HARVARD UNIVERSITY
Ernst Mayr Library
of the Museum of
Comparative Zoology
I
Volume 8 • 1999
Editor
Ermi Zhao
Chengdu Institute of Biology, Academia Sinica, Chengdu, Sichuan, China
Associate Editors
Kellar Autumn
Lewis & Clark College, Portland, Oregon. USA
J. Robert Macev
Department of Biology. Washington University. St. Louis.
Missouri, USA
Theodore J. Papenfuss
Museum of Vertebrate Zoology. University of California.
Berkeley. California. USA
Editorial Board
Kraig Adler
Cornell University. Ithaca, New York. USA
Natalia B. Ananjeva
Zoological Institute. St. Petersburg. Russia
Steven C. Anderson
University of the Pacific. Stockton, California. USA
Aaron Bauer
Villanova University, Villanova, Pennsylvania. USA
Christopher Bell
University of Texas. Austin, Texas. USA
Leo Borkin
Zoological Inslilule. St. Petersburg. Russia
Bihui Chen
Anhui Normal University, Wuhu. Anhui. China
I i Cheng
Inslilule oi Marine Biology. National Taiwan Ocean University,
Keeking. Taiwan. China
Ilya Darevsky
Zoological Institute, St. Petersburg, Russia
Indraneil Das
Madras Crocodile Bank. Vadanemmeli Peiur. Madras. India
William E. Duellman
University of Kansas. Lawrence, Kansas. USA
Hajime Fukada
Sennyuji Sannaicho, Higashiyamaku, Kyoto. Japan
Carl Cans
University of Michigan. Ann Arbor. Michigan. USA
Robert F. Inger
Field Museum. Chicago, Illinois, USA
Xiang Ji
Hang/hou Normal College. Hangzhou. Zhejiang, China
Pi-peng Li
Yantai Normal College, Yanlai. Shandong. China
Ronald Marlou
I niversitj oi Nevada, Las Vegas. Nevada, I S \
Robert W. Murphy
Royal Ontario Museum. Toronto, Ontario. Canada
(.nun Nilson
University of Goteborg, Goteborg, Sweden
Nikolai Orlov
Zoological Institute, Si Petersburg, Russia
Hidetoshi Ota
Department oi Biology, University of the Ryukyus. Nishihara.
Okinawa, Japan
James F. Parham
University of California, Berkeley. California. USA
Soheila Shafii
University ol Shahid Bahonar, Kerman, Iran
Hai-tao Shi
Hainan Normal University, Haikou, Hainan. China
\iu-ling Wang
Xinjiang Normal University, Urumqi, Xinjiang. China
Yue-zhao Wang
Chengdu Institute of Biology. Academia Sinica, Chengdu.
Sichuan. China
Yehudah Werner
Hebrew University, Jerusalem. Israel
Ken-tang Zhao
Suzhou Railway Teacher's College. Suzhou. Jiungsu China
Asiatic Herpetological Research is published by the Asiatic Herpetological Research Society (AHRS) and the Chinese So-
ciety for the Study of Amphibians and Reptiles (CSSAR)at the Museum of Vertebrate Zoology. University of California. The
editors encourage authors from all countries to submit articles concerning hut not limited to Asian herpetology. All correspon-
dence outside of China and requests for subscription should be sent to AHR. Museum of Vertebrate Zoology. University of
California. Berkeley. California, USA 94720. or by email to [email protected]. All correspondence within Chi-
na should be sent to Ermi Zhao. Editor, Chengdu Institute of Biology, P.O. Box 416. Chengdu, Sichuan Province. China. Au-
thors should consult Guidelines for Manuscript Preparation and Submission at the end of this issue. Subscription and
membership are $25 per year ($45 for libraries). Postage outside of the USA and China, please add $5 per issue for surface
mail or $10 per issue for air mail. Make checks or money orders payable in US currency to AHRS. If you do not have access
to US currency, please notify us. and we will make other arrangements.
Asiatic Herpetological Research Volume 8 succeeds Volume 7 published in 1997. Vol. 6 published in 1995. Vol. 5 published
in 1993, Vol. 4 published in 1992. Vol. 3 published in 1990 and Chinese Herpetological Research Vol. 2. which was pub-
lished at the Museum of Vertebrate Zoology. 1988-1989 as the journal for the Chinese Society for the Study of Amphibians
and Reptiles. Volume 2 succeeded Chinese Herpetological Research 1 987. published for the Chengdu Institute of Biology
by the Chongqing Branch Scientific and Technological Literature Press. Chongqing. Sichuan. China. Acta Herpetologica
Sinica ceased publication in June, 1988.
Cover: Cuora galbinifrons. Diaoluoshan, 18 km N. of Nanxi. Hainan Province, China. Photo by James F. Parham.
1999
Asiatic Herpetological Research
Vol. 8, pp. 1-6
The Activity and Thermal Biology of the Fossorial Reptile, Diplometopon
zarudnyi (Amphisbaenia: Trogonophiidae) in Central Saudi Arabia
AWADH M. AL-JOHANY
Department of Zoology, College of Science, King Saud University, P.O.Box 2455, Riyadh II 45 1, Saudi Arabia.
Abstract .- The nocturnal activity of the fossorial amphisbaenid Diplometopon zarudnyi was studied in the field
and its thermal selection and tolerance were determined in the laboratory. During the study period (summer) the
animals commenced activity at 20.00 hrs (ground temperature 30-32°C) and finish their foraging between 3.00 to
4.00 hrs (ground temperature 28-26°C) before the break of dawn. The mean activity temperature determined in
the field was 31.5°C, which was usually 0.5 to 1°C higher than the ground temperature. The mean selected body
temperatures in a gradient during day and night were 26.4°C (range 15-38°C) and 26.3°C (range 14-38°C)
respectively. The Critical Thermal Maximum was 47.6°C and the Critical Thermal Minimum was 7°C. D.
zarudnyi tolerates a wide range of temperatures while maintaining its mean body temperature within a narrow
range. The role of Selected Body Temperature is discussed in relation to metabolism.
Key words.- Amphisbaenia, Trogonophiidae, fossorial reptile, Diplometopon zarudnyi, Saudi Arabia, Central
Arabia, activity, thermal preference, thermal tolerance.
Introduction
The amphishaenian family Trogonophiidae is repre-
sented in central Arabia by the single species Diplom-
etopon zarudnyi ( Al-Sadoon, 1988). The range of this
species extends to northern Arabia and the coastal
Arabian Gulf (Arnold, 1986). D. zarudnyi is an oscil-
lating digger, commonly found burrowing in low sand
dunes in open terrain and in sub-surface soils of date
palm farms. This amphisbaenian is a nocturnal for-
ager, sometimes occupying ant and termite tunnels.
In this study the nocturnal activity of D. zarudnyi
was studied in the field, and its thermal selection and
temperature tolerance were determined in the labora-
tory. A comparison of results of this study has been
made with the results of other species from different
geographical habitats.
Material and Methods
Several field trips were made during the summer sea-
son (July- August.) to habitats of D. zarudnyi located
around Riyadh city (Thummama and Dilam). Noctur-
nal activity of the animals was observed during the
activity period. Rechargeable fluorescent lanterns
were employed to illuminate the area being studied.
When tracks appeared on the sand surface, they were
followed up to the location of the animal, which was
either dug out of its subsurface position by hand or
using a small hand shovel. Soil temperature (Ts), air
temperature (Ta) and cloacal body temperature (Tb)
were taken within 15 seconds of capture by a quick
reading cloacal thermometer (Millar and Weber Co.,
Figure 2. Setup used to measure the selected body
temperature: (1) Telethermometer, (2) Thermal gradi-
ent, (3) Thermostat heater, (4) Cooling coil in water
bath, (5) Refrigerant machine, (6) 10 cm thick sand
layer, (7) 100 W heating bulb, (8) Thermistor probe.
U.S. A). Air and ground temperature were also moni-
tored every hour from dusk to dawn.
Thirty D. zarudnyi (adult animals of both sexes)
were used in the laboratory study (mean mass = 7.63
g, SD ± 2.54; mean SVL=182 mm, SD ± 13.4; mean
VTL=14 mm, SD ± 2.0). They were collected from
various locations around Riyadh city. They were
maintained for short periods in Plexiglass boxes filled
with 10 cm of clean sand. The sand was sprinkled
periodically with water. Mealworms and water were
available ad lib. The laboratory temperature was 23 ±
1.5°C.
The Selected Body Temperature (SBT) of ten
amphisbaenians was determined in a metal thermal
Vol. 8, p.
Asiatic Herpetological Research
1999
Figure 2. Method employed to tie the thermistor; the
probe (1) inserted inside the animal's cloaca and
looped to be held on the tail (2) with bands of adhesive
tape.
gradient which measured 200 x 25 x 40 cm (Fig.l).
Sand was spread evenly to a depth of 10 cm on the
base of the gradient. A temperature gradient from 10-
50°C was achieved by fitting a thermostatic hot plate
below one end and by placing an insulated ice con-
tainer constantly frozen by an immersion refrigerant
coil on the other end. The surface sand at the cool end
was sprinkled with water intermittently to prevent
desiccation. The gradient was illuminated by two 100
watt bulbs suspended 80 cm from the surface of the
sand controlled by an electronic timer to maintain the
photoperiod. The animals were left in the gradient for
one day prior to the start of the experiment for accli-
mation.
The cloacal body temperature (Tb) was monitored
with high sensitivity probes (Model 511; Yellow
Springs Inc.). The probes were connected to a multi-
channel YSI Telethermometer, and an Omniscribe
Houston Instruments continuous chart recorder. The
flexible tip of the pre-calibrated probe was inserted for
1 cm into the cloaca and held in place with 3-4 mm
bands of adhesive tape (Fig. 2). The probes remained
in place even when the animal burrowed below the
sand. Twenty four hour continuous recording of Tb
was obtained for three days on each animal and one
measurement for each hour was recorded.
These instruments were also used to measure the
Critical Thermal Maximum (CTMax) and the Critical
Thermal Minimum (CTMin). CTMax is the arith-
metic mean of the collective thermal points at which
locomotor activity becomes disorganized and the ani-
mal loses its ability to escape from conditions that
will promptly lead to its death. CTMin is the low tem-
perature that produces cold narcosis and prevents
locomotion (Pough and Gans, 1982). A sheet metal
box (25 X 20 cm) filled with a layer of sand and kept
above a thermostat heater was employed to measure
CTMax. For CTMin, a Plexiglass box (25 X 15 cm)
with a layer of sand held inside a larger insulated box
surrounded by ice cubes was employed. Twenty dif-
ferent animals ( 10 for each category) were used. Each
animal was gradually heated or cooled inside the
experimental chambers ( 1 °C increase or decrease per
minute). The probe remained inserted in the cloaca
and the body temperature was monitored continu-
ously while the test chamber sand was gradually
heated or cooled.
To determine the CTMax and CTMin, the amphis-
baenian was observed until the animal lost its righting
response when it was turned on its back. During the
CTMin experiments, after initial cooling (9.5°C), the
animal lost its ability to right itself but, after its belly
was touched by a fine paint brush, the animal exhib-
ited a wave of convulsions down the body. Further
cooling led to total loss of all responses, and the tem-
perature at which this occurred was designated as the
CTMin. All but one experimental animal survived
after returning to room temperature. After 10 days, the
animals which were used for CTMax experiments
were used to measure CTMin. The CTMin of these
animals was compared to that of the first group.
Statistical analysis was performed using GLM
procedure of Minitab package (version 8.2). Two-way
analysis of variance (ANOVA) with interaction
(unbalanced) was used for data analysis (P=<0.05).
Results
The nocturnal activity of the animals is clearly defined
during summer nights. Emergence for foraging activ-
ity begins at 22.00 hrs when the air temperature is 30-
32 °C and the ground temperature is 32-34°C. The
foraging activity subsides between 03.00 to 04.00 hrs
when the air temperature is 28-26°C and the ground
temperature is 27-25°C. After this the animals move
deeper into the sand surface (presumably to their bur-
rows or refuges) and no kind of activity is observed
during the daylight hours.
The animals were active between adjacently
located shrubby small sand dunes. Most of these sand
dunes hosted colonies of ant and termite mounds.
Movement is typically a combination of sub-surface
and surface locomotion. Undisturbed movement of
the animal over the surface of the sand was observed
only two instances. On the rest of the occasions the
animals were tracked by their impressions in the sand.
The animals move just below the surface of the sand
for two or three meters by piercing and wiggling by
strong head and body movement (probably in search
of termites). After that they come out on the surface
and effortlessly glide on the sand surface for several
meters by fast subsequent spring action. This was
done by making an VS' shape of the body and flicking
forward. Consequently this kind of activity leaves a
distinct pattern of tracks on the sand surface which
1999
Asiatic Herpetological Research
Vol. 8. p. 3
35 0-i
32.5
30.0
E
i
E
a
m 27.5
250
r= 0.6648
P=0.0132
n=13
27
— i —
28
29
30
31
32
33
34
35.0
O
32.5
300
■- 27.5-
25.04
r=06588
P=0.0143
n=13
B
27
28
29
31
33
34
Body Temperature 'C
Figure 3. A. Relationship between body temperature
(Tb) and soil temperature (Ts). B. Relationship
between body temperature (Tb) and air temperature
(Ta). (The regression line, significance value and sam-
ple size are as indicated).
can be easily differentiated between the tracks of
other animals of the habitat.
The mean field body temperature for the active
animals captured was 31.5°C (range 29.5 - 32.5°C;
n=13). Regression analysis showed a significant dif-
ference between the T\, - Ta and T^, - Ts (P<0.05; Fig.
3). The mean selected temperatures in the gradient
during the day and night were 26.4°C (SD ± 5.2) and
26.3 °C (SD ± 5.7) respectively; the temperatures
selected during day ranged between 15 and 38°C and
between 14 and 38°C during the night (Fig.4). About
ninety percent of D. zarudnyi selected temperatures
between 23 and 36°C during the day and between 21
and 36 C during the night. Temperature selected did
not differ significantly between day and night
(F=0. 14, P=0.705). However, individuals differed sig-
nificantly in temperatures selected (F=l 27.37,
P=0.001 ). Also, there was a highly significant interac-
tion between individuals and the time of day (F=7.72,
P=0.001 ). The average hourly temperature pattern of
D. zarudnyi showed a gradual increase of body tem-
perature (in the gradient) and reached its highest level
just before the end of the dark period (Fig. 5), and a
s
I
0
M
%-
C
16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38
Temperature "C
Figure 4. Representation of body temperature selec-
tion (%) by Diplometopon zarudnyi in the thermal gra-
dient during day and night periods.
gradual decrease of body temperature to its lowest
value by the end of the light period.
During the CTMax trials, animals below the soil
surface emerged when the sand temperature reached
40°C. The CTMax was 47.6°C. During the CTMin
trials, the animals lost the righting reflex at 9.4°C
(SD±1) and CTMin was 7°C (SD±0.6). The second
group of animals used in measuring CTMin lost the
righting reflex at 11.3°C (SD±1.1) and CTMin was
reached at 9.5°C (SD±0.5).
Discussion
D. zarudnyi come out of their refuges at night when
the air temperature and the soil surface temperature
are favorable. By employing two kinds of locomotion
the task of foraging is accomplished. They expend
vigorous efforts on their foraging activity, since they
have to accomplish it in a short duration: multiple
tracks crossing each other were observed for a single
animal in a wide area, giving a false impression of
many animals being active. This lead to many dead
ends while following the leads of the tracks.
Previous reports (gradient studies) assumed that
the body temperatures of amphisbaenians are equal to
soil temperatures, since readings were obtained from
the soil surrounding the animals. For a more accurate
evaluation, here, we recorded body temperatures
direct and continuously in the thermal gradient.
The selected mean temperature in the gradient
(26°C) measured in this study explains the Metabolic
rate-Temperature curve (M-T curve) reported for D.
zarudnyi; in which both the adults (mean wt.6.34 g)
and sub-adults (mean wt.3.15 g) showed stable Ot
consumption rates between 25-30°C (Al-Sadoon,
1986).
Vol. 8, p. 4
Asiatic Herpetological Research
1999
28.0
27.5
27.0
a
I 26.5
26.0
255
25.0
24 5
24.0
O
Q.
E
«
n=10
_i — i — i — 1_
18 h
24 h
6h
12h
18 h
Time
Figure 5. Mean selected body temperature pattern of Diplometopon zarudnyi in the thermal gradient during 24
hours. Numbers at each point indicate the SEM.
The body temperature for active D. zarudnyi are
higher in the field than in the laboratory because the
animals were deprived of food during the experiment,
and also may be the result of confinement to a limited
space in the gradient. Van Berkum (1980) demon-
strated that the SBT is lower in lizards with decreased
food consumption. It is recommended to measure
metabolism during the post absorptive state of diges-
tion, so as to minimize any contribution of specific
dynamic action (Eckert and Randall, 1983).
As D. zarudnyi is fossorial, the low mean selected
temperature (26°C) could extend activity and stabilize
body metabolism in the sub-surface habitat. The
present results supplement the previous published
reports of lower temperature selection in amphisbae-
nians. Avery (1982) noted that many fossorial snakes,
amphisbaenians, sea snakes, fresh water and marine
turtles, appear not to thermoregulate and that many
select low temperatures. Evidence of thermoregula-
tion in Amphisbaena mertensi was reported by Abe
(1984); mean field body temperature and preferred
temperature in the gradient was 21.1°C and 21.4°C
respectively. Also, Martin et. al. (1990) reported
marked field thermoregulation in Blanus cinereus and
it selected low field body temperatures. Gatten and
McClung ( 1981 ) reported the low mean body temper-
ature for Trogonophis weigmanni in a range of 21.7°C
to 23.4°C. A field study of Bipes biporus demon-
strated that this worm lizard can thermoregulate if
necessary, by vertical and horizontal changes in sub-
strate positioning (Papenfuss, 1982). More recently,
Diaz-Paniagua et al., (1995) during a field study of
seasonal and diel activity of Blanus cinereus, reported
an activity range of ground temperatures between
13.4 -27.8°C which is low and as well clearly indi-
cates thermoregulation.
The low temperature selection of D. zarudnyi is
also in line with the observations made on other bur-
rowing species of reptiles. Bury and Bolgooyen
(1976) determined the thermal preferendum of the
legless burrowing lizard Anniella pulchra to be 24-
25°C. Clark ( 1968) reported five subterranean species
of small snakes to select lower temperatures than sur-
face dwelling species. Burrowing snakes of the family
Uropeltidae also appear to select a low body tempera-
tures between 18°C and 20°C (Gans,1973). Low
selected body temperatures were also reported for
Anguis fragilis (Gregory, 1980).
A previous study showed that D. zarudnyi had no
endogenous circadian rhythm and no periodicity in
alternating light and darkness although it was more
active at high temperatures (Cloudsley-Thompson,
1979). The finding in the present study wherein
Diplometopon showed no significant difference
between day and night time temperature selection is
consistent with the lack of an endogenous circadian
rhythm in temperatures selected in day and night.
However, in the present results there is a highly sig-
nificant difference among individuals. This is proba-
bly due to individual differences in body weight,
health status, age and sex of the animals tested.
In the gradient D. zarudnyi elevated its body tem-
perature slightly in the second half of the night, a time
when they were seen to forage actively in the field. In
contrast, T. wiegmanni tested in a thermal gradient
showed elevated temperatures in the afternoon and
early evening (Gatten and McClung, 1981). Foraging
activity at dawn and in early morning also is reported
1999
Asiatic Herpetological Research
Vol. 8, p. 5
for Agamodon anguliceps from Somalia; the animals
were located in the top 2-3 inches of the soil at dawn,
appearing to have moved upwards during the night.
As temperatures rose, most animals disappeared from
the top 6-12 inches of the ground (Gans and Pandit.
1965).
The CTMax value for Diplometopon is similar to
that of certain terrestrial lizards of Central Arabia, but
the CTMin was higher than that reported for most
other sympatric lizards (Al-Johany, 1986). The rela-
tively high CTMin might be related to the subterra-
nean temperatures encountered by Diplometopon
which seldom fall below freezing, unlike the surface
temperatures which may drop below 0 °C. The 2.5 °C
increase in the CTMin for animals that had experi-
enced the CTMax might be attributed to a short-time
heat-hardening effect (see Maness and Hutchison,
1980).
Prior to this study there was no data available on
the held thermal ecology of D. zarudnyi. By the com-
bined result of the field and laboratory study it is now
confirmed that the animal is a thigmotherm but not in
its strict sense. Since it was observed that the animal
manages (probably by metabolic activity) to keep its
body temperature a degree or half higher than the
ground temperature.
Acknowledgments
I am thankful to Dr.Carl Gans, Department of Biol-
ogy, University of Michigan, for helpful comments
and to Dr.Roger Avery, University of Bristol, for
meticulous reading of the manuscript. Thanks are also
due to Mr. Mohammed Yousuf for help in field work,
technical assistance in the laboratory and typing of the
manuscript.
Literature Cited
Abe, A. S. 1984. Experimental and field record of pre-
ferred temperature in the neotropical amphisbaenid
Amphisbaena mertensi Stauch (Reptilia, Amphis-
baenidae). Comparative Biochemistry and Physiology
77A: 251-253.
Al-Johany, A. M. H. 1986. Ecology and reproductive
biology of Acanthodactylus schmiditi in Central Ara-
bia. Ph.D.Thesis. University of Southampton. U.K.
pp.
Al-Sadoon, M. K. 1986. Influence of a broad tempera-
ture range on the oxygen consumption rates of three
desert lizard species. Comparative Biochemistry and
Physiology 84A: 339-344.
Al-Sadoon. M. K. 1988. Survey of the reptilian fauna
of the Kingdom of Saudi Arabia II. The lizard and
amphisbaenian fauna of Riyadh province. Bulletin
ofMaryland Herpetological Society 24: 58-76.
Arnold, E. N. 1986. A key and annonated check list to
the lizards and Amphisbaenians of Arabia. Fauna of
Saudi Arabia. 8: 385-432.
Avery, R. A. 1982. Field studies of body temperature
and thermoregulation. Pp 93-166. In: C.Gans and
F.H.Pough (eds), Biology of the Reptilia Vol 12, Aca-
demic Press, London.
Bury, R. B. and T.G. Bolgooyen. 1976. Temperature
selectivity in the legless lizard, Anniella pulchra.
Copeia 1976: 152-155.
Clark, D. R. Jr. 1968. Experiments into selection of
soil type, soil moisture level and temperature by five
species of small snakes. Transactions of Kansas Acad-
emy of Sciences 70: 490-496.
Cloudsley -Thompson, J.L. 1979. Water loss and loco-
motory activity in Agarna persica and Diplometopon
zarudnyi from Kuwait. Journal of Arid Environments
2: 273-277.
Diaz-Paniagua, C, M.C. Blazquez, C. Keller, A.C.
Andreu.G. Olmedo and J. A. Mateo. 1995. Observa-
tions on seasonal and dial surface activity of the
amphisbaenian Blanus cinereus in south-western
Spain. Herpetological Journal Vol.5: 217-220.
Eckert, R., and D. Randall. 1983. Animal Physiology,
Mechanisms and Adaptations, 2nd Edition, W.H.
Freeman & Co., New York.
Gans, C. 1973. Uropeltid snakes - survivors in a
changing world. Endeavor. 32: 60-65.
Gans, C. and H.M. Pandit. 1965. Notes on a herpeto-
logical collection from Somali republic V. The
amphisbaenian genus Agamodon Peters. Ann. in 8
Zool., R.G. Mus. Afr. Cent. 134: 71-86.
Gatten, R. E. Jr. and R.M. McClung. 1981. Thermal
selection by an amphisbaenian Trogonophis wieg-
manni. Journal of Thermal Biology 6: 49-51.
Gregory, P. T. 1980. Physical factor selectivity in the
fossorial lizard Anguis fragilis. Journal of Herpetol-
ogy 14: 95-99.
Maness, J.D. and V.H. Hutchison. 1980. Acute adjust-
ment of thermal tolerance in vertebrate ectotherms
following exposure to critical thermal maxima. Jour-
nal of Thermal Biology 5: 225-233.
Martin. J., P. Lopez and A. Salvador. 1990. Field body
temperatures of the amphisbaenid lizard Blanus
cinereus. Amphibia-Reptilia 1 1 : 87-96.
Vol. 8, p. 6 Asiatic Herpetological Research 1999
Papenfuss, T.J. 1982. The ecology and systematics of
the amphisbaenian genus Bipes. Occational Paper,
California Acadamy of Sciences 136: 1-42.
Pough, F.H. and Gans, C. 1982. Biology of the Rep-
tilia, Vol.12 Physiology C. Academic Press, London.
Templeton, J.R. 1970. Reptiles. Pp. 167-221. In:
Whittow, G.C (ed), Comparative physiology of ther-
moregulation. Vol. 1. Academic Press, New York.
van Berkum, F.H. 1980. The significance of preferred
body temperature of lizards. American Zoologist 20:
734.
1999
Asiatic Herpetological Research
Vol. 8, pp. 7-12
Description of a New Species of Pseudorabdion (Serpentes: Colubridae) from
Panay Island, Philippines with a Revised Key to the Genus
Rafe M. Brown1'2, Alan E. Leviton3, and Rogelio V. Sison4
Section of Integrative Biology and Texas Memorial Museum, University of Texas, Austin, Texas, 78712
([email protected]); "Geier Collections and Research Center, Museum of Natural History and Science,
Cincinnati Museum Center. 1720 Gilbert Avenue, Cincinnati, OH 45202-1401: •Department of Herpetology,
California Academy of Sciences, San Francisco, CA 941 18 (leviton® sfsu.edu); 4 Zoology Department, Natiotud
Museum of the Philippines, Executive House, P. Burgos Street, Manila, Philippines ([email protected]).
Abstract.- We describe a new species of snake in the colubrid genus Pseudorabdion from the western coastal
mountain range of Panay island, Philippines. The new species appears to be related to the members of the P.
mcnamarae species group (P. mcnamarae and P. taylori from the Philippines, P. albonuchalis, and P.
saravacensis from Borneo, and P. sarasinorum from Sulawesi) but differs from each of these species by
characters of scalation and color pattern. The new species is one of several other recently-discovered vertebrates
from Panay island. Together, these discoveries suggest that diversity and endemism patterns of the Negros-Panay
Pleistocene aggregate island platform (Negros, Panay, Cebu and Masbate islands) are more complex and
interesting than previously thought.
Introduction
While engaged in a biological reconnaissance survey
of the western coastal mountain range of Panay Island
(Fig. 1 ), the senior author collected two specimens of
what appeared at the time to be Pseudorabdion
mcnamarae, a species already well know from Negros
Island. On closer examination it was discovered that
the Panay specimens differed in significant details
from the Negros population while sharing features
with P. taylori, known from Mindanao, and with P.
albonuchalis, a species earlier known only from the
type specimen (but see Inger and Leviton, 1966),
which can no longer be located, and said to have come
from Sarawak, Borneo. The observed differences
among these related species leads us to believe that
the Panay specimens represent a previously unrecog-
nized, taxonomically distinct population of Pseudo-
rabdion allied to the section of the genus
Pseudorabdion whose members possess an elongate
loreal (lori-ocular) that borders the orbit anteriorly.
Pseudorabdion
cies (Figs. 2-3)
talonuran new spe-
Holotype: PNM 2712 (Field no. PNM/CMNH 671),
adult male, collected on western foothills of Mt.
Madja-as ( 1 1°23' N, 122°09' E; elev. 1500 m), Baran-
gay Allojipan, Municipality of Culasi, Antique Prov-
ince, Panay Island, Philippines, 28 May 1992 by Rafe
Brown and Roger Sison.
Paratype: CMNH 5076 (Field no. PNM/CMNH
670), young male, other data as for holotype except it
was collected at 1410 m.
Etymology: The specific epithet is chosen from the
Antique Province dialect Caray-a, and is derived from
the words, "talon" (forest) and "uran" (rain), in refer-
ence to the high elevation rain forest habitat where the
new species was collected on Mt. Madja-as.
Diagnosis: Elongate loreal (=Iori-ocular) present,
extending from the posterior border of the nasal to the
orbit of the eye; ventrals (M) 139-146; subcaudals
(M) 36-39; total of ventrals plus subcaudals (M) 175-
185; scales of dorsum each edged with a mottling of
brown pigment, the posterior and central portions of
each scale pale, lacking a dense infusion of dark pig-
ment, the lateral and latero-ventral scales with larger
pale areas than those on the dorsum; no distinct
nuchal collar but pattern of pale centers and dark rims
characterizes nuchal scales and head shields, which
are somewhat mottled dark and light.
Pseudorabdion talonuran belongs to the section of the
genus Pseudorabdion characterized by the presence
of a loreal (lori- ocular) shield. From the allied Philip-
pine P. mcnamarae, it differs in lacking a pale nuchal
color in adults and in having more than 30 subcaudals
in both males and females; from P. taylori it differs in
having the centers and apical tips of the dorsal scales
nearly pigmentless whereas in P. taylori the centers
are pale brown, and in having the hemipenes minutely
This paper represents contribution number 23 to the results of the National Museum of the Philippines/
Cincinnati Museum of Natural History Philippine Biodiversity Inventors- (PNM/CMNH PB1)
Vol. 8, p. 8
Asiatic Herpetological Research
1999
spinose (in P. taylori the apical tips are calyculate).
Among the non-Philippine species having a lori-ocu-
lar, P. talonuran differs from P. sarasinorum in having
the anterior chin shields in contact with the mental,
from P. albonuchalis in having fewer subcaudals (36-
39 vs. 43) and the frontal not border the eye, and from
P. saravacensis in having a greater number of subcau-
dals (36-39 vs. fewer than 30) and fewer maxillary
teeth (8 vs. 14). From the remaining species in the
genus, it differs in having an elongate loreal (lori-ocu-
lar) shield that borders the eye.
Description of holotype: (Adult male) Rostral as
high as wide, portion visible from above slightly
greater than length of internasal suture; internasals
small, greatest length about one-half greatest length of
prefrontals, in contact with rostral, nasal, loreal and
prefrontal: common suture between prefrontals about
four-fifths length of frontal: prefrontal bordering eye
between loreal and supraocular, also in contact with
internasals; left prefrontal in contact with both inter-
nasals (because internasal suture offset from midline):
frontal two-thirds length of parietals, subtriangular,
three-fourths as wide as long, in contact with prefron-
tals, supraocular and parietals, but not bordering eye;
supraocular distinct, not fused to ocular brill; maxi-
mum length of parietals slightly greater than distance
to tip of snout; nasal quadrangular, undivided, resting
on first and in contact with second supralabials, nostril
pierced in anterior lower quadrant; loreal elongate,
resting on second and third supralabials. about twice
as long as its distance to tip of snout, bordering eye;
preocular absent (or more likely fused to form an
elongate loreal [lori-ocular]); postocular, subquadran-
gular, about one half size of supraocular, in contact
with fourth and fifth supralabials, not as high as eye,
its lower border extending below level of eye and
inserting between two supralabials; eye small, its
diameter equal to its distance from mouth, pupil
round; five supralabials and one large postsupralabial,
supralabials three and four border eye, fifth largest
and broadly in contact with parietals, followed by
third, second, fourth, and first in descending order of
-12
-11°
40 km
Borneo '
^'■"121° 124°
] 0-150
] 150-400
400-800
800-1200
1200-1600
>1600
Fig. 1 . Map of Panay Island, showing its position in the Philippines (inset), major cities (darkened circles), provinces
(dashed lines; names underlined) and elevational topography (see key). The type locality (Mt. Madja-as) of Pseu-
dorabdion talonuran is indicated with a star.
1999
Asiatic Herpetological Research
Vol. 8, p. 9
Fig. 2. Dorsal (A) and lateral (B) views of head of holo-
type of Pseudorabdion talonuran.
size; one large "posterior temporal" between postla-
bial and parietal; mental in contact with elongate ante-
rior chin shields; infralabials five, first three in contact
with anterior chin shields, third and fourth bordering
posterior chin shields; posterior chin shields about
three-fourths length of anterior pair, separated from
one another in the midline for two-thirds their length
by insertion of a gular scale, and about same size as
bordering gular scales; maxillary teeth eight.
Scales smooth, without apical pits, in 15 longitu-
dinal rows, not reducing posteriorly before vent; ven-
trals 146 mm; subcaudals 39 mm, paired; anal
undivided.
Hemipenes extend in situ to 8th subcaudal plate,
forked at the level of the 6th plate; apical ends with
minute spines.
Total length 265 mm; tail 46 mm; head length (tip
of snout to angle of jaws) 1 1.25 mm, (tip of snout to
posterior edge of parietals) 9.1 mm; diameter of eye
0.8 mm.
Color pattern (in alcohol): Dorsal scales each with
irregular dark borders; apical end and centers pale,
nearly pigmentless, pigmentless areas larger and more
distinct laterally; ventrals unpigmented except for lat-
eral edges; no nuchal collar.
Paratype: The paratype, a young male, differs from
the holotype in the following particulars: ventrals 139;
subcaudals 36; snout-vent length, 265 mm; tail length
47 mm; apical ends of hemipenes do not appear to be
spinose (but the everted organ is poorly preserved and
difficult to examine).
Ecological notes: The forest habitat of the new spe-
cies on Mt. Madja-as (Fig. 4) has been classified by
Whitmore (1984) as the transition zone between
mixed dipterocarp (submontane) and mossy (upper
montane) forests. The forest consists of two strata, a
canopy of 10 m and subcanopy of 3-4 m with emer-
gent trees as high as 18 m; an herb and shrub layer
vegetation was also present. The forest near the col-
lection site was mossy and contained high densities of
epiphytic ferns and orchids. The topography was
qualitatively characterized as steep, with numerous
sheer rocky valleys and forest-covered ridges (see
Ferner, et al., 1997 for more details.) Both holotype
and paratype were found beneath logs.
Remarks: The section of the genus Pseudorabdion
characterized by the presence of an elongate loreal
(lori-ocular) that borders the orbit, termed here the
"mcnamarae" section, includes three species in the
Philippines, P. mcnamarae, P. taylori, and P. talonu-
ran, and three non-Philippine species, P. albonuchalis
and P. saravacensis from Sarawak, and P. sarasi-
norwn from Gunung (Volcano) Soudara, Sulawesi.
Five species (P. longiceps, P. ater, P. oxycephalum,
P. eiselti, and P. montcmum) lack the loreal (lori-ocu-
lar); the prefrontals are in contact with the second and
third upper labials. Of the forms lacking a distinct
Fig. 3. Dorsal view of holotype (PNM 2712) of Pseudorabdion talonuran.
Vol. 8, p. 10
Asiatic Herpetological Research
1999
Fig. 4.Cloud forest habitat of Pseudorabdion talonuran at the type locality: Mt. Madja-as, Antique Province, Panay
Island, Philippines.
loreal (or if a small scale is present in the loreal posi- that its high elevation montane regions warrant more
tion, a rare occurrence among this group, it is neither intensive biodiversity survey efforts in the near future.
elongate nor does it border the orbit), P. oxycephalum,
P. ater, and P montanum are confined to the Philip- Key tO the Species of Pseudorabdion
pines, f! me/ft is known only from the type locality at
Padang, Sumatra, and P. longipes has been collected (Modified from Inger and Leviton, 1966)
at many localities on the islands of Borneo, Sulawesi, ia Lori-ocular (loreal) shield absent (if present, does
Nias, and Sumatra, from Singapore and elsewhere not border orbit); prefrontal in contact with upper
north along the Malay Peninsula, from the Riau labials 2
(Riou) Archipelago, and as far north as Ban Gnara and ^ Lori.ocular shidd presem very distincti elongate,
Patani, in southern Thailand. borders orbit; preftontal not in contact WIth upper
The presence of this new, endemic species of labials 7
snake in the coastal mountains of western Panay ^ Preocular present; supraocular present; internasal
island further bolsters our suspicion that the level ot ^ fa ^^ ^ upper labia,s; maxillary teeth , , .
endemism on Panay is greater than previously p longipes
thought. By virtue of the fact that Panay was intermit-
tently connected to Negros and Cebu at various points 2b. Preocular absent; supraocular present or absent;
during the Pleistocene (Heaney, 1986), biogeogra- internasals almost always in contact with upper labial^
phers have justifiably expected that these islands to
possess a high percentage of faunal elements in com- 3a. Supraocular absent; frontal borders orbit; nasal
mon (Leviton. 1963; Brown and Alcala, 1970). Never- divided; maxillary teeth 10 or more 4
theless, recent discoveries of other vertebrates 3^ Supraocular present; frontal does not border orbit;
endemic to Panay (Gonzales and Kennedy, 1990, nasa] undivided; maxillary teeth 10 or less 5
1996; Brown et al.. 1997; Ferner et al., 1997) suggest ^ Postocular absent; masmsay teeth 10 P. ater
1999
Asiatic Herpetological Research
Vol. 8, p. 1 1
4b. Poslocular present; maxillary teeth 22-25
P. collaris
5a. Postocular not fused to supraocular: ventrals 130;
suhcaudals 12 P. eiselti
5b. Postocular and supraocular fused; ventrals greater
than 140; suhcaudals greater than 15 6
6a. Each scale of outer row with dark centers and pale
borders; ventrals uniformly dark brown except for
extreme posterior outer edges which are pale; ocular
shield usually fused to combined supra- and postocu-
lars; suhcaudals (M) 22-24, (F) 16- 17
P. oxycephalum
6b. Each scale of outer row with pale centers: ventrals
whitish with dark brown more or less confined to a
broad median band; ocular shield not fused to com-
bined supra- and postoculars; suhcaudals (M) 28; (F)
21-24 P. montanum
7a. Anterior chin shields not in contact with mental:
nasal shield divided P. sarasinorum
7b. Anterior chin shields in contact with mental; nasal
shield not divided 8
8a. Maxillary teeth greater than 15 9
8b. Maxillary teeth fewer than 10 10
9a. Ventrals greater than 125; suhcaudals greater than
40 P. albonuchalis
9b. Ventrals fewer than 120; suhcaudals fewer than 30
P. saravacensis
10a. Pale nuchal collar usually present; suhcaudals
1 7-30; distal portion of hemipenes minutely spinose
P. menamarae
10b. Pale nuchal collar absent in adults; suhcaudals
greater than 30 11
I la. Dorsal scales uniform pale brown, each scale
thinly edged with pigmentless border; distal portion
of hemipenes calyculate P. taylori
1 lb. Dorsal scales with pale, nearly pigmentless cen-
ters and apical tips, anterior borders of each scale with
brown mottling, larger areas of latero-ventral scales
devoid of dark pigment; hemipenes minutely spinose
P. talonuran
Acknowledgments
We thank The Protected Areas and Wildlife Bureau
(PAWB) of the Philippines Department of the Envi-
ronment and Natural Resources (DENR) for facilitat-
ing collecting and export permits necessary for the
field work that contributed to this study. For logistical
assistance in the Philippines, we thank Corazon Cati-
bog-Sinha (DENR), A. Alcala (Silliman University),
P. Gonzales (PNM), R. Kennedy (CMNH) and the
provincial DENR authorities of Antique Province.
For the loans of specimens, we thank the follow-
ing individuals and their respective institutions
(museum acronyms, with the exception of CMNH.
follow Leviton et al., 1985): J. Vindum and R. Drewes
(CAS), R. Kennedy and J. Ferner (CMNH), and P.
Gonzales (PNM). Financial support for RMB's travel
to CAS was provided by the C. Stearns Fellowship of
the California Academy of Sciences. We thank J. Bar-
celona (PNM) for assistance with the Caray-a deriva-
tion of the new species name.
Support for RMB's field work was provided by the
Society for the Study of Amphibians and Reptiles, the
Roschman Student Enrichment fund of the College of
Arts and Sciences, and the Zoology and Botany
Departments of Miami University (Oxford, Ohio).
The PNM/CMNH PBI was supported by a grant (to R.
Kennedy and P. Gonzales) from the John D and
Catherine T. MacArthur Foundation and by the bene-
factors of Cincinnati Museum of Natural History.
We thank D. Cannatella and A. Diesmos for com-
ments on earlier drafts of this manuscript.
Literature Cited
Brown, W. C. and A. C. Alcala. 1970. The zoogeogra-
phy of the Philippine Islands, a fringing archipelago.
Proc. California Acad. Sci. 38:105-130.
Brown, W. C, R. M. Brown, and A. C. Alcala. 1997.
Species of the hazelae group of Platymantis
(Amphibia: Ranidae) from the Philippines, with
descriptions of two new species. Proc. California
Acad. Sci. 49:405-421, Figs. 1-4.
Ferner, J. W., R. M. Brown, and A. E. Greer. 1997. A
new genus and species of moist closed canopy forest
skinks from the Philippines. Jour. Herpetol. 31:187-
192, Figs. 1-3.
Gonzales, PC. and R.S. Kennedy. 1990. A new spe-
cies of Stachyris babbler ( Aves: Timaliidae). from the
island of Panay, Philippines. Wilson Bull. 102: 367-
379.
Gonzales, PC. and R.S. Kennedy. 1996. A new spe-
cies of Crateromys (Rodentia: Muridae) from Panay,
Philippines. J. Mamm. 77:25-40.
Heaney, L. R. 1986. Biogeography of small mammals
in SE Asia: estimates of rates of colonization, extinc-
tion and speciation. Biol. Jour. Linnaen Soc, London
28:127-165, Figs. 1-8.
Inger, R. F, and A. E. Leviton. 1961. A new colubrid
snake of the genus Pseudorabdion from Sumatra.
Fieldiana: Zoology 44:45-47, Fig. 1.
Vol. 8, p. 12
Asiatic Herpetological Research
1999
Inger, R. F., and A. E. Leviton. 1966. The taxonomic
status of Bornean snakes of the genus Pseudorabdion
Jan and of the nominal genus Idiopholis Mocquard.
Proc. California Acad. Sci., 34:307-314, Figs. 1-3.
Leviton, A. E., and W. C. Brown. 1959. A review of
the genus Pseudorabdion with remarks on the status
of the genera Agrophis and Typhlogeophis (Serpentes:
Colubridae). Proc. California Acad. Sci., 29:475-508,
Figs. 1-10.
Leviton, A. E. 1963. Remarks on the zoogeography of
Philippine terrestrial snakes. Proc. California Acad.
Sci. 31:369-416, Fig. 1.
Leviton, A. E., R. H. Gibbs, Jr., E. Heal, and C. E.
Dawson. 1985. Standards in herpetology and ichthy-
ology: Part I. Standard symbolic code for institutional
resource collections in herpetology and ichthyology.
Copeia 1985: 802-832.
Appendix 1. Specimens Examined
In addition to specimens listed in earlier publications
by Leviton and Brown ( 1959) and by Inger and Levi-
ton (1961 and 1966), the following new materials
have been examined:
Pseudorabdion mcnamarae: Philippine Islands:
Negros Island: Negros Occidental Prov.: CAS 185577
- Panakiyo, 22 km E Isabela, 16 April 1960 by Q. and
L. Alcala. Negros Oriental Prov.: CAS 186052 - Cuer-
nos de Negros. 3600-3800 ft., 24 December 1959 by
Q. Alcala and R. Empeso.
P. talonuran: See Holotype and Paratype sections for
this species.
P. albonuchalis: Malaysia: Sarawak (Fourth Divi-
sion): CAS 101500 - Niah, Tangap, 6 December 1960
by T. Harrison.
P. oxyeephalum Philippine Islands: Panay Island:
Aklan Prov.: CAS 137643 - Nabas, Laserna Barrio, 12
May 1973 by L. Alcala. Negros Island: Negros Occi-
dental Prov.: CAS 185453-185457 - Hinoba-an Town,
barrios Alim and Asia, 9-10 June 1967 by L. Alcala
and party: Barrio Asia, 30 May-3 June 1967 by A.
Alcala, L. Pelingon and F Pelingon. Negros Oriental
Prov.: CAS 1 10974 - Camp Lookout. Valencia, 14
June 1967 by L. and F. Pelingon: 24-25 km NW of
Bondo [about 10 km N of Siaton], 27-31 December
1958 by A. Alcala and party.
1999
Asiatic Herpetological Research
Vol. 8, pp. 13-17
Anguis melanostictus Schneider, 1801, a Valid Species of Barkudia
(Sauria: Scincidae) from Southeastern India
INDRANEIL DAS
Institute of Biodiversity and Environmental Conservation, Universiti Malaysia Sarawak, 94300, Kota
Samarahan, Sarawak, East Malaysia
Abstract.- Anguis melanostictus Schneider, 180I, based on a watercolor in Russell (1796), from the Coromandel
coast of India, is shown to be a species of Barkudia, nonconspecific with B. insularis Annandale, 1917, and is
revived. B. melanosticta, is compared with the holotype and other specimens of B. insularis from Orissa State,
and shown to be larger (SVL 161.0-164.9 mm, vs. 107.0-143.0 mm), in addition to differing in the following
characteristics: palatal teeth present (vs. absent); anterior lobe of tongue distinctly narrowed (vs. not
differentiated); and lobules around ear opening absent (vs. present). A neotype of Barkudia melanosticta
(Schneider, 1801) is designated, based on an adult female from Visakhapatnam, Andhra Pradesh State,
southeastern India (ZSI 20627).
Key words.- Sauria, Scincidae, Anguis melanostictus,
designation, Andhra Pradesh, southeastern India
Barkudia insularis, Barkudia melanosticta, neotype
Introduction
Patrick Russell (1726-1805), perhaps the lirst Western
herpetologist in India, a medical doctor by training,
was posted as naturalist by the British East India
Company at Vizagapatam (at present Visakhapatnam,
Andhra Pradesh, southeastern India). Russell is best
known for a two volume folio of watercolors of
snakes, published in 1796 and 1801-1802 (finished
between 1807-1810; see Adler, 1989; Zhao and Adler,
1993), that concentrated on the fauna of the region.
Russell's books are unique in that he used local ver-
naculars of the species illustrated, but not their scien-
tific or English names, and several leading
herpetologists of the time have named new species on
the basis of the watercolors in Russell. Accounts of
the life of Patrick Russell can be found in Adler
(1989) and Smith ( 1931). The only reptile that is not a
snake described and illustrated in Russell (1796: 48;
PI. XLII), a blind worm snake (Typhlops j-like reptile,
was named Anguis melanostictus by Schneider, 1801.
Russell referred to the species only by the local ver-
nacular name, Rondoo talooloo pam (an obvious cor-
ruption of 'renda talu pam', Telugu for two-headed
snake), and referred the species to the genus Anguis.
Subsequent workers (e.g., Gray, 1845; Giinther, 1864)
have assigned the species provisionally to the genus
Anguis, the latter author crediting the name, in error,
to Merrem (1820). The species is unlisted in the next
several major works on the herpetology of the region,
including Boulenger ( 1 890) and Smith (1935).
Because the description was substantial, including
details of scalations, coloration and scale counts, it is
clear that the species illustrated by Russell and named
as Anguis melanostictus by Schneider ( 1 801 ) is a spe-
cies of Barkudia, known to be endemic to the east
coast of peninsular India (see Smith, 1935). Diagnos-
tic features described by Russell (1796) matches only
this genus amongst all other southern Asian species of
scincids: ventrals 151; head and neck subequal; the
forehead covered with "laminae of unusual shapes"
(fide Giinther, 1864); teeth small, numerous: eyes lat-
eral, small: nostrils small: trunk cylindric, of the small
thickness throughout the body; body scales imbricate;
each with a black dot, and eight to 10 parallel dotted
lines forming a line that runs from the head to the end
of the tail; length 10.5 inches: tail round, smooth, its
tip blunt: tail length 4.5 inches; color reddish-brown;
ventrals and subcaudals glossy white.
The genus Barkudia and its type species, B. insu-
laris, was established on a single specimen of a leg-
less scincid from Barkuda Island, Chilka Lake (19°
46'N; 85° 20'E), Ganjam District, Orissa State, East-
ern India, by Annandale (1917). Smith (1935) pro-
vided a redescription of the species, expanding the
original description based on a reexamination of the
holotype at the Zoological Survey of India (ZSI). No
further species of the genus has been described and
Greer (1970), in his analysis of the phylogenetic rela-
tionships of scincid lizards, included the genus in the
subfamily Scincinae. Although subsequent specimens
have been found at the type locality (Annandale,
Vol. 8, p. 14
Asiatic Herpetological Research
1999
Figure 1 . The neotype of Barkudia melanosticta (ZSI 20627). Bar = 20 mm.
1921; also ZSI 22540, collected from the type locality
on 5 July, 1961), and from adjacent Nandan Kanan
Biological Park (20° 13'N; 85° 50'E), Cuttack Dis-
trict, Orissa State (Biswas and Acharjyo, 1980), little
is known of its biology (see Murthy, 1990a; 1990b).
Ganapati and Nayar (1952) reported Barkudia insu-
laris from Waltair (17° 44'N; 83° 23'E; close to Visa-
khapatnam: 17° 42'N; 83° 18'E), Andhra Pradesh
State, Southeastern India, at a distance of circa 300
km to the southwest of the type locality of B. insu-
laris, and Ganapati and Rajyalakshmi (1955:279)
noted that the type of the species was reported lost.
Several subsequent publications (e.g., Murthy, 1990a;
Pillai and Murthy, 1982: Sanyal, 1993; Sanyal et at..
1993; Subba Rao, 1996) uncritically accepted the
Waltair locality and listed the Andhra Pradesh locality
for the species, although both Tikader and Sharma
(1992) and Welch et al. (1990) omit this southern
record. The recent rediscovery of the holotype of B.
insularis by Das and Dattagupta (1997), permits an
examination of this and additional material and a
comparison with material from Waltair reveal that the
Andhra Pradesh material is not conspecific with B.
insularis. This paper redescribes the Southeast Indian
material and designates a neotype.
Material and Methods
The following measurements were taken with dial
vernier caliper (to the nearest 0.1 mm): snout- vent
length (SVL; from tip of snout to vent), tail length
(TL; from vent to tip of unregenerated tail), tail width
(TW; measured at base of tail); head length (HL: dis-
tance between angle of jaws and snout-tip), head
width (HW; measured at angle of jaws), head depth
(HD; maximum height of head, from occiput to
throat), body width (BW; greatest width of body), eye
diameter (ED; greatest diameter of orbit), eye to nos-
tril distance (E-N; distance between anteriormost
point of eyes and nostrils), eye to snout distance (E-S;
distance between anteriormost point of eyes and tip of
snout), eye to ear distance (EE: distance from anterior
edge of ear opening to posterior corner of eyes), inter-
narial distance (IN; distance between nares), and
interorbital distance (IO; between orbits).
Comparative material of Barkudia insularis exam-
ined includes: ZSI 18075 (holotype of Barkudia insu-
laris Annandale. 1917), Barkuda Island, Chilka Lake,
Orissa, Eastern India; ZSI 22540: Barkuda Island,
Chilka Lake, Orissa, Eastern India); ZSI 24086.1 and
24086.2 (Nandan Kanan Biological Park, Cuttack
District, Orissa, Eastern India).
Systematic account
Barkudia melanosticta (Schneider, 1801) nov.
comb. (Figs. 1-2)
Neotype. ZSI 20627 (adult female), Visakhapatnam
(17° 42'N: 83° 18'E), Andhra Pradesh State, South-
eastern India, 47.8 m above mean sea level, collected
by P. N. Ganapati, 17 August 1954. The type locality
is indicated in Fig. 3.
Other material. ZSI 25135 (adult female), collected
by M. V. Subba Rao, 1984.
Diagnosis. A member of the genus Barkudia Annan-
dale, 1917, B. melanosticta (Schneider, 1810), can be
distinguished from B. insularis Annandale, 1917, as
follows: larger size (SVL 161.0-164.9 mm, vs. 107.0-
143.0 mm): palatal teeth present (vs. absent); anterior
lobe of tongue distinctly narrowed (vs. not differenti-
ated from the posterior lobe of tongue); and lobules
around ear opening absent (vs. present).
Description of neotype. Adult female. Snout-vent
length 164.9 mm; head elongated (HL/SVL ratio
0.05), narrow (HW/SVL ratio 0.04), depressed (HD/
HL ratio 0.61), indistinct from neck; snout long (E-S/
HW ratio 0.74), longer than the eye diameter (ED/E-S
ratio 0.33). projecting beyond mandible: parietal eye
absent; supraoculars three, supraoculars II and III
largest; supraciliaries present; scales on snout and
forehead smooth; rostral emarginate laterally, contact-
ing supranasals posteriorly; rostral large, lacking ros-
tral groove, wider than deep (rostral width = 3.0 mm;
rostral depth = 1.7 mm; width/depth ratio 1.76), con-
1999
Asiatic Herpetological Research
Vol. 8, p. 15
Figure 2. Head of the neotype of Barkudia melanos-
ticta (ZSI 20627) in dorsal (top left), ventral (top right)
and lateral (bottom) views. Bars = 5 mm. 20627). Bar
= 20 mm.
tacted posteriorly by two nasals and two semicircular
supranasals that are narrowly in contact. Posteroven-
trally, rostral in contact with supralabial I. Nares slit-
like, situated within nasals, oriented laterally, nasals
in narrow contact with supralabial I. Supranasals con-
tact supralabial I laterally and frontonasal posteriorly:
frontonasal trapezoid, wider than long, contacting
supranasals anteriorly and frontal posteriorly: frontal
deeper than frontonasal, constricted laterally, where it
contacts supraocular I; at its posterior end, frontonasal
contacts a V-shaped interparietal, which is wider than
frontal, a single pair of parietals contacts interparietal:
a single preocular between loreal and orbit. Eye
reduced (ED/HL ratio 0.18), orbit situated dorsolater-
al^; four supralabials (supralabial III in suborbital
position), supralabial IV largest: supralabial followed
by a single small scale; infralabials 4; upper eyelids
undeveloped; lower eyelids scaly; two postoculars: a
single anterior and two posterior temporals; ear open-
ing minute, slitlike, measuring 0.05 mm; situated lat-
erally at approximately the level of jaws; lobules
Figure 3. Map of India (marker = 800 km), showing
(enlarged on right; marker = 400 km) eastern and
southeastern India, and the distribution of the two spe-
cies of Barkudia. Reference: Spots, B. insularis (both
in Orissa State); triangle, B. melanosticta (in Andhra
Pradesh State). See text for details.
around ear opening absent; eye-to-ear distance less
than eye-to-nostril distance (E-E/E-N ratio 1.19).
Inner rim of upper jaw smooth. Mental large, semicir-
cular, wider than deep, single trapezoidal postmental,
larger than mental, its width 0.29 per cent head width.
Postmental contacts infralabial I, but fails to contact
infralabial II, bounded posteriorly by a pair of
smooth, rounded, juxtaposed chin scales that are sepa-
rated by a single scale. Tongue narrowly elongate, dis-
tinctly narrowed distally, with a median cleft and
scattered papillae on the dorsal surface. Palate with
teeth arranged in a regular series; maxillary and
manibular teeth oriented towards the posterior, regu-
larly arranged.
Body slender, elongate (SVL/BW ratio 0.04). Scales
smooth, scale size subequal dorsal ly as well as ven-
trally. Anals three, smooth; preanal not enlarged, over-
lapped by the last ventral; two scales border anal
laterally, exceeding its posterior level, over vent.
Limbs absent. Tail short, tail length 67.5 mm, much
shorter than snout- vent length (TL/SVL ratio 0.41 ),
tail base slightly swollen and bluntly rounded at tip.
Ventral surface of tail with smooth, undifferentiated
subcaudals; scales on the postanal region and at the
proximal part of the tail base smooth.
Coloration, (in alcohol) Dorsally yellowish-brown,
turning chestnut brown towards the posterior half of
tail; the tail tip (last 5 mm of tail) dark brown dorsally
and ventrally, except for a pale yellow spot on the
Vol. 8, p. 16
Asiatic Herpetological Research
1999
ventrum. Ventrum of body uniformly yellow-cream.
In life, these lizards are typically "glossy brown with
a black spot in the middle of each scale" (Ganapati
and Rajyalakshmi, 1955).
Measurements . (neotype, followed by ZSI 25135
[an adult female]; in mm) SVL 164.9 (161.0); TL
67.5- original unregenerated (32.2- partially regener-
ated); TW 4.7 (5.1); HL 8.7 (6.7); HW 6.6 (6.2); HD
5.3 (4.9): BW 6.8 (6.3); ED 1.6 (1.2); E-N 3.2 (3.1);
E-S 4.9 (4.1); E-E 3.8 (3.3); 10 4.7 (5.0); and IN 3.3
(3.5).
Scutellation. (neotype, followed by ZSI 25135 in
parentheses).- Ventrals (between postmental and prea-
nal) 145 (143); subcaudals 78 (36+): supralabials 4
(4) (III in suborbital position in both types); infralabi-
als 4 (4); and midbody scale rows 20 (20).
Variation. The non-type differs from the neotype in
the following details: anal divided, lateral scales do
not exceed level of anal; which bear fine keels and
first scale following postmental contacts infralabial I.
In the original description, the subcaudal count given
(120) is significantly larger than that shown by the
neotype- 78 (tail-tip regenerated in the non-type), but
it is likely that adult males (of which no specimens
have been examined) have longer tails and therefore,
larger subcaudal counts. For instance, in a single male
Barkudia insularis (ZSI 18075) examined, the sub-
caudal count was 108, as opposed to 82 in the only
female (ZSI 24086) with an original tail.
Natural history. Several authors have provided infor-
mation on the natural history of Barkudia melanos-
ticta, including Ganapati and Nayar ( 1952), Ganapati
and Rajyalakshmi (1955), Subba Rao (1996) and
Subba Rao and Nageswara Rao ( 1998). The local pro-
tection given to the new species has precluded the col-
lection of additional specimens.
Comparisons
The species being revived from obscurity is clearly a
member of the genus Barkudia Annandale, 1917, due
to the following features: fore and hind limbs absent,
upper eyelids undeveloped, lower eyelids scaly, eyes
vestigial, ear opening slitlike; nares situated in nasal,
and body elongated. These features, in combination,
separate members of the genus Barkudia from two
other genera (both monotypic) of limbless scincids to
which it is apparently closely related, including Sep-
sophis Beddome, 1870, containing Sepsophis puncta-
tus Beddome, 1870, from the Eastern Ghats of
Southeastern India and Chalcidoseps Boulenger,
1887, containing Chalcidoseps thwaitesii (Gunther.
1872), from the Knuckles Range of Central Sri Lanka
(see Smith, 1935, for diagnoses).
Barkudia melanosticta (Schneider, 1801) differs
from B. insularis Annandale, 1917, in the following
features: palatine teeth present (vs. absent); anterior
lobe of tongue narrowed (vs. not differentiated): and
lobules around ear opening absent (vs. present). The
two specimens known are larger (SVL 161.0 and
164.9 mm) than the four (see Materials and Methods)
examples of B. insularis (SVL 107.0- 143.0 mm)
examined.
Barkudia melanosticta is known only from the
Andhra University Campus at Visakhapatnam (north-
eastern Andhra Pradesh State, southeastern India),
and is thus separated from the two known localities of
B. insularis by a distance of circa 300 km to the
southwest. Most of Russell's collections were pre-
sumably made in and around Visakhapatnam, ca. 5
km southeast of Waltair, the only known locality of B.
melanosticta.
Acknowledgments
For permission and facilities to examine comparative
material at the ZSI, I thank J. R. Alfred and Shyamal
Kumar Chanda. Basudeb Dattagupta, Nemai Charan
Gayen and Sujay Raha rendered curatorial assistance.
M. V Subba Rao supplied the second example. Kraig
Adler, Sushil Dutta, Allen Greer, Van Wallach and
Romulus Whitaker offered comments on the manu-
script.
Literature Cited
Adler, K. 1989. Herpetologists of the past. In: Contri-
butions to the history of herpetology. pp: 5-141. K.
Adler (Ed). Society for the Study of Amphibians and
Reptiles. Contributions to Herpetology, Number 5,
Oxford, Ohio.
Annandale, N. 1917. A new genus of limbless skinks
from an island in the Chilka Lake. Records of the
Indian Museum 13:17-21.
Annandale, N. 1921. The reptiles and Batrachia of
Barkuda Island. Records of the Indian Museum
22:331-333.
Biswas, S. and L. N. Acharjyo. 1980. A note on distri-
bution of Barkudia insularis Annandale, a rare limb-
less lizard from Orissa Journal of the Bombay
Natural History Society 76:524-525.
Boulenger, G. A. 1890. The fauna of British India,
including Ceylon and Burma. Reptilia and Batrachia.
Taylor and Francis, London, xviii + 541 pp.
1999
Asiatic Herpelological Research
Vol. 8, p. 17
Das, 1. and B. Dattagupta. 1997. Rediscovery of the
holotypes of Ophisops jerdoni Blyth. 1853 and
Barkudia insularis Annandale, 1917. Hamadryad
22(l):53-55.
Ganapati, P. N. and K. K. Nayar. 1952. Occurrence of
the limbless lizard Barkudia Annandale at Waltair.
Current Science 21:105-106.
Ganapati. P. N. and K. Rajyalakshmi. 1955. Bionom-
ics and some anatomical peculiarities of the limbless
lizard Barkudia insularis Annandale. Records of the
Indian Museum 53:279-291.
Gray, J. E. 1845. Catalogue of the specimens of liz-
ards in the collection of the British Museum. British
Museum, London, xxviii + 289 pp.
Greer, A. E. 1970. A subfamilial classification of scin-
cid lizards. Bulletin of the Museum of Comparative
Zoology, Harvard University 1 39: 1 5 1 - 1 84.
Gunther, A. C. L. 1864. The reptiles of British India.
Ray Society, London, xxvii + 452 pp. + I-XXVI pi.
Reprinted around 1982 Oxford and IBH Publishing
Co., New Delhi, Bombay and Calcutta.
Merrem, B. 1820. Versuch eines Systems der
Amphibien/Tentamen Systematis Amphibiorum.
Johann Christian Krieger, Marburg, xv, xv + 188, 188
pp., index; 189-191: 1 pi.
Murthy, T. S. N. 1990a. A field book of the lizards of
India. Records of the Zoological Survey of India.
Occasional Paper ( 1 15 ):i-vii +1-92+30 pi.
Murthy, T. S. N. 1990b. A pocket book of the amphib-
ians and reptiles of the Chilka Lagoon, Orissa.
Records of the Zoological Survey of India. Occa-
sional Paper ( 1 25 ):( 1 )+ 1 -35+33 pi.
Pillai. R. S. and T. S. N. Murthy. 1982. Herpetofauna
of Eastern Ghats. //;: Proceedings of the Seminar on
Resources, Development & Environment of the East-
ern Ghats, pp: 81-84. P. Bhavanarayana (Ed). Depart-
ment of Environmental Sciences, Andhra University,
Waltair.
Russell, P. 1796. An account of Indian serpents, col-
lected on the coast of Coromandel; containing
descriptions and drawings of each species; together
with experiments and remarks on their several poi-
sons. George Nicol, London, viii + 91 pp + PI.
I-XLVI.
Russell, P. 1801-1810. A continuation of an account
of Indian serpents; containing descriptions and fig-
ures, from specimens and drawings, transmitted from
various parts of India, to the Hon. The Court of Direc-
tors of the East India Company, and published by their
order, under the superintendence of Patrick Russell,
M.D.F.R.S. G. and W. Nicol, London, i-v, ix-xv + 53
+ (4) + PL I-XLV.
Sanyal, D. P. 1993. Reptilia. In: State Fauna Series 1.
Fauna of Orissa., Part 4. pp: 51-74. A. K. Ghosh (ed).
Zoological Survey of India, Calcutta.
Sanyal, D. P., B. Dattagupta and N. C. Gayen. 1993.
Reptilia. In: State Fauna Series 5. Fauna of Andhra
Pradesh, Part I. pp: 1-63. A. K. Ghosh (ed). Zoologi-
cal Survey of India, Calcutta.
Schneider, J. G. 1801. Historiae Amphibiorum natu-
ralis et literariae. Fasciculcus Secundus continens
Crocodilos, Scincos, Chamaesauras, Boas, Pseudo-
boas, Elapes, Angues, Amphisbaenas et Caecilias.
Friederici Fromman, Jena, vi + 374 pp + pi. 1-2.
Smith, M. A. 1931. The fauna of British India, includ-
ing Ceylon and Burma. Vol. I. Loricata, Testudines.
Taylor and Francis, London, xxviii + 185 pp + 2 pi.
Smith, M. A. 1935. The fauna of British India, Ceylon
and Burma, including the whole of the Indo-Chinese
region. Vol. II. Sauria. Taylor and Francis, London,
xiii + 440 pp + PI. I.
Subba Rao, M. V 1996. Ecology of limbless lizard,
Barkudia insularis Anadale (sic) (Reptilia, Sauria,
Scincidae). //;: [Abstract book for] International Con-
ference on the Biology & Conservation of Amphibi-
ans & Reptiles of South Asia, pp: 23. A. de Silva (Ed).
ARROS, Gampola.
Subba Rao, M. V. and B. Nageswara Rao. 1998. Diet
of the limbless skink, Barkudia insularis Annandale
1917 (Sauria: Scincidae). Hamadryad 22(2): 120.
Tikader, B. K. and R. C. Sharma. 1992. Handbook:
Indian lizards. Zoological Survey of India, Calcutta,
xv + 250 pp + 42 pi.
Welch, K. R. G., P. S. Cooke and A. S. Wright. 1990.
Lizards of the Orient: A checklist. Robert E. Krieger
Publishing Company, Malabar, Florida, v + 162 pp.
Zhao, E.-M. and K. ADLER. 1993. Herpetology of
China. Society for the Study of Amphibians and Rep-
tiles, Contributions to Herpetology, No. 10, Oxford,
Ohio. 522 pp + 48 pi. + 1 folding map.
1999
Asiatic Herpetological Research
Vol. 8, pp. 18-24
The Dates of Publication of Amphibian and Reptile Names by Blanford and
Stoliczka in the Journal and Proceedings of the Asiatic Society of Bengal
INDRANEIL DAS
Museum of Comparative Zoology, Harvard University, Cambridge, MA 02138, USA.
Present address: Institute of Biodiversity and Environmental Consen'ation, Universiti Malaysia Sarawak, 94300
Kota Samaralian, Sarawak, Malaysia, email: [email protected]
Abstract.- The dates of publications of the Proceedings and the Journal of the Asiatic Society of Bengal are
discussed. Several names of amphibians and reptiles were proposed, along with brief descriptions, by W. T.
Blanford and F. Stoliczka in the monthly Proceedings before their intended formal description in the Journal, in
some cases, a year before. These earlier publications constitute formal descriptions according to the Code of
Zoological Nomenclature. A listing of two genera (one amphibian and one reptile) and 24 species (three
amphibians and 21 reptiles) is appended; the type localities include Turkmenistan, Pakistan, India, Myanmar and
Malaysia.
Key words.- Amphibians, reptiles, dates of publication. Proceedings and Journal of the Asiatic Society of Bengal.
Founded in 1784 by the Orientalist, Sir William Jones
(1746-1794; see Cannon, 1960, for a biographic
sketch), the Asiatic Society of Bengal, with its head-
quarters in Calcutta, has played, according to a report
in Nature at the turn of the century, "...a leading part
in the exploration of the natural history, philology,
antiquities, and other branches of scientific inquiry
connected with the East" (Anonymous, 1907).
Although Jones himself was opposed to the collection
of zoological specimens (Bose, 1885), examples of
both plants and animals did start to arrive from vari-
ous parts of the British Indian Empire, and occasion-
ally from outside. Coupled with the expeditions
organized or participated in subsequently by the staff
of the Museum of the Society, the Asiatic Society of
Bengal came to acquire one of the most important
zoological reference collections in the world, which,
after the passing of the Museum Act in 1 866, came to
the Indian Museum (Fermor, 1936) and is at present
maintained by the Zoological Survey of India (Sewell,
1932; Das et al., 1998).
The periodicals of this two century old institution
included the Journal and the Proceedings, which
gradually replaced several leading oriental journals of
the period, including the Asiatick Researches and the
Calcutta Journal of Natural History. Because of
delays in publishing the Journal (started in March
1832, the old series continuing until 1904, see
Chaudhuri, 1956), the Society started the Proceedings
in January 1865 (which were issued monthly till
December 1904). The Proceedings was out "as soon
as possible, after every monthly meeting", according
to the information on the cover page, as opposed to
and separate from the more widely circulated Journal,
which was published only once in two to three months
(Mitra, 1885). As mentioned on an untitled page of
the first issue, the separation of the Journal (which
was issued in a "new series" between 1905 and 1934,
when the Proceedings was reunited with the Journal)
from the Proceedings was "In accordance with the
announcement of the Council in the Annual Report
read at the Annual General Meeting held on the 1 1th
January, 1865" (Blanford and Heeley, 1865). Each
fascicle of the Proceedings comprised 10-30 pages,
and contained reports of the progress of the Society,
including financial statements, additions of books to
the library and coins to the Society's numismatic col-
lection, exhibition notices, correspondence from its
members and lists (and losses) of members, and also,
"short notes, which were not deemed fit for introduc-
tion into the Journal" (Mitra, 1885).
Because the Society's Proceedings was less well
known than the Journal and the ambiguity of descrip-
tions in abstracts versus in "full papers", the dates of
some of the descriptions of several genera and species
of amphibians and reptiles from Asia have been
assigned incorrectly in subsequent works (e.g., Smith,
1935; 1943) to the description published in the Jour-
nal, when, in fact, they were validly published earlier,
in some cases, a year before, in the Proceedings.
Some of the leading naturalists of the day read papers
on faunistics, including the descriptions of new taxa,
in the monthly meetings of the Society, which were
reported as "abstracts" in the Proceedings. These
1999
Asiatic Herpeiological Research
Vol. 8, p. 19
abstracts propose both new names and provide
descriptions and diagnoses, thereby constituting a
valid description according to the Code of Zoological
Nomenclature. Since the aforementioned fascicles
were generally issued monthly, and distributed to
members through subscription, publication was rapid,
leading to several names being available before their
more complete description. In some of the cases, the
titles of the papers published in the Journal and Pro-
ceedings were identical, in others, there were minor
differences, such as the use of the more formal 'Rep-
tilia' in Blanford (1879a) instead of 'reptiles' in Blan-
ford (1879b). Regrettably, the type localities of some
taxa are different in the two publications, the Journal
tending to have a more precise type locality. In one
instance. (Blanford, 1878a), the type locality ("Foot
of Nawlabu hill, west of Tavoy") is different from that
which appeared in the purported formal description
(Blanford, 1878b: "Foot of Nawlabu Hill, east of
Tavoy..."). If illustrations depicting the new taxon
being described for the first time were provided, these
appeared in the Journal. The months and, where avail-
able, dates of issue of each fascicle making available
new zoological names are annotated with the refer-
ences in Table 1. Only names published in the Pro-
ceedings that are at present attributed to the intended
formal description in the Journal have been listed.
Names dealt with in this communication have
been proposed either by William Blanford (1832-
1905) of the Geological Survey of India, or Ferdinand
Stoliczka (1838-1874), Secretary of the Natural His-
tory Department of the Asiatic Society of Bengal. Two
genera (one amphibian and one reptile) and 24 species
(three amphibians and 21 reptiles) were described as
new by the aforementioned workers in the Proceed-
ings before their intended formal publication in the
Journal. Of these, one genus (an amphibian) and 16
species (three amphibians and 13 reptiles) are at
present considered valid (see Table 1 ). The geographi-
cal coverage of the type localities includes Turkmeni-
stan (five), Pakistan (five), India (five), Myanmar
(six), and Malaysia (five).
Acknowledgements
Supported by a Fulbright Fellowship. Research on the
manuscript was conducted at the Widener and Ernst
Mayr Libraries of Harvard University. I thank Kraig
Adler, Roy McDiarmid, Hobart Smith and Van
Wallach for comments on the manuscript.
Literature Cited
Anonymous. 1907. The Asiatic Society of Bengal.
Nature 75: 511.
Berry, P. Y. 1975. The amphibian fauna of peninsular
Malaysia. Tropical Press, Kuala Lumpur, x + 130 pp.
Blanford. H. F and W. L. Heeley. 1865. [Untitled]
Proceedings of the Asiatic Society of Bengal 1865(i):
(I).
Blanford, W. T 1875a. List of Reptilia and Amphibia
collected by the late Dr. Stoliczka in Kashmir, Ladak,
Eastern Turkestan and Wakhan, with descriptions of
new species. Proceedings of the Asiatic Society of
Bengal (8): 201-202. [issued November, 1875.]
Blanford. W. T "1875"b 1876. List of Reptilia and
Amphibia collected by the late Dr. Stoliczka in Kash-
mir, Ladak, eastern Turkistan, and Wakhan, with
descriptions of new species. Journal of the Asiatic
Society of Bengal 44(3): 191-196. [issued January 13,
1876.]
Blanford, W. T. 1875c. On some lizards from Sind,
with descriptions of new species of Ptyodactylus,
Stenodactylus, and Trapelus. Proceedings of the Asi-
atic Society of Bengal (9): 232-233. [issued Decem-
ber, 1875.]
Blanford, W. T. 1876. On some lizards from Sind,
with descriptions of new species of Ptyodactylus,
Stenodactylus, and Trapelus. Journal of the Asiatic
Society of Bengal 45(1 ): 18-26 + PI. I-II. [issued June
26, 1876.]
Blanford, W. T. 1878a. Notes on Reptilia from the
Himalayas and Assam. Proceedings of the Asiatic
Society of Bengal (6): 141-142. [issued June, 1878.]
Blanford, W. T. 1878b. Notes on some Reptilia from
the Himalayas and Burma. Journal of the Asiatic Soci-
ety of Bengal 47(3): 125-131. [issued October 28,
1878]
Blanford, W. T. 1879a. Notes on reptiles. Proceedings
of the Asiatic Society of Bengal (8): 216-217. [issued
August, 1879.]
Blanford, W. T. 1879b. Notes on Reptilia. Journal of
the Asiatic Society of Bengal 48(3): 127-132. [issued
November 28, 1879]
Bose, P. N. 1885. Centenary review of the Asiatic
Society of Bengal from 1784-1883. Part ID.. Natural
Science. Asiatic Society of Bengal, Calcutta. Errata +
109 + xcvi pp.
Boulenger, G. A. 1885. Catalogue of lizards in the
British Museum (Natural History). Second edition.
Vol. 1. Geckonidae (sic), Eublepharidae, Uroplatidae,
Vol. 8, p. 20
Asiatic Herpetological Research
1999
Pygopodidae, Agamidae. British Museum (Natural
History), London, xii + 436 pp + PL I-XXXII.
Boulenger, G. A. 1893. Catalogue of the snakes in the
British Museum (Natural History). Vol. I., containing
the families Typhlopidae, Glauconiidae, Boidae, Ilysi-
idae, Uropeltidae, Xenopeltidae, and Colubridae
Aglyphas part. British Museum (Natural History),
London, xiii + 448 pp + PL I-XXVIII.
Boulenger, G. A. 1912. A vertebrate fauna of the
Malay Peninsula from the Isthmus of Kra to Sin-
gapore including the adjacent islands. Reptilia and
Batrachia. Taylor and Francis, London, xiii + 294 pp.
Brown, W. C. 1991. Lizards of the genus Emoia
(Scincidae) with observations on their evolution and
biogeography. Memoirs of the California Academy of
Sciences (15): vi + 1-94.
Cannon, G. 1960. The literary place of Sir William
Jones (1746-1794). Journal of the Asiatic Society of
Bengal (new series) 2: 47-61.
Chaudhuri, S. 1956. Index to the publications of the
Asiatic Society 1788-1953. Asiatic Society of Bengal,
Calcutta, xiii + 336 pp.
Das, I., B. Dattagupta and N. C. Gayen. 1998. History
and catalogue of reptile types in the collection of the
Zoological Survey of India. Journal of South Asian
Natural History 3(2): 121-172.
Dring, J. C. M. 1979. Amphibians and reptiles from
northern Trengganu, Malaysia, with descriptions of
two new geckos: Cnemaspis and Cyrtodactyius. Bul-
letin of the British Museum of Natural History (Zool-
ogy) 34: 181-241.
Dubois, A. 1992. Notes sur la classification des
Ranidae (Amphibiens Anoures). Alytes 61(10): 305-
352.
Fermor, L. L. 1936. Annual address, 1934-35. The
development of scientific research in India to the end
of the Nineteenth Century. Year-Book Asiatic Society
of Bengal 1:9-22.
Greer, A. E. 1977. The systematics and evolutionary
relationships of the scincid lizard genus Lygosoma.
Journal of Natural History 11: 515-540.
Hennig, W. 1936. Revision der Gattung Draco (Aga-
midae). Temminckia 1: 153-220.
Hoge, A. R. and S. A. R. W. L. Romano-Hoge. 1978-
1979. Poisonous snakes of the world. Part I. Check
list of the pit vipers Viperoidea, Viperidae, Crotalinae.
Mem. Inst. Butantan 42-43: 179-310. [issued 1981.]
Inger, R. F 1960. A revision of the Oriental toads of
the genus Ansonia Stoliczka. Fieldiana Zoology 39:
473-503.
Inger, R. F 1983. Morphological and ecological varia-
tion in the flying lizards (genus Draco). Fieldiana
Zoology new series (18): i-iv + 1-35.
Kluge. A. G. 1993. Gekkonoid lizard taxonomy. Inter-
national Gecko Society, San Diego. 245 pp.
Mitra, R. 1885. Centenary review of the Asiatic Soci-
ety of Bengal from 1784 to 1883. Part I. History of the
Society. Asiatic Society of Bengal. Calcutta. 195 pp.
Moody, S. M. 1980. Phylogenetic and historical bio-
geographical relationships of the genera in the family
Agamidae (Reptilia: Lacertilia). Unpublished Doc-
toral Dissertation, University of Michigan, Ann Arbor.
5 unnumbered pages + xv + 373 pp.
Musters, C. J. M. 1983. Taxonomy of the genus
Draco L. (Agamidae, Lacertilia, Reptiles). Zoolo-
gischeVerhandelingen(199): 1-120, PL 1-4.
Nikol'skii, A. M. 1963. Fauna of Russia and adjacent
countries. Reptiles. Vol. I. Chelonia and Sauria. Israel
Program for Scientific Translations, Jerusalem. 352
pp.
Pope, C. H. 1935. The reptiles of China. Turtles, croc-
odilians, snakes, lizards. Natural history of central
Asia. Vol. 10. American Museum of Natural History,
New York, lii + 604 pp.
Sewell, R. B. S. 1932. The Zoological Survey of
India. Nature 129:530-531.
Smith, H. M. 1989. The original description of Ovo-
phis Burger (Serpentes: Viperidae). Bulletin of the
Chicago Herpetological Society 24: 7.
Smith, M. A. 1935. The fauna of British India, includ-
ing Ceylon and Burma. Reptilia and Amphibia. Vol.
II.- Sauria. Taylor and Francis, London, xiii + 440 pp
+ 1 pi.
Smith, M. A. 1943. Fauna of British India, Ceylon and
Burma, including the whole of the Indo-Chinese
region. Vol. III. Serpentes. Taylor and Francis, Lon-
don, xii + 583 pp. + 1 map.
Stoliczka, F 1870a. Observations on some Indian and
Malayan Amphibia and Reptilia. Proceedings of the
Asiatic Society of Bengal 1870(4): 103-109. [issued
April, 1870.]
Stoliczka, F 1870b. Observations on some Indian and
Malayan Amphibia and Reptilia. Journal of the Asi-
atic Society of Bengal 39(2): 134-157 (= 158 pp) +
captions, PL DC [issued June 7, 1870.]
Stoliczka, F 1870c. Observations on some Indian and
Malayan Amphibia and Reptilia. Journal of the Asi-
atic Society of Bengal 39(3): 159-228 (= 70 pp) PL
X-XII. [issued September 1, 1870.]
1999
Asiatic Herpetological Research
Vol. 8, p. 21
Wall, F. 1923. A hand-list of the snakes of the Indian
Empire. Part II. Journal of the Bombay Natural His-
tory Society 29: 598-632.
Wall, F. 1924. A hand-list of the snakes of the Indian
Empire. Part III. Journal of the Bombay Natural His-
tory Society 29: 864-878.
Zhao, E.-M. and K. Adler. 1993. Herpetology of
China. Society for the Study of Amphibians and Rep-
tiles, Contributions to Herpetology, No. 10. SSAR,
Oxford, Ohio. 522 pp, 48 pi.
• a) a>
£ SP£
•o !» c
(D J —
? = 8
1 8 g
C <K «
— w CO
»- „- C
"5 g 'Z
2 Q) ?
O X jS
• o **
CO m c
o|-S
^°o
0) u .
o S m
o .9
co
£ 8
0) ro
< C
<g £
— 3
° s
al
<D en
<D CD
o u
O c
4 ^
« s
« §>
X) C
(0 CD
go
"O CD
co 'o
E o
X o
"5 «9
o <
o> a>
° x
o ~
0) o
0)
c
CD
05
C
CD
CD
£
T3
CO
O
■D
£
o
o
"co
CD
Si
E £
CO c
c —
— c
o o
°- )z
ECO
_ CD
c c
CO CO
en co
■ ■ X>
CD CD-
'S M
|2 E
z
o
p
<
y
j
ca
D
CL
u.
O
00
P
<
Q
2
o
P
<
u
o
-1
_J
<
H
z
PJ
OS „
D S
u 2
OS 0
to
O
Is
kj 00
UJ _
81
OS <
ft.
ca
O
r-
oc
Q
O0
B
C
UJ
S
<
z
<
z
5
5
o
a*
2 .2
. . «
CO >^
O C3
six
-So
a to 00
^ a —
— . u.
C 60 N
55 g^
2 .E S
s cl 00
O 3 C
cu ca •—
o
Q.
<
O
00
00
CN
5
o
3
Q
3
o
C CQ
s I
^ o
*z
* *
o
r~
00
Q.
<
CO
O
r-
00
ca
M
N
2 K §
r~ o o
«^ c
- « S
R s «
S c 00
<55 .2 -_
o ca
So N
o
00
n.
<
s
00
ca
cj
O ^
— ca
O S
00 to
— <u
ca^
^! .
N 00
o c
— ca
o c
55 CL
.2 3
Or, ""
2 °
S —
o ca
2 c
-. CJ
■^ CL
ffl £ o
ca c>o
•O 3
c —
ca :
x :
<u —
<u 00
> c
o ca
ca o>
. '■ ^
• u
00 si
P
■S.S
60 2
B • ^
« . • ■£■
c - o
CL C 00
: ca —
O
00
E
H.
CJ
00
o
00
n.
<
ca
O
r~
00
ca
N
CJ
5
in
2 .2
C3 >~.
O =a
!^ «
CB
O
^:
O 00 ca
/5 a n
i^ C CJ
I E I
3 O. .
~S 00
o
00
CJ
a.
CJ
00
o
00
a.
<
o
r-
00
OO
&
55
s > 00 —
CJ
ex
CJ
O0
o
00
Q.
<
O
00
B
0
2
13
o „
ty ca
3
ca
Cu CL
o
r-
oc
CJ
X
E
CJ
c.
CJ
00
o
1^
o.
<
N
0^
x
a
S
G CA
d e
= ^ 8
a. o u
S" r- cj
•~ 00 cj
ac — 00
ca
E
c
«n 3
ca c
°l
00 •£
— 3
- o
ca ca
M
n ca
.H E
o 2
00 o
22
-2 11
o ^
4- ca
x
c ca
.8" a
52
Vol.
p. 22
Asiatic Herpetological Research
1999
o
00
CJ
1
0)
W
D.
1)
on
o
r-
00
CO
E
«j
Q.
to
00
r-
oo
i
3
VD
r-
oo
>>
c-3
3
00
o
f-
00
a.
<
o
r-
oo
a.
<
o
r-
oo
a.
<
o
r-
oo
c
<
1/1
00
X.
to
>
0
Z
00
o
E
u
>
o
Z
IT)
r-
oo
>
o
Z
es
O
r-
oo
eS
N
U
on
c
'C
8
« —
§■73
O
cs ^-t, C/3
i? .2 S3
a -
-a w
CS c
Vj to
<n i-
<ij CS
■O X^
« o
3 -
•< z
£ o
Joo
>-..£
3 £
cs l—l
Z .£
oo
U
a
5
■a f>
'- s
el
r- II es
O CJ
« 'a s:
o E
S3
_ o
CS «—
Si> cs* ^
CS
E u
li
= S
C 3
53 1
I -
a —
'r* &
a >-
s -e
5 <
3 -*
S3 J
.% o
« oo
'o c
E -
>* * :
£ £
M
o
00 >*
= .E
"a £
- "3
^ c —
g CS CS
" E c
t\, cs ^
— CS CS
.a -o oo
^ < J
^^ <u
00 O
cs .2
O c«
r- >.
oo _n
~ cs
OO bo
£ £
s £
3
_o
«3 y
> o
cj r-»
3
a CS
_ ^:
cs N
i-2
»< 3
a es
■a c
,=- CJ
* 1
5 °
3 oo
CJ c
c :
O CJ
— .«J
IE o
= 3
CJ (N
3
O
X.
■a
_ c
^ 3
a 1
u-i :
OO ^
CS
o 3
'— Q>-
3 CJ
03 3
£ H
a c
-2 2
tj CS
:a U
o •*-
oo °
.2 S
oo ^c
3 CS
.2 c
:E''-E
c
u
3 CD
3 .E
OX) tJ
CJ -^c
a c
to : .
pi
i (/3
3
o
E
a
=
=
<
3
>>
D
cs
00
■s
•°
3
_cs
CQ
VI —
r- o
00 Csl
00
00
: X
■2 1
3 CS
_« ;
a «
•a "J
| =
^ CO
■S to 3
O . «:
3 §-s
w oo r2
co t—
'- OC 3
en > es ■Xl
cs *-• [Tl --)
PJ *J LJ a
-§ 0 *
ts en "O
a 3 3
; a
U
o-43
f- e3
!w.
2 i
3 2
< '■£
S3 5b
3 3
00 CS
d r
00
00
^85
CO
00
_3
- 2
- ™ X
•o : P
fa T3 cj
■— E ^
3 a r:
cs i 5
CO g «=
^ « E
'a cj ■ — '
; M ■
^ '—
H 3 .
•a E— oo
•^ 1— ,— -
Si 91 "
■S <_ es
S O -O
a m 3
a 3 es
§1
3 "
1- 3
B
en *
CJ 3
S "2
. en
O •£
'So ef,
cj t—
bt « P
>. cs
?? A.
>- 3
3 2
o cs oo
w en —
3 en _-
< JC -C
3 i-^
II ss
1999
Asiatic Herpetological Research
Vol. 8, p. 23
m
r-
oc
u
x
E
o
>
o
Z
r-
oc
o
X
*— '
c
:3
O
s
-S
oc
m
00
OJ
o
Z
C3
in
00
en
in
ON
NO
oc
in
r-
oo
X
E
<u
3
Q
m
r-
oc
-a
a
c
co
03
~z rr,
1)
00
e*
Ul z
fcj
D.
O
a.
nC
00
U
c
3
m
r-
00
X
E
a>
o
ej
Q
o
I/-)
00
■2
<S
c
03
s
s
o
s
o
5
a
-a
o
r-
oo
C
m
00
X
u
a
o
in
i—
00
•s
,o
.si
£2
-a
a
a
o
X
g
O
00
r~
oo <u
— X
= s
U ^
"3
3
B f,
— 00
S 2
Hi
_ ^ i
^r » >■»
o oo x
oo--
c 5 c
° F> c-
o -1- S>
1-2
is o
-S ~1 ^
o s &
g s c
52J
= — _
.2 b-
"P .S x
■a S
O 3
■g < =
« = B
"O
q 3
« n X
m " _
OO c o
— 3
BO —
O C
— 3
03 if
CS 3
5 H
tJJ
3 u
3 B
— 2
t '5b
oo s2
X 3
crt O
SI
a 3
"if OO
--- pn
oo ^
y
X o
oc x.
T3 x:
,o o
1= VI
03 —
.£"§
C3
3 l-
•« C3
3 S
Gfl —
^o^
CO
ra
;J
in ii
oc .
— T3
■p .E
03
B X
O
o.
Du.
0-
x a
n nC
" r-
c oc
c —
O :
i- r~
O 00
S -
o -
5 s
(3
fill
o ^
B5
a, ^
oo
-a
c
■8 x
o -a
c
OC "3
■B ~
CO O.
"3
3
v5
^ -5
00
X *
^ r
o -P
C3 C
X C3
'3
X^
« 8 C
u Z -
00 r
© H
w U
O CA
T '3 00
: f*-
. oo
- ssg
"2 .5*
03
■S. P
- Q
03 *
. oo -
b°I J
3 ou 3
o "a :~
.S "= B
: •= S
V..2P o
9 •= —
5 - g>
f— _• >
•_ — «
o x H
Vol. 8, p. 24
Asiatic Herpetological Research
1999
oo
f-
00
u
■8
o
o
00
s
>
o
Z
00
r-
oo
u
s
3
r—
oo
3
ou
3
<
OO
00
B
:3
a
u
em
c
<L>
05 CQ
a
Q 03
oo
oo
•o
£
c
03
it
s
I"
0 S3
.S ea
g
a
u
■ - S
oo ~
no s
-3 "£
k- ■«■*
■2. a
« a:
c
eg
•b o
'c_ CQ
o *<u
— 3
E ea'
C3 ON
B r-
— oo
c —
<u
E "a
rr —
•2
c
p ea
■5t
1/1
00
CQ S
■a 3 -o •= -5
uj Si cq a; Q
CO
00
£ C
b a
3 E
S c
2 ■— '
-a i
■S £«
^ o
<j >
CJ e3
| s
"5 =:
* :
ea
oo
r-
oo
■a
a
c
ea
CQ
CS
OO
x
■a
In
£
c
CQ
£2
*
o
'S
eu
■->
& 2
1/5 o
l) 3
>• >>
w *
CS
_* ,u
_ : O
_, . >, -3 m
_ O -C _'
> .2 r-"
u
•a "S
O rr
5 3^ Scq
•— JS <■ ' OJ E
~ * ' • B -
. J u a"«
> a a - u
•S ^ 3 J u
<u o « o •£
■a* u. .E — *
* j Cos
el
u
E
C3
*e*
E
u
o .Si.
?2 a'.E^"^
1«S§lB
■r = 3 E « ai
,C n ^= C E ea
■a 3 e^|s
S E V C "ea «
S •= j= ^ « M
a 2 b ■- ^ u
00 3 ° e ■ - CQ
^ ^ ^ oo « -
V X! • O al
■~ " ' ji .2 u
ea
E s
E E
^ a>
^ a:
E CQ
— '3 -o
E 30 O
« « O
CO ^ -=
3 .E e
g e £
"S 'o -S -C
r* a) em as
S ea JJ
= CQ c _
~ : u
E £
S « 3 ea
§• C3N ou —
-C-r- <Li CQ
a OO O. r
* — % .3.
00
(N
1999
Asiatic Herpetological Research
Vol. 8, pp. 25-28
Size and Shape Description of Oviductal Eggs of Draco obscurus formosus
(Squamata: Agamidae)
C.H. Diong1 and S.Y.T. Soon2
Division of Biology, School of Science, Nanyang Technological University, N1E, 469 Bukit Timah Road,
Singapore 259756; -Interactive Math Exploration Center, 02-16, Waterloo Center, Singapore 180261.
Abstract.-Owidactai eggs were obtained by an abdominal dissection from a gravid Draco obscurus formosus
which was captured near the northern limits of this species distribution during the Malaysian Heritage and
Scientific Expedition to Belum, Temengor Forest Reserve, Ulu Perak, Peninsular Malaysia in 1993 and 1994.
Egg size, shape, the species-specific egg bicone coefficient , clutch mass, and clutch volume are described. This
is the first report that describes the egg and clutch characters of this species.
Key words,
coefficent.
Reptilia, Squamata, Agamidae, Draco obscurus formosus. Peninsular Malaysia, egg shape, bicone
Introduction
Size and shape characteristics of eggs, as well as the
ecological implications of egg parameters, have been
extensively studied in birds (e.g.. Preston, 1968, 1969.
1974: Paganelli et al., 1974; Hoyt, 1979; Smart, 1991)
but rare in reptiles (Iverson & Ewert, 1991; Maritz
and Douglas. 1994). One reason for this neglect lies in
the fact that most squamate reptiles lay soft, flexible-
Figure 1 . A. The adult female Draco obscurus formosus
(ZRC.2.3693) from Sungei Halong, Temengor Rain For-
est, Ulu Perak, Peninsular Malaysia. SVL = 87 mm. B.
A clutch of four fully-shelled oviductal eggs of Draco
obscurus formosus. Note the pinched projections at
both ends of each egg.
shelled eggs. Length and width dimensions of such
eggs change as they absorb or lose water through the
soft parchment shell to produce changes in their size,
shape, volume, and surface area. Consequently, soft-
shelled eggs have to be measured in their oviducts or
soon after they are oviposited. This is in contrast to
rigid-shelled eggs of crocodilians, geckos, birds, and
some chelonians which can be measured at any time
after being laid.
Iverson and Ewert ( 1991 ) applied Preston's (1968)
formulation to describe reptile eggs firstly. This for-
mulation was developed to describe the shape of avian
eggs and assumed that an egg was axis-symmetric and
the revolved egg outline on the x-axis gives its volume
of revolution. Recently, Maritz and Douglas (1994)
Vol. 8,
p.2t
Asiatic Hei-petological Research
1999
y value
b
Figure 2. The coordinates and linear dimensions used to describe the shape of Draco obscurus formosus eggs;
the outline of the egg shape, excluding the pinched ends, is generated by Mathematica software program. See
text for details.
employed the Preston formulation to demonstrate the
shape of reptile eggs from two linear measurements,
egg length L, maximum width W, and the bicone coef-
ficient c2. The bicone coefficient is a species-specific
parameter which measures bluntness at both ends of
an egg: c2 is negative for eggs with pointed ends, pos-
itive for eggs with blunt ends, and zero when the
shape is a perfect ellipse.
During the Malaysian Heritage and Science Expedi-
tion to the Belum Temengor Forest Reserves in 1993
and 1994, a gravid female of Draco o. formosus, a
subspecies endemic to southern Peninsular Thailand
and Peninsular Malaysia (Boulenger, 1903, 1908;
Musters, 1983) was collected (Diong et al. 1995).
This presented an opportunity to collect oviductal
eggs for size and shape quantization for this subspe-
cies.
Material and Methods
Material examined
One gravid female (Fig. la) was collected on 9 Dec
1994 from a trunk of a large tree along Sungei [river]
Halong, about 2 km upstream of Camp Halong (5°
24 X 101° 18Ti), Temengor Rain Forest Reserve, Ulu
Perak, Malaysia, during the Belum Scientific Expedi-
tion (Diong et. al. 1995). Specimen was measured and
dissected the day after collection. Head and body
shape, as well as mass of body and egg were mea-
sured to the nearest 0.01 mm and 0.01 g by digital cal-
ipers (Mitutoyo) and electronic balance (Ohaus),
respectively. Voucher specimen was deposited in the
Zoological Reference Collection, School of Biologi-
cal Sciences, National University of Singapore.
Quantization of egg shape
Length (L) and maximum width (W) of each egg were
measured to obtain elongation (E = LAV), bicone
coefficient (c2) and volume (V) using the method
described by Maritz and Douglas ( 1994). The outline
1999
Asiatic Herpetological Research
Vol. 8. p. 27
of the egg was described parametrieally using the Pre-
ston formulation, as follows :
cos(8).
- (£)-.e<
0° < 0 < 360°
1 + c2cos 0),
Mathematica (1993) software programme was
used to generate the shape described by the paramet-
ric equations. A 35 mm slide of the clutch of eggs was
projected on to a white cardboard mounted on a wall
and three lines parallel to the y axis (c.a. 2/3 W) were
drawn to the outline of each egg (Fig. 2) to obtain
measurements of 1, w, L, and W from the projected
image; this procedure was repeated for the other half
of the egg so that the bicone for each egg was an aver-
age of six estimations. The bicone coefficient was
determined with the formula, c-, = -I . - 1 ) ,
where r = — , a = ~( 7 I ~ ' • anc' was surjse-
quently used to estimate egg volume, V (in cm ), as
follows: V = ^L^(l+|c2 + !4 Clutch vol-
ume was defined as the sum of individual egg volume
in the clutch.
Results
Size of female lizard
Body mass 10.02 g, snout-vent length (SVL) 87 mm;
tail length (TL) 167 mm; head length (HL) 16.78 mm;
jaw length (JL) 16.86 mm, head width (HW) 10.59
mm; hind leg length (HLL) 270 mm; hind foot length
(HFL) 170 mm; fore leg length (FLL) 270 mm; fore
foot length (FFL) 9 mm.
Clutch size, egg size, and shape quantization
of eggs
The clutch consisting of 4 oviductal eggs; 2 eggs in
each oviduct; 2 yolked ova and 4 whitish ova in right
ovary, 2 yolked ova and 5 whitish ova in left ovary;
yolked ova, 5.07 - 5.15 mm in diameter, white unde-
veloped ova 1.50 - 1.72 mm in cross diameter. Eggs
turgid, shelled with chalky-white parchment-like
membrane. Egg shape ellipsoidal, ends blunt, but each
with pinched cap at ends (Fig. lb, 2). Pinched ends
solid, thick, firm, flat and in same plane, less than half
a semi-circle; outline of lip-like pinched structure
asymmetric. Mean ± SD of L excluding pinched ends
for 4 eggs 11.83 ± 0.53 mm (range: 10.94 - 12.30
mm); L including pinched ends 13.00 ± 0.26 mm
(range: 12.14- 13.40 mm); W 8.71 ± 0.20 mm (range:
8.40 - 8.91 mm); elongation L/W 1.36 ± 0.08 (range:
1.23 -1.41); mean egg bicone coefficient c2 -0.021 ±
0.008 (range: -0.032 to - 0.010); egg volume 0.487 ±
0.022 cm3 (range: 0.460 - 0.510); egg mass 0.497 ±
0.022 g (range: 0.470 - 0.520 g); density 1.0205 ±
0.0009 (range: 1.0 196 - 1.0217). Total clutch volume
1.86 cm ; total clutch mass 1.99 g; relative clutch
mass [clutch mass divided by female (clutch plus
body) mass] in percent, 19.86; relative clutch mass
[clutch mass divided by female (body only, exclusive
of clutch) mass) in percent, 24.78
Discussion
The present specimen has TL/SVL ratio equaled to
1.92 which is a middle size compared to Musters'
(1983) report of 1.89 - 1.99 for females of this spe-
cies. Musters (1983) while reporting a mean SVL of
82 ± 7mm for four females of this lizard and a mean
clutch size of 3.7 for three females of Draco obscurus
formosus, made no reference to egg shape of this liz-
ard. Hendrickson (1966) recorded a mean clutch size
of 2 in D. melanopogon (n = 14) and a mean clutch
size of 4 in D. volans (n = 20). This suggests that
clutch sizes in D. o. formosus and D. volans may be
similar, being larger than that in D. melanopogan.
Among these gliding agamid lizards, clutch size is
probably constrained by body size and clutch mass as
a larger clutch mass is likely to reduce the horizontal
displacement covered during gliding. In the present
study, the total clutch mass accounted for almost 20
percent of female body mass.
The three Draco species, D. obscurus formosus,
D. melanopogan, and D. volans, all have contrasting
egg shapes. Causility of variation of egg shape in the
genus are unknown. The eggs are distinctly pointed at
both ends in D. melanopogan but are ellipsoidal,
blunt, and smoothly rounded at both ends in D. volans
(Hendrickson, 1966). Eggs of D. obscurus formosus is
a nearly perfect ellipsoid as indicated by the species-
specific bicone coefficient, c2 -0.021, which is very
close to Ci = 0, the value for a perfect ellipse. Addi-
tionally, the eggs are much rounder, as indicated by its
elongation factor of 1.36 which is smaller in eggs of
D. volans (E = 1.6) and D. melanopogon (E = 2.06),
as calculated from Hendrickson's (1966) L and W
measurements of the eggs. The most unusual structure
of D. o. formosus eggs is the flat projections pinched
outwards from both ends. The significance of the cres-
Vol. 8, p. 28
Asiatic Herpetological Research
1999
cent-shaped pinched ends is unknown, but they may
function as reserves of parchment shell materials to
allow the stretching and expansion of the egg during
development.
Acknowledgments
The first author thanks the Malaysian Nature Society
for permission to participate in the Belum Scientific
Expedition; to L. S. Tay for field assistance, and to T.
Hikida for identifying the specimen. This study was
partially supported by the Nanyang Technological
University, Singapore research grant RP10/92 to the
first author.
Literature Cited
Boulenger, G. A. 1903. Report on the batrachians and
reptiles. Fasciculi Malayenses Zoology, 1:130-176,
figs. 1 -3, pis. 5-10.
Boulenger, G. A. 1908. Report on the Gunong Tahan
expedition, May - Sept 1905. Ill Fishes, batrachians
and reptiles. Journal of the Federated Malay State
Museum, Singapore, 3: 61-69.
Diong, C. H., B. H. Kiew, and B. L. Lim. 1995. An
annotated checklist of the lizard fauna in the Temen-
gor Forest Reserve. Hulu Perak, Malaysia. Malayan
Nature Journal (Belum Expedition, Temengor 1993-
1994), 48(3&4): 353-356
Hendrickson, J. R. 1966. Observations on the fauna of
Pulau Tioman and Pulau Tulai. 5. The reptiles. Bulle-
tin of Raffles Museum, Singapore 34:53-71.
Hoyt, D. F. 1979. Practical methods of estimating vol-
ume and fresh weight of bird eggs. AUK 96: 73-77.
Iverson, J. B. and M. A. Ewert. 1991. Physical charac-
teristics of reptile eggs and a comparison with avian
eggs. Pp. 87-100. In D.C. Deeming and M.W.J. Fer-
guson (eds). Egg incubation: its effects on embryonic
development in birds and reptiles. Cambridge Univer-
sity Press, Cambridge, U.K.
Maritz, M. F. and R. M. Douglas 1994. Shape quanti-
zation and the estimation of volume and surface area
of reptile eggs. Journal of Herpetology 28(3): 281-
291.
Mathematica. 1993. Mathematica [computer file]: a
system for doing mathematics by computer. Version
2.2, Wolfram Research, Champaign, Illinois, U.S.A.
Musters, C. J. M. 1983. Taxonomy of the genus
Draco L. (Agamidae, Lacertilia, Reptilia). Zoolo-
gische Verhandelingen, 199: 1-120.
Paganelli, C.V., A. Olszowka and A. AR. 1974. The
avian egg: surface area, volume, and density. CON-
DOR 76: 319-325.
Preston, FW. 1968. The shape of birds eggs: mathe-
matical aspects. AUK 85: 454-463.
Preston, FW. 1969. Shapes of bird's eggs: extant
North American families. AUK 86: 246-264.
Preston, F.W. 1974. The volume of an egg. AUK 91:
132-138.
Smart, I.H.M. 1991. Egg-shape in birds. Pp. 101-1 16.
In D.C. Deeming and M.W.J. Ferguson (eds), Egg
incubation: its effects on embryonic development in
birds and reptiles. Cambridge University Press, Cam-
bridge, U.K.
1999
Asiatic Herpetological Research
Vol. 8, pp. 29-37
Diel Activity of Ranodon sibiricus (Amphibia: Hynobiidae) in Relationship to
Environment and Threats
Dag Dolmen1, Rudolf A. Kubykin2 and Jo V. Arnekleiv1
Norwegian University of Science and Technology, The Museum; N-7004 Trondheim, Norway. National
Academy of Science, Inst, of Zoology; Almaty 480032, Kazakhstan.
Abstract. -¥vt\d studies on the diel activity of Ranodon sibiricus were carried out in Dzhungaria, southeastern
Kazakhstan, in August 1994 and June 1995. Counts showed that adults and juveniles were strongly nocturnal,
which was also confirmed with the help of IR light/photocell equipment, whereas larvae were active both night
and day. The daily activity period of adults and juveniles started near the 5-lux limit and peaked around 23-01
hrs. Its length followed that of the night and was accordingly shorter in June than in August. When the activity of
aquatic adults and juveniles started in the early night, about 5% came out of the water and walked on land
alongside the brook. Most ranodons, however, were relatively stationary sit-and-wait predators in the water. The
nocturnal activity of/?, sibiricus protects it against dehydration (terrestrial animals), strong UV radiation and
diurnal predators. The most important task of the nocturnally and diurnally active larvae is to grow as fast as
possible to survive the first, hazardous hibernation. The difference in diel activity between adults/juveniles and
larvae reduces intraspecific competition and cannibalism within the population. Because of their secretive life,
metamorphosed stages of R. sibiricus are not easily accessible to predators or Man. Hence, the most important
threat is probably the large herds of cattle grazing in the area. Since adults and juveniles are well hidden by day,
when the cattle wade the brooks, they are fairly safe, but cattle may pose a great threat to ranodon eggs and
larvae.
Key words. -Ranodon sibiricus. Kazakhstan, diel activity, rare species, environmental adaptation, threats.
Introduction
A threatened, secretive species
The salamander Ranodon sibiricus Kessler, 1866 is
distributed in the Dzhungarian mountains of south-
eastern Kazakhstan and the extreme west of Xinjiang
province in China. Its range is very small and has
undergone many man-made changes during the past.
The species is therefore threatened and is on the red
list of the former Soviet Union/Kazakhstan (Bannikov
et al. 1978; Zhao and Adler 1993). Its habitat is cold,
clear mountain brooks. Because of their quite secre-
tive way of life, individuals are not always easy to find
even where they may be locally abundant. Although
Shnitnikov (1913) found it easily, Brushko and Nar-
baeva ( 1988) emphasized the difficulties of finding R.
sibiricus in the mountain rivers. Its secretive life is
also reflected in its nocturnal activity, an aspect briefly
touched upon by several authors (Shnitnikov 1913:
Paraskiv 1953; Kubykin 1986: Narbaeva and Brushko
1986; Wang 1990).
As part of a wider ecological study of Ranodon
sibiricus in Dzhungaria, we investigated its activity,
partly in 1993, but more thoroughly in 1994 and 1995,
to learn the details of its diel activity rhythm and pos-
sible adaptations to the environment. Several other
questions were also of interest. For instance, do the
larvae behave differently from the metamorphosed
animals to reduce intraspecific competition and canni-
balism (as in Triturus; see Dolmen 1988)? Does the
nocturnality of the species really make it almost safe
from terrestrial predators and Man? To what extent
can R. sibiricus avoid the heavy impact of some 150
cows which graze along and trample in the brooks
when crossing the study area twice a day in summer
(Kubykin et al. 1995; Dolmen et al. 1997)?
A preliminary report on these studies was pre-
sented by Dolmen et al. (1995). Hereafter. Ranodon
sibiricus is mostly referred to as ranodon.
Principles of measuring activity
In principle, there are at least three ways of mea-
suring the activity of an animal: 1 ) with an actograph
or other technical device such as light beam/photocell
equipment, 2) by interval trapping of active animals,
and 3) by counting active animals. All three methods
have been successfully used for Triturus species
(Salamandridae) in Europe (e.g. Himstedt 1971; Dol-
men 1983a,b; Griffiths 1985).
Vol. 8, p. 30
Asiatic Herpetological Research
1999
Preliminary studies
In June 1993. the trapping technique was tried out for
ranodons in a small brook in the Borokhudzir valley
in Dzhungaria. On 15 June, 10 simple funnel traps (1
L "Cola traps") and two more complicated traps with
eight entrances each (constructed by Arne Haug) were
placed in a 15 m long stretch of a small brooklet
(Brook 3) in which six ranodons and 50 double
clutches of eggs had been registered two days earlier.
Alternate traps had their entrances pointing down-
stream and upstream. The traps were checked/emptied
every third hour throughout a day and night, but no
ranodons were caught. The water temperature varied
between 3.8 °C and 7.6 °C. On 17 June, a similar set-
up was tried on a 15 m stretch of another, somewhat
larger brook (Brook 1) where, in addition to the ran-
odons living there naturally, 38 additional ones were
released. A few were caught during the next day and
night, but never more than two each time.
However, a study of a third brook (Brook 5) at
night revealed that many ranodons were going onto
land and wandering on the dew-wet banks beside the
brook. On a 500 m stretch at 23.00-24.00 hrs. (stan-
dard time), four men with torches counted 14 ran-
odons that were active on wet land and 1 1 hidden
under stones alongside the brook. Although aquatic
individuals were also active, the main movements up
and down the brook seemed to be taking place on
land, not in the water. The trapping technique in water
was accordingly unsuitable for measuring the activity
of ranodons.
For 1994 and 1995. it was therefore decided to use
the counting method for measuring the activity of ran-
odons, and for comparison, data from the use of light
beam/photocell equipment could serve as a control.
Description of the area
The study area, on the southern slopes of the River
Borokhudzir catchment in Dzhungaria at an altitude
of approximately 2200 m, consists of grazing for cat-
tle, bog, and juniper-covered hillsides. Two small trib-
utary brooks to the River Borokhudzir (Brook 1 and
Brook 5), approximately 200-300 m apart, were cho-
sen for the study. Both were spring-fed, about 2-50
cm deep and 30-80 cm wide, and had gravelly or
stony bottoms. In a few places, turf almost overgrew
and covered the water. Boulders, where terrestrial ran-
odons hid, could also be found on land alongside the
brooks. The velocity of the water at different sites
along the two brooks varied from 0.0-0.2 and 0.0- 1 .0
m/s, respectively. Measurements were made in August
1994 when the flow was low.
The weather in both periods was mostly clear. The
air temperatures in August 1994 and June 1995 varied
between 5.7 °C and 17.1 °C, and 3.5 °C and 21.0 °C,
respectively. The air humidity in August 1994 varied
from less than 50 to 100% RH, with maximum
humidity at night. The water temperature at the site
investigated in Brook 1 varied in August 1994
between 5.5 °C in the early morning and 19.3 °C in
the afternoon, and in June 1995 between 5.0 °C and
20.0 °C. In Brook 5, the water temperature varied
between 6.2 °C and 14.8 °C in August 1994 and 4.8
°C and 15.6 °C in June 1995. A more detailed descrip-
tion of the area is given by Dolmen et al. (1997).
Material and Methods
Field investigations
The study took place in August 1994 and June 1995.
Two persons equipped with good torches examined a
total of 90 m and 190 m, respectively, along the two
brooks (Brook 1 and Brook 5) every second hour for
three days and nights. The walking speed was approx-
imately 8 m/min. Deep pools and shallow slowly-
flowing water were especially well examined, and
also the nearest 2-3 m on land alongside the brooks.
No stones were turned, however, and no ranodons
were disturbed, except possibly by the torchlight. The
two brooks had been divided into sections of 5 or 10
m, respectively, for statistical use. and the number of
ranodons in each section were counted separately. The
numbers in different main developmental stages were
also kept apart: 0+ (young larvae, less than one year
old), 1+ (old larvae and metamorphosed individuals
from the previous year), larger juveniles, and adults.
Aquarium investigations
In December 1994, additional investigations of the
activity of two ranodon individuals, an adult and a
large juvenile, were carried out in Almaty. An experi-
mental aquarium was made of transparent plexiglass
shaped like a circular channel. The outer diameter was
36.5 cm, the inner diameter 15 cm and the height 10
cm. The aquarium was filled half full of water brought
from Dzhungaria and some large stones acted as shel-
ter for the animals and to enable them to climb up into
the air. The aquarium was equipped with an infra-red
light beam/photocell system (Visolux LS 4-GaAs).
The beam was set to a diameter of about 2 mm and
focused near the bottom of the aquarium, where the
ranodons usually walk around. Interruptions of the
beam were recorded by an electric counter (Visolux
LU GaAs), which was read every second hour
throughout eight days and nights. Food was not pro-
1999
Asiatic Herpetological Research
Vol. 8, p. 31
vided during the experiment. The aquarium was
placed inside a building, close to a north-facing win-
dow. The light regime was therefore natural, i.e.
approximately like outside. The temperature was con-
stant and slightly lower than the usual room tempera-
ture.
The same equipment, connected to a 12V car bat-
tery, was used for an adult and a large juvenile in
D/hungaria in June 1995. The aquarium was pro-
tected from disturbance and strong sunshine by being
placed halfway under a car and partly covered with a
blanket. The water was replenished (in daytime) once
during the experiment, which ran for barely three days
and nights. On the second evening, the onset of activ-
ity was studied in more detail at 5-minute intervals for
two hours.
Environmental factors
Light intensities between 0 and 10 lux normally act as
Zeitgeber for activity in plants and animals (cf. Dol-
men 1983b). The 5-lux value is therefore often used in
activity studies as a limit between day and night. In
our study it was determined subjectively, evening and
morning. The 5-lux value in Dzhungaria occurs
roughly 10-15 minutes before (or after) the 0.1-0.5
lux values, which corresponds well with the light
intensity required for reading a newspaper, for
instance. This was confirmed with a Hartmann and
Braun ECLX 4 luxmeter.
The times for reading the Visolux counter were set
approximately symmetrically around the darkest time
of night (ca. 24.00-00.30). All hours mentioned here-
after refer to standard time, not summer time. An
important difference in the understanding of diagrams
based on the two methods used for measuring activity
here is that a) the counting method measures the
activity at the time of counting, whereas b) the IR
beam/photocell method measures the activity during
the two hours preceding the time when the counter is
read.
Statistics
Wilcoxon's matched-pairs signed-ranks test (two-
tailed) was used to test any significance levels in the
activity measured in the field, the number of ranodons
within the different brook sections being counted for
an hour and comparison being made with the situation
two hours later.
The same test was used for the aquarium study,
but it was based on the ranodon counts for all the days
within a certain time interval combined, and these
were compared with the corresponding counts in the
next time interval.
The chi-square test was used to find out whether
or not the activity patterns had a significant diurnal
(06-18 hrs.) or nocturnal (18-06 hrs.) predominance,
and the chi-square test with two variables withoul
expected values was used to test any differences in
activity pattern between, for example, adults and lar-
Results
The field activity studies
The activity of Ranodon sibiricus was definitely noc-
turnal, but with some modifications with respect to the
developmental stage and the month of the year. The
animals in all stages were amazingly clever at hiding
during parts of the day and night. Several were seen at
night on a gravelly bottom along stretches of the
brook which we had searched very thoroughly in day-
time without finding any.
In August 1994, the diel activity showed basically
the same patterns in both brooks, although the peak
apparently varied slightly from day to day between 21
and 01 hrs. (Fig. 1).
Adults and juveniles had similar patterns, and seen
together the rise in activity level from 19 to 21 hrs.
was always statistically significant (P<0.002: Wil-
coxon's signed-ranks test, see Fig. 1 ). Likewise, the
decrease in activity from 03 to 05 hrs. was always sig-
nificant in Brook 5, where most animals were regis-
tered (P<0.002). The variation in the time of peak
activity from day to day was usually not significant.
In Brook 1, the larvae showed a similar rise in
activity from 19 to 21 hrs. When 0+ and 1+ larvae are
counted together, the increase is significant (P<0.002
or P<0.02) on two of three dates. The activity of 0+
larvae in Brook 5 was not as well defined as in Brook
1, being much more diurnal. In contrast to adults and
juveniles, and also to the larvae of the other brook,
which were all mainly nocturnal (P«0.001; chi-
square test), the larvae of Brook 5 showed a much
higher degree of diurnality (nocturnality tested:
0.20<P<0.30). Indeed, traces of diurnal activity can
also be seen in the 0+ larvae of Brook 1 .
The period of activity of this species fitted very
well with the light and dark periods, i.e. activity was
connected with the part of the 24-hour period when
the light intensity was below 5 lux. This was approxi-
mately 20.00-05.30 hrs. at that time of year. Except
for young larvae, any activity outside that period was
negligible.
A pattern similar to that of August 1994 was
revealed in June 1995. The period of darkness (<5
Vol. 8, p. 32
Asiatic Herpetological Research
1999
Hrs.
09 11 13 15 17 19 21 23 01 03 05 07 09 j9 11 13 15 17 19 21 23 01 03 05 07 09
45-
40-
3S -
Hrs
09 11
13 15 17 19 21 23 01 03 05 07 09 09 11 13 15 17 19 21 23 01 03 05 07 09
25
11 13 15 17 19 21 23 01 03 05 07 09 09 1 1 13 15 17 19 21 23 01 03 05 07 09
Figure 1 . Diel activity of Ranodon sibiricus, based on
counts in Brooks 1 and 5 in August 1994. Levels of sta-
tistical significance: * P<0.05 or P<0.02; ** P<0.01 or
P<0.002.
lux) in June was shorter than in August, i.e. about
21.00-04.30 hrs., and the activity peaks of adults and
large juveniles were narrower, at 23 (21) or 01 hrs.
(Fig. 2).
The youngest stage (1 + ) showed activity peaks
varying from 21 to 03 hrs. and also some diurnal
activity. At least three times, larvae (one each time)
were even registered directly exposed to sunshine, at
1 1, 13 and 17 hrs. Nevertheless, on the whole, the lar-
vae definitely had a nocturnal pattern.
The activity period of the species again fitted very
well with the (shorter) dark period. The rise in activity
from 19 to 21 hrs. was always significant (P<0.002 or
0.02) in Brook 5, both for adults/juveniles and 1+ lar-
vae, as was the decline from 03 to 05 hrs (P<0.002,
0.01, 0.02 or 0.05), and usually even 01-03 hrs. for
adults and juveniles in both brooks (P<0.002, 0.02 or
0.05). The day-to-day variation in peak activity seen
at midnight was not significant.
The aquarium studies
In the aquarium investigations in December 1994, the
ranodons also showed a definite nocturnal activity,
with peak activity at 20-22, 22-00 and/or 00-02 hrs. A
cumulative curve for the whole period of investigation
5
10-
15
20-
I 11 13 15 17 19 21 23 01 03 05 07 09 09 11 13 15 17 19 21 23 01 03 05 07 09
Figure 2. Diel activity of Ranodon sibiricus in Brooks 1
and 5 in June 1995. For explanation, see Fig. 1.
had a main peak at 02 hrs. (i.e. peak activity at 00-02
hrs.) and a minor peak at 22 hrs. (i.e. 20-22 hrs.). with
little or no activity during the light hours. The rise in
activity from 16-18 to 18-20 hrs. and from 22-00 to
00-02 hrs. was significant (P<0.05), as was the
decrease from 00-02 to 04-06 hrs. (two time intervals
seen together) (Fig. 3).
The activity period of the animals at this time of
year was clearly longer than the activity measured in
summer, as was the period of darkness (<5 lux),
which lasted from approximately 17.30 to 08.00 hrs.
The aquarium study in June 1995 confirmed the
results of the field investigations, although there were
minor deviations, probably for methodological rea-
sons. Activity was negligible until 21 hrs. when a rise
in activity occurred resulting in a peak at 21-23, 23-01
or 01-03 hrs. (Fig. 4).
In the more detailed aquarium investigations on 20
June, the activity started about 15 minutes before the
5-lux limit was reached in the open. However, since
the aquarium was partially covered (see Methods), the
1999
Asiatic Herpetological Research
Vol. 8, p. 33
Hrs.
12 14 16 1!
20 22 00 02 04 06 08 10 12
Hrs.
13 15 17 19 21 23 01 03 05 07 09 11 13
No.
Figure 3.Diel activity of two Ranodon sibiricus speci-
mens kept in an aquarium under natural lighting condi-
tions for eight days and nights in December 1994,
based on the IR light/photocell method. Level of statis-
tical significance: * P<0.05.
light intensity there was a bit lower and the activity
probably started at a light value very close to 5 lux. It
increased gradually over the next hour (Fig. 5).
Observations of aquatic and terrestrial ran-
odons
By far the majority of active ranodons were found
in the water, not on land. The frequencies of finds
made on land relative to the total number of ranodon
counts were only 6.1% (N=425) and 3.6% (N=279)
for August 1994 and June 1995, respectively. The
number of ranodons counted on land alongside the
brooks was thus relatively low, but sometimes
increased when the number counted in the water
increased. Animals walking on the moist grassy
ground beside the brooks had a wet skin and were
considered not to be really terrestrial, but aquatic ani-
mals which had only left the water temporarily for
some reason.
Not all ranodons were active to the same degree at
the same time, not even near midnight. In June 1993,
when we counted ranodons on land at 23.00-24.00
hrs., i.e. when the activity was at its highest, 14 were
seen walking along the bank, but another 1 1 really ter-
restrial specimens (with a dry skin) were still passive
and very sluggish, hiding under stones.
Discussion
The activity pattern
Ranodon sibiricus proved to be highly nocturnal, with
very little, if any, activity during the day. An exception
was the young larvae (0+) in August, in part also the
one-year old larvae (1 + ) in June, which showed a cer-
tain amount of diurnal as well as nocturnal activity.
The 5-min. reading in the aquarium study showed in
detail that the ranodons gradually started their activity
near the 5-lux limit in the evening. When that limit
150-1
100
50
0
350
300-
250-
200-
150-
100
50-
0
20O
150
100-
50
0
19-20 June 1995
20-21 June
21-22 June
— i 1 l — i 1 1 1 1 1 —
13 15 17 19 21 23 01 03 05 07 09 11 13
Figure 4. Diel activity of two Ranodon sibiricus speci-
mens kept in an aquarium under natural lighting condi-
tions for nearly three days and nights in June 1995,
based on the IR light/photocell method.
was again reached in the morning, the activity had
decreased to approximately zero. This means that
even though the species is clearly nocturnal, it uses all
the time it can get for activity, i.e. mainly hunting.
Most earlier authors have noted the extreme noc-
turnal habits of the ranodons and the more diurnal
habits of the larvae (Shnitnikov 1913; Kubykin 1986;
Narbaeva and Brushko 1986). Metamorphosed speci-
mens, both in water and on land, hide under stones
during the day, but come out at night and often move
upstream or downstream for some distance. Wang
(1990) stated that in western Xinjiang, China, ran-
odons also hides among plants and under stones dur-
ing the day and is active between 24 and 06 hrs. The
Xinjiang province, like the rest of China, follows
Beijing time, which is three hours earlier than sun
time in western Xinjiang. The true activity time of
ranodons in western Xinjiang should therefore be
around 21-03 hrs., i.e. similar to that found in our
investigations in eastern Kazakhstan.
Vol. 8, p. 34
Asiatic Herpetological Research
1999
19
20
21
22
24
01
No.
5 mm.
10-
5-
0
20 June
19
Figure 5. Details of the onset of activity of two Ranodon
sibiricus specimens kept in an aquarium under natural
lighting conditions on 20 June 1995, based on the IR
light/photocell method. Activity values are shown as
counts per 5 minutes (dots) and per 2 hours (trian-
gles). The activity started near the 5-lux limit of light
intensity (see text for further explanation).
We had no opportunity to investigate newly-
hatched larvae. In 1995, in the most favourable brook
(Brook 1), the first larvae hatched during the second
half of June. According to Paraskiv (1953), newly-
hatched larvae remain in calm, shallow water well
illuminated by the sun, where they hide among stones
on the bottom. However, they often come out and lie
on the stones, and are active by day, not avoiding the
sunshine (cf. Kubykin 1986). We found that at least
part of this diurnal activity lasted throughout the sum-
mer - although the main activity was nocturnal in
August - and even to some extent in the next year
(June). A well-defined phase shift from diurnal to noc-
turnal activity, as described, for example, for Triturus
cristatus larvae (see Dolmen 1983a,b), probably does
not take place. Paraskiv (1953) mentions that older
larvae, at the time of their metamorphosis when their
gills are becoming resorbed and they are going onto
land, avoid the sunshine and keep to shady places.
Water phase and land life
The metamorphosed ranodons stay in water or on
land, or alternate more or less regularly between these
two media. In daytime, but also sometimes at night,
we found terrestrial individuals in damp hollows
under stones and the like within a few metres of the
water. We made no attempt to specifically measure the
activity of such animals. The activity of ranodons in
the brooks increased at night, however, and some also
went up on to land. We are therefore dealing with two
categories of ranodons on land: true terrestrial ani-
mals, which have a dry skin and which stay on land
for a day or more, and aquatic ranodons, which have a
wet skin and which only temporarily come out of the
water (Dolmen et al. 1997).
Shnitnikov (1913) and Paraskiv (1953) also noted
that juvenile and adult ranodons leave the water or
their terrestrial hiding places at twilight and in dark-
ness, and are then active and are found on the banks of
brooks, where they often move long distances (cf.
Kubykin 1986; Narbaeva and Brushko 1986).
However, as these authors pointed out. not all ran-
odons leave the water at night, at least not at the same
time. The majority, in fact, stay in the water and may
only occasionally come up. We found that when the
weather had been dry for many days (August 1994
and June 1995), relatively fewer ranodons were found
on land, walking around at night or hiding under
stones, than when the weather was wet (June 1993).
Environmental adaptations
The nocturnal/crepuscular activity pattern in amphibi-
ans is probably ultimately an adaptation to the night
and day temperature and air humidity cycles. The vul-
nerability of the animals to dry conditions makes it
necessary for them to hide during the driest and hot-
test hours, and even when, like the ranodons, they stay
in water, this pattern is maintained. Most urodeles are
thus primarily nocturnal, although their activity pat-
tern may vary ontogenetically (e.g. Noble 1954;
McDiarmid 1994). The activity is proximately con-
trolled by the light/dark cycle. Different temperature
regimes, even a rise in temperature of as much as 10-
15 °C, seemed to have little, if any, influence on the
activity pattern of Ranodon sibiricus. Relative humid-
ity, or at least the moisture on the ground, could be
important for whether or not amphibians will walk on
land, however. All records of ranodons walking on
land were made when the air humidity was above
80% RH, always between 21.00 and 03.00 hrs.
Another factor which could represent a threat to
Ranodon sibiricus, living at high elevations (ca. 1700-
2700 m), is the strong UV radiation. Except for a very
few larvae of the youngest stages (0+ in August and
1+ in June), no animals were seen voluntarily expos-
ing themselves directly to the sun. For cold-stenother-
mic animals like R. sibiricus, it is probably even more
important to be noctumally active than it is for most
other amphibians. High temperatures, i.e. more than
22 °C, are reported to be lethal, at least to ranodon lar-
vae (Brushko and Narbaeva 1988). Temperatures were
as low as 6.0-11.5 °C in the air and 4.8-1 1.0 °C in the
water during the peak aquatic and land-walking activ-
ity of ranodons at night. Maximum air temperatures
during the day were 17.1-21 °C, and water tempera-
1999
Asiatic Herpetological Research
Vol. 8, p. 35
Hrs. 11 13 15 17 19 21 23 01 03 05 07 09 09 11 13 15 17 19 21 23 01 03 05 07 09
%
40 H
30
20 H
10
0
10
20
30
40
50
_i i _i i i_
Brook 1
— ad., |uv. N=166
— 0+ larvae N=168
-- 1+ larvae N=28
15-18 Aug. 1994
ad., juv. N=425
0+ larvae N=151
Brook 1
ad., juv. N=75
1+ larvae N=52
18-21 June 1995
Brook 5
ad., juv. N=279
1+ larvae N=409
Figure 6. Relative degree of activity (%) of Ranodon sibiricus adults/juveniles and larvae in Brooks 1 and 5 (cf. Figs.
1-2). Young larvae (0+, and in part 1+) exhibit a markedly greater degree of diurnality than older life stages.
tures reached 19.3-20.0 °C. A few larvae were
counted during the warmest periods, too.
We made no specific study of the possible influ-
ence of moonlight on the activity of ranodons. How-
ever, when we compared our data on activity with
notes on the weather, etc, we found no trend of, for
instance, decreasing activity when the half moon (at
the most) was sometimes shining. The light regime
under such circumstances was also always well below
the 5-lux limit.
Ranodon sibiricus is clearly more nocturnal than,
for instance, the Triturus species studied by Dolmen
( 1983a,b). It can also be seen that the activity period
of R. sibiricus in June was shorter than in August,
which is in conformity with the length of the night. A
similar phenomenon was shown for the more crepus-
cular Triturus vulgaris and T. cristatus in Norway
(Dolmen 1983a,b). Moreover, although normally two-
peaked, in northern latitudes at midsummer the crep-
uscular peaks of the Triturus species fused, and the
activity curve thus revealed only one, long midnight
peak when real nights (<5 lux) disappeared. Espe-
cially T. vulgaris, being the more crepuscular species,
takes advantage of these long periods of twilight in
northern latitudes in that its hunting day thereby
becomes longer and its growth better.
The activity period of the strictly nocturnal Ran-
odon sibiricus, however, becomes shorter at midsum-
mer. It is advantageous for an animal to have the
opportunity to seek food for as many hours as possi-
ble; the ranodons in fact spends the whole night. Its
activity is limited, however, by the varying light
regime through the season, i.e. the period per day and
night when light intensity is below 5 lux, which again
is relatively short at midsummer. The need for protec-
tion against climatic factors, as described above, and
possibly from (diurnal) predators thus seems to be
greater than the need for extra growth in metamor-
phosed ranodons.
However, a marked difference could be seen in the
diel activity of metamorphosed ranodons and larvae,
especially 0+ larvae aged 1-2 months (Fig. 6). The
youngest stages seem to be more or less active both
day and night. Still younger larvae than those we have
studied are possibly even more diurnally active (cf.
Paraskiv 1953). A probable explanation of the pro-
longed activity of the larvae, compared to older
stages, is their need to eat and grow as much as possi-
ble during the short frost-free season in the moun-
tains. Being large may perhaps increase their chances
of surviving their first, most hazardous, winter. Grow-
ing is therefore probably their most important task. A
larger size also makes their migration up or down the
brook to hibernation sites in late autumn easier and
protects them from predatory fish (see below).
By staying during the summer in the lower,
warmer part of small brooks, in shallow water, and
alternating between shade and sunshine (Paraskiv
1953: Dolmen et al. 1997), the metabolism of the lar-
vae is raised and kept at a near optimal level. There
are, however, certain limits for a cold-stenothermic
animal like Ranodon sibiricus. Small larvae are sensi-
tive to warm weather, and 22 °C is said to be lethal
(Brushko and Narbaeva 1988).
Such a difference in diel activity and microhabitat
between adult urodeles and their larvae is not uncom-
Vol. 8, p. 36
Asiatic Herpetological Research
1999
mon (McDiarmid 1994). Dolmen (1983a,b; 1988)
interpreted it as a means to reduce intraspecific com-
petition between different developmental stages and
as protection against cannibalism, which may be com-
mon in salamanders and which is also known to occur
in Ranodon sibiricus (Kubykin 1986: Wang 1990:
Kuzmin 1991a). In species whose adults and larvae
live sympatrically, a behavioural mechanism which
favours the avoidance of cannibalism could presum-
ably be of adaptive value.
Hunting strategy
During our preliminary studies in June 1993, the
method we used for trapping ranodons in water failed
and we concluded that most translocations of Ran-
odon sibiricus, at least at that particular time of year,
probably took place on land. However, only a small
proportion of our many records of active ranodons in
1994 and 1995 were made on land. We therefore con-
clude that most of their activity, like hunting (not
longer translocations), is nevertheless aquatic. Hence,
ranodons are probably largely sit-and-wait hunters, as
maintained by Paraskiv ( 1953), too; they do not move
about much in the water. This contrasts with the Euro-
pean Triturus species (see Dolmen 1983a,b), which
live in the stagnant water of ponds and small lakes.
For a running-water species like R. sibiricus, it may
be more economic to sit and wait for drifting prey
than to spend energy looking for them.
Our preliminary results on food items showed that
Ranodon sibiricus is an opportunist when it comes to
choice of prey, and thus supports the results of stom-
ach analyses made by Kuzmin (1991b). There was
also a tendency for ranodon stomachs to be at their
fullest after midnight. Based on the undigested stom-
ach contents of a few specimens caught in daytime,
Shnitnikov (1913) suggested that the ranodons feeds
by day. However, apparently no ranodons caught by
him at night were examined.
Diel activity and predators
During the day, metamorphosed ranodons cleverly
hide under boulders and in earth cavities in the brook
bed and are often difficult to catch. Because of their
strict nocturnality and their ability to hide in daytime,
night searches with good torches are the best way of
looking for ranodons in a brook. Searches in daytime
may be strenuous, and often negative if the population
density is not large. At night, however, the animals are
easy to see in small and medium-sized brooks.
It can be expected that the activity cycles of a
predator and its prey will coincide. Wild boars Sus
scrofa and grey herons
Ardea cinerea are said to be natural predators of
ranodons (Brushko and Narbaeva 1988), likewise
black storks Ciconia nigra (Shnitnikov 1913). We
think that some of the many species of birds of prey
which occur in great numbers in the mountains (e.g.
buzzards Buteo spp.) will also occasionally take ran-
odons if they had the opportunity. However, of these
terrestrial predators, only the wild boar is nocturnal.
Adults and large juvenile ranodons therefore seem to
have few, if any, really important predators. However,
two kinds of fish (Diptychus maculatus and D.
dybowskii (Cypriniformes)) are present in the River
Borokhudzir, at least in the main river. Fish, which are
usually nocturnal or crepuscular, may therefore be
potential predators of ranodon larvae. However, since
these fish are absent, or extremely rare, in the small,
spring-fed brooks in which the ranodons breeds, they
are hardly a threat to the ranodons there.
The influence of cattle
The negative influence of cattle on Ranodon sibiricus
has been mentioned by several authors (Kubykin
1986; Narbaeva and Brushko 1986; Brushko and Nar-
baeva 1988; Wang 1990; Dolmen et al. 1997). Dam-
age is mechanical when the cattle trample in the
brooks, crushing ranodons and destroying eggs. Their
excrements may also pose a threat to eggs and small
larvae.
In 1993, up to about 150 cows, watched by shep-
herds on horseback, twice daily crossed the brooks of
the study area. There were also flocks of horses, sheep
and goats. Corresponding numbers of domestic ani-
mals were seen in 1994 and 1995. Most crossing of
brooks took place in daylight at about 8 hrs. and 20
hrs., and at that time the adult and juvenile ranodons
were still relatively safe in their hiding places. Never-
theless, we twice found dead ranodons which had
been crushed under the feet of cows. On other occa-
sions, we came across mechanically damaged eggs,
presumably the victims of wading cattle. Larvae, too,
may suffer from cattle. However, we believe that the
damage to metamorphosed ranodons is not really
large (cf. Kubykin 1986).
Conclusions
Ranodon sibiricus is a nocturnal species in the juve-
nile and adult stages, whereas the activity of young
larvae is more evenly distributed through the day and
night. The difference in diel activity between larvae
and metamorphosed stages probably reduces intraspe-
cific competition and cannibalism. In daytime, the
ranodons hide cleverly in the brook bed or on land.
This secretive life makes them difficult to find, both
1999
Asiatic Herpetological Research
Vol. 8. p. 37
for diurnal predators and people. At night, however,
the ranodons are easy to see. Their nocturnality also
makes adult and juvenile ranodons less vulnerable to
mechanical damage from grazing cattle, but eggs and
larvae may easily be harmed.
Acknowledgments
Marina V. Basargina was our excellent interpreter and
good helper during all three field trips. Richard Binns
has kindly improved the language of the manuscript.
Literature Cited
Bannikov, A.G.; I.S. Darevsky and N.N. Shcherbak
1978. Krasnaya kniga SSSR (Red book of the Soviet
Union). Moscow.
Brushko, Z.K. and S.R Narbaeva 1988. Razmnozhe-
nie semirechenskogo lyagushkozuba v doline reki
Borokbudzir (Yugo-Vostochnyy Kazakhstan) (Repro-
duction of the Semirechensk salamander in the
Borokbudzir river valley (South-Eastern Kazakhstan).
Ekologiya 2:45-49 (Sverdlovsk).
Dolmen, D. 1983a. Diel rhythms and microhabitat
preference of the newts Triturus vulgaris and T. cris-
tatus at the northern border of their distribution area.
Journal of Herpetology 17:23-31.
Dolmen, D. 1983b. Diel rhythms of Triturus vulgaris
(L.) and T. cristatus (Laurenti) (Amphibia) in Central
Norway. Gunneria 42:1-34.
Dolmen, D. 1988. Coexistence and niche segregation
in the newts Triturus vulgaris (L.) and T. cristatus
(Laurenti). Amphibia-Reptilia 9:365-374.
Dolmen, D. : J. V. Arnekleiv and R. A. Kubykin. 1997.
Habitat and abundance of the Semirechensk sala-
mander (Ranodon sibiricus) at a site in the Borokhujir
River Valley, Kazakhstan. Advances in Amphibian
Research in the Former Soviet Union 2: 45-70.
Dolmen, D.; R.A. Kubykin and J.V. Arnekleiv 1995.
Diel rhythms of Ranodon sibiricus (Hynobiidae). R
20. //; N. Ananeva (ed.). Second International Asian
Herpetological Meeting, 6-10 Sept. 1995, Ashgabat.
[Abstr.]
Griffiths, R. 1985. Diel profile of behaviour in the
smooth newt, Triturus vulgaris (L.): an analysis of
environmental cues and endogenous timing. Animal
Behaviour 33:573-582.
Himstedt, W. 1971. Die Tagesperiodik von Salaman-
driden. Oecologia 8:194-208.
Kubykin. R.A. 1986. K ekologii semirechenskogo
lyagushkozuba (On the ecology of the Semirechensk
salamander). Pp. 187-191. In E.V. Gvozdev (ed.),
Redkie Zhivotnye Kazakhstana. Nauka Publ., Alma-
Ata (Almaty).
Kubykin, R.A.; D. Dolmen; J.V. Arnekleiv and D.
Mikutavicius 1995. Influence of cattle-breeding on
density of Ranodon sibiricus (Hynobiidae) in spawn-
ing places (Dzhungarski Alatau Mts.). P. 35. In N.
Ananeva (ed.). Second International Asian Herpeto-
logical Meeting, 6-10 Sept. 1995, Ashgabat. [Abstr.]
Kuzmin, S.L. 1991a. A review of studies on amphib-
ian and reptilian feeding ecology in the USSR. Herpe-
tozoa 4:99- 115.
Kuzmin, S.L. 1991b. Feeding of the salamander Ran-
odon sibiricus. Alytes 9:135-143.
McDiarmid, R.W. 1994. Amphibian diversity and nat-
ural history: an overview. Pp. 5-15. //; R.W. Heyer;
M.A. Donnelly: R.W. McDiarmid: L-A.C. Hayek and
M.S. Foster, Measuring and monitoring biological
diversity. Standard methods for amphibians. Smithso-
nian Inst. Press, Washington.
Narbaeva, S.R and Z.K. Brushko 1986. Chislennost',
razmeshenie i razmernyy sostav populyatsii semirech-
enskogo lyagushkozuba v istokakh reki Borokhudzir
(Population number, local distribution and size com-
position of the Semirechensk salamander in the
sources of the Borokhudzir River). Pp. 181-186. In
E.V. Gvozdev (ed.), Redkie Zhivotnye Kazakhstana.
Nauka Publ., Alma-Ata (Almaty).
Noble, G.K. 1954. The biology of the Amphibia.
Dover Publ., New York.
Paraskiv, K.P 1953. Semirechenskiy triton (lyagush-
kozub) (The Semirechensk salamander (lyagushko-
zub)). Izvestiya Akademii Nauk Kazakhskoy SSR,
Ser. Biol. 8:47-56 (Alma-Ata (Almaty)).
Shnitnikov, V.N. 1913. Neskol'ko dannykh o Semire-
chenskom tritone (Ranidens sibiricus Kessl.) (Some
data about the Siberian salamander (Ranidens sibiri-
cus Kessl.)). Ezhegodnik Zoologicheskogo muzeya
Akademii Nauk SSSR 18(53):1 18-122 (St. Peters-
burg).
Wang, Xiu-ling 1990. [Six unpublished abstracts on
Ranodon sibiricus by Xiu-ling Wang and collabora-
tors at Xinjiang Normal University, Urumqi. (In Chi-
nese, translated to Russian.)]
Zhao, E. and K. Adler 1993. Herpetology of China.
Society for the Study of Amphibians and Reptiles.
Oxford, Ohio.
1999
Asiatic Heij>etological Research
Vol. 8, pp. 38-42
The Hemipenes of Chinese Species of Deinagkistrodon and Gloydius
(Serpentes: Crotaiinae)
Peng Guo1, Fu-ji Zhang, and Yue-ying Chen
Chengdu Institute of Biology: the Chinese Academy of Sciences, Chengdu 610041, China
Abstract.- The hemipenes of eight species of two genera, Gloydius and Deinagkistrodon are described in detail
and illustrated. The results indicate that ( 1 ) the structures of hemipenes of Gloydius markedly different from that
of Deinagkistrodon, (2) more similarities are present among species of Gloydius. At the end of the paper, the
taxonomic relationships among species revealed by hemipenial structures are discussed.
Key words.- Serpentes, Crotaiinae, Deinagkistrodon, Gloydius, Hemipenes.
'Present address: Sichuan Yibin Teachers College. Yibin, Sichuan 644007. China.
Introduction
Since Cope has firstly implied the characters of reptil-
ian hemipenes to the classification in 1893, their
important value in the classification and phylogeny
was realized by more and more researchers around
world (Pope, 1935; Smith, 1943: Dowling et al., 1960;
Zhang et al., 1984; Zhang, 1986; Branch, 1988; Mao,
1989; Gloyd et al., 1990; Malnate, 1990). Although
some of hemipenes of Chinese Deinagkistrodon and
Gloydius were described (Pope, 1935; Smith, 1943;
Mao, 1989; Gloyd et al., 1990; Malnate, 1990) previ-
ously, the authors didn't illustrate them except Gloy-
dius brevicaudus and Deinagkistrodon acutus.
Prior to this paper, a comparative anatomy on
skull of these two genera was done (in press.), we
confirm that there are eight valid species of Deinagki-
strodon and Gloydius in China. At the present work,
the feathers of the hemipenes of these eight species
will be described in detail, and the taxonomic rela-
tionships indicated by their structures will also be dis-
cussed, they will provide additional and further data
for the classification and systematic of these species.
Material and Methods
The materials used in this study are based up forma-
lin-preserved adult specimens; all of them are depos-
ited in Chengdu Institute of Biology, the Chinese
Academy of Sciences. The number and locality of
examined and figured specimens are listed in Table 1 .
In this paper, the descriptive terminology gener-
ally followed literature (Dowling et al., 1960; Zhang
et al., 1984: Branch, 1986). In a majority of cases, the
fully everted hemipenes were illustrated. In a few
cases, the partly everted hemipenes were everted arti-
ficially. The drawings were done under the binocular-
dissecting microscope.
Results
Gloydius ussuriensis (Emelianov). The divided
hemipenis (Fig.l) extends to eighth subcaudal plate
and is forked opposite the third. While the Russia
(Kebrovka, Primorskiy Kray) specimens described by
Gloyd et al. (1990) and Malnate (1990) extend to the
eleventh subcaudal and are forked for eight subcau-
dals. It is spinous proximally, calyculate distally. The
transition from spines to calyces is inconspicuous.
The calyculate area is about equal to that of spinous
one. The calyculate edges are spinous. Over sixty
spines, they reduce in size distally and away from sul-
cus. Base of organ, proximal to the large spinous, is
beset with very minute spines. Centripetal sulcus dis-
tinct, forking near the crotch which is about the sec-
ond subcaudal, it ends at the tips of the organ. The lips
of sulcus are spinous and calyculate in the respective
areas of ornamentation.
The M. retractor penis magnus ends in the twenty-
third to twenty-fifth subcaudal, it is forked at the level
of the eleventh subcaudal before its insertion the dor-
sal organ. The dorsal lobe is one subcaudal longer
than the ventral lobe (in situ).
G. brevicaudus (Stejneger). The hemipenes (Fig. 2)
of the specimens from Anhui and Zhejiang extend to
the fifth to eighth subcaudal plate and are forked at the
level of the third to fourth subcaudal. Base of the
organ nude. The proximally half of the organ is
spinous and the other half calyculate. The calyculate
ridges bears tiny spines. Gloyd et al. (1990) also
described the hemipenes from Anhui, they were sure
that the lips of top calyces were smooth. The demar-
1999
Asiatic Herpetological Research
Vol. 8, p. 39
Table 1 . Material used in this study.
cation between the two areas is inconspicuous. In the
spinous area, there are about twenty-eight to thirty
spines, they become larger away from the sulcus. Sul-
cus prominent, it is forked at the second subcaudal
and ends at the tips of the organ. The lips of the sulcus
are spinous in the spinous area and calyculate in the
calyculate area. The M. retractor penis magnus origi-
nates at the level of the twenty-firth to twenty-fourth
subcaudal, and is forked for the length of two to four
subcaudals before its insertion the organ dorsal.
In this paper, three specimens from Liaoning,
which are dominated brevicaudus by Gloyd (1972),
were also examined, they are different from the form-
ers slightly. The calyce is restrict to the tips of the lob,
its extent is about fourth of the spinous one. The M.
retractor penis magnus, which is about ten to fourteen
in length, is shorter than the former one. it is forked
for the length of two subcaudals. The hemipenes of
two specimens examined extend to the seventh or
eighth subcaudal, and are forked at the level of the
fourth subcaudal, but the other one is much longer, it
extends to the twelfth subcaudal and is forked at the
level of the seventh subcaudal. Our observation is
consistent with Gloyd et al. (1990) and Malnate
(1990).
G. intermedius (Strauch). The hemipenis (Fig. 3) is
seven to eleven subcaudals in length, forked for the
length of four to five subcaudals. It is spinous proxi-
mally half, and the distally half of the organ is calycu-
late. The line of changing from spines to calyces is
inconspicuous. The calyces small adjacent to the sul-
cus but larger away from it, their lips bearing tiny
spines. About sixty spines are present in the spinous
area, they reduce in size distally and near the sulcus.
One or two strongly enlarged spines adjacent to the
sulcus at the crotch level. Small spines are found in
the base of the organ. The sulcus is forked at the level
of the second to the fourth subcaudal, it continues to
the tips of the lobes. The sulcus prominent, its lips are
spinous or calyculate in the respective area of orna-
gantation. M. retractor penis magnus originates at the
level of the twenty-seventh to twenty-ninth subcaudal,
it is forked for the length of two to four subcaudals
before its insertion at the organ tips.
G. saxatilis (Emelianov). The hemipenis (Fig. 4) of
this species extends to the ninth to the eleventh sub-
caudal plate, forked at the level of the third or forth
subcaudal. It is spinous proximally and calyculate dis-
tally. The spinous and calyculate areas are about equal
in length, the demarcation between two areas is incon-
spicuous. There are about sixty to seventy spines near
the crotch, including six much larger spines, four of
them appearing on the surface near the crotch, while
the other two are on the opposite side. The spines
reduce in size distally on the organ lobes. The margins
of the calyces are spinous. The base of the organ is
covered with tiny spines. While Gloyd et al. (1990)
previously described the specimens collected from
Korea (near Seoul), the organ base nude, the lips of
the distal cups are smooth. The sulcus is bifurcated at
the level of the second subcaudal and extends to the
tips of the organ, their lips are prominent, bearing a
few spines in the spinous area and calyces in the caly-
culate area. The M. retractor penis magnus originates
at the level of the twenty-fourth to twenty-fifth sub-
caudal, and is forked for the length of two to three
subcaudals before its insertion at the organ tips.
G. shedaoensis (Zhao). In this species, the hemipenis
(Fig. 5) is eight to ten subcaudals in length, and
forked for five to six subcaudals. The base of the
Vol. 8, p. 40
Asiatic Herpetological Research
1999
ttgl
Figure 1 . The right everted hemipenis of G. ussuriensis
(CIB785185, Panshi, Jilin)
Figure 2. The right everted hemipenis of G. brevicaudus
(CIB 726108, Taiping, Anhui)
Figure 3. The right everted hemipenis of G. interme-
dius (CIB 8010015, Xingyuan, Xinjiang)
Figure 4. The right everted hemipenis of G. saxatilis
(CIB 79I0090, R. Zhuang, Liaoning)
organ is covered with tiny spines. Spinouse proxi-
mally, calyculate distally. The margins of calyces are
tiny spines. The extent of calyces is about half of
spines. Line of changing from spine to calyces is
inconspicuous. There are ninety to one hundred spines
in the spinous area, and six especially larger spines in
each lobe. The sulcus prominent, forked at the level of
the third subcaudal, and extends to the tips of the
organ rami. Sulcus lips are spinous or calyculate in
the respective areas of ornamentation. The M. retrac-
tor penis magnus originates at the level of the twenty-
fourth to twenty-seventh subcaudal and is bifid for the
length of two to three subcaudals before its insertion
at the organ tips.
G. strauchii (Bedriaga). The hemipenis (Fig. 6)
examined extends to the seventh to eleventh subcau-
dal and is forked for four to five subcaudals. It is
spinous proximally half, and the distally half is caly-
culate. The line of changing from spines to calyces is
inconspicuous. The calyces are small adjacent to the
sulcus but larger away from it, their lips bearing tiny
spines. About sixty spines are present in the spinous
area, they reduced in size distally and near the sulcus.
One or two strongly enlarged spines are adjacent to
the sulcus at the crotch level. Small spines are present
in the base of the organ. The sulcus forks at the level
of the second to fifth subcaudal, and continues to the
tips of the lobes. The lips of the sulcus prominent,
they are spinous or calyculate in the respective areas
of ornamentation. M. retractor penis magnus origi-
1999
Asiatic Herpetological Research
Vol. 8, p. 41
nates al the level of the twenty-seventh to twenty-
Figure 5. The right everted hemipenis of G. shedaoensis
(CIB 79110006, Shedao, Liaonong)
Figure 6. The right everted hemipenis of G. strauchii
(CIB 755127, Hongyuan, Sichuan)
ninth subcaudal, and is forked for the length of two to
Figure 7. The right everted hemipenis of G qinlingensis
(840050, Qinling, Shaanxi)
four subcaudals before its insertion at the organ tips.
G. qinlingensis (Song). The hemipenis (Fig. 7)
extends to the eleventh subcaudal plate in length and
is forked at the level of the fifth subcaudal. Minute
spines are present in the base of the organ. It is
spinous proximally, calyculate distally, the spinous
area is about twice to third times as the calyculate
one. The line of demarcation between two areas is
inconspicuous. The calyculate edges are spinous,
there are approximately thirty to forty spines in the
spinous region. The sulcus bifurcates the fourth to
fifth subcaudal, terminates at the tips of the organ.
Sulcus is distinct, bearing spines in spinous area and
Figure 8. The right everted hemipenis of D. acutus (CIB
6416190, Fujian)
calyces in the calyculate one. The length of M. rec-
tractor penis niagnus extending is 14 subcaudals and
it is forked for the length of two subcaudals before its
insertion at the organ tips.
Deinagkistrodon acutus (Gunther). The hemipenis
(Fig. 8) extends to the eleventh to thirteenth subcaudal
and is forked opposite the fourth subcaudal, base of
organ nude. The proximally half of the organ is spi-
nouse, the distally half calyculate, the demarcation
between these two areas is distinct. The calyces with
smooth margins reduce in size distally and near the
sulcus. The spines are about sixth to seventy, they are
larger on the lateral surface of each lobe than those
Vol. 8, p. 42
Asiatic Herpetological Research
1999
near the sulcus. The sulcus forks at the level of the
fourth subcaudal, it extends to the tips of the each
lobe. The lips of sulcus prominent, they bearing caly-
ces in the calyculate region and smooth in the spinous
area. M. retractor penis magnus originates at the level
of the twenty-sixth subcaudal and is bifid for the
length of two to four subcaudals before its insertion at
the tips of the organ.
Discussion
The hemipenes are deeply forked in eight Chinese
species of pitvipers, the shape of the everted hemipe-
nes are "Y". It is spinous proximal ly and calyculate
distally. The centripetal sulcus is consistently bifur-
cated on the basal part of the organ in all of the spe-
cies examined, and it extends to the tips of the lobes.
These similarities reveal the taxonomic relationships
between genus Gloydius and Deinagkistrodon. The
deeply forking of the hemipenis and the bifurcation of
the sulcus in the basal region of the organ are exactly
like those of the other pitvipers (Pope, 1935; Smith,
1943).
D. acutus can be characterized by presence of the
fowling hemipenial structures: (1) the margins of the
calyces are smooth: (2) transition from spines to caly-
ces is abrupt and conspicuous: (3) the sulcus lips are
smooth in the spinous area: (4) the base of the organ is
naked. These conditions further confirmed the validity
of the independent generic status of Deinagkistrodon.
The seven species of Gloydius exhibit rather con-
servative and stable hemipenial structures, the inter-
specific variation is only limited to: ( 1 ) the length of
the hemipenes and the depth of their forking: (2) the
extent of the calyculate area on the lobes; (3) the
length of the retractor muscle and the depth of their
forking; (4) the manner of insertion of the retractor
muscle onto the organ; (5) the number of enlarge
spines. The results above indicated that the differenti-
ation of the hemipenial structures in Gloydius is little.
Acknowledgments
This project was supported by the Special Fund for
Classification & Fauna, the Chinese Academy of Sci-
ences (950633), and by Chengdu Diao Science Fund,
the Chinese Academy of Sciences.
The authors express their grateful appreciation to
Prof. E. M. Zhao, Chengdu Institute of Biology, the
Chinese Academy of Sciences, for providing literature
and reviewing the manuscript. We also thank the fol-
lowing people for presenting with studying speci-
mens: Prof. M. H. Huang. Zhejiang Medical
University: Prof. M. T Song, Shaanxi Institute of
Zoology; Prof. Y. H. Zhou, Xinjiang Normal Univer-
sity; Prof. K. C. Huang, Dalian Museum of Natural
History.
Literature Cited
Branch, W. R. 1986. Hemipenial morphology of Afri-
can snakes: a taxonomic review, part I: Scolecophidia
and Boidae. Journal of Herpetology 20(3): 285-299.
Dowling, H. G. and J. M. Savage. 1960. A guide to the
snake hemipenis: a survey of basic structure and sys-
tematic characters. Zoologica 45: 2, 17-28.
Gloyd, H. K. and R. Conant. 1990. Snakes of Agkistr-
odon Complex: A Monographic Review. Oxford
(Ohio), USA. 614pp.
Malnate, E. V. 1990. A review and comparison of
hemipenial structure in the genus Agkistrodon (sensu
lato). pp. 583-588. //;: H. K. Gloyd and R. Conant
(eds.), Snakes of Agkistrodon Complex: A Mono-
graphic Review. Oxford (Ohio), USA.
Mao, S. H., FY. Yin, and Y W. Guo. 1984. The hemi-
penes of common Taiwanese venomous snakes. Her-
petologica 40(4): 406-410.
Pope, C. H. 1935. The Reptiles of China, Natural His-
tory of Central Asia, X. American Museum Natural
History, New York. 604pp.
Smith, M. A. 1943. The fauna of British India, Ceylon
and Burma, including the whole of the Indo-Chinese
sub-region. Reptilia and Amphibia, vol. III-Serpentes.
Taylor and Francis, London. 583pp.
Zhang, F J.. S. Q. Hu. and E. M. Zhao. 1984. [Com-
parative studies and phylogenetic discussions on
hemipenial morphology of the Chinese Colubrinae
(Colubridae)]. Acta Herpetologica Sinica, new series
3(3): 23-44. (in Chinese).
Zhang, F J. 1986. [Comparative studies on hemipe-
nial morphology of the Chinese Opisthoglyph genera
(Reptilia: Colubridae)]. Acta Herpetologica Sinica,
new series 5(4): 166-170. (in Chinese).
Zhao, E. M. and K Adler. 1993. Herpetology of
China. Oxford (Ohio), USA. 522pp.
1999 Asiatic Herpetological Research Vol. 8, pp. 43^47
Catalogue of Type Specimens of Reptiles in the Herpetological Collections of
Chengdu Institute of Biology, the Chinese Academy of Sciences
Peng Guo1, Fu-ji Zhang, and Yue-ying Chen
Chengdu Institute of Biology, The Chinese Academy of Sciences, Chengdu, Sichuan 610041, China
Abstract.- There are nearly 15,000 specimens and 300 species of Chinese reptiles that are preserved in the
herpetological collections of Chengdu Institute of Biology (CIB), the Chinese Academy of Sciences, these
species are over 70% of the known species in China. Most of these specimens were collected by the scientific
research personnel in the herpetology department of CIB in sixty years. In these specimens there are about 400
type series specimens (28 species or subspecies) which were selected by the scientific research personnel in the
herpetology department of CIB when they described the new taxon. In order to reflect the achievements in
scientific research on Chinese reptiles in CIB and provide the facility to scientific research and academic
exchange, it is helpful to list all of the type specimens in the collections.
Key words.- Reptiles, type specimens, Chengdu Institute of Biology, China.
'Sichuan Yibin Teachers Colleae. Yibin, Sichuan 644(X)7, China.
LACERTILIA
AGAMIDAE:
Calotes medogensis Zhao and Li, 1984
Acta Herpetol. Sin., Chengdu, [new ser.], 3(4): 77.
Holotype: CIB 8370177, Male;Yarang, Medog Co., Xizang Autonomous Region; 910 m; Coll. S. Q. Li, 7.
23, 1983.
Japalura szechwanensis Hu and Zhao, 1966
Acta Zootaxon. Sin., Peking, 3(2): 158.
Holotype: CIB 613047, Male: Baishui He, Peng Co., Sichuan Prov.; 2000 m; Coll. C. C. Liu; 5. 9, 1961.
Allotype: CIB 6130460, Female; the same locality and time as holotype.
Paratype: CIB 625131, Male; Mt. Erlang, Tianquan Co., Sichuan Prov.; 1400 m; 8, 1962.
Laudakia papenfussi Zhao, 1998
Zoological Research, Kunming, 19(5): 401.
Holotype: CIB 775001, Male: Mayang River Valley between Mayang Village and Diya Village, Zanda Co.,
Xizang Autonomous Region; 3300 m; Coll. R. Z. Zhang; 7. 1, 1976.
Laudakia wui Zhao, 1998
Acta Zootaxon. Sin., Beijing, 23(4): 440.
Holotype: CIB 7315012, Male; Yi'ong, Bomi Co., Xizang Autonomous Region: 2350 m: Coll. Y. M. Jiang;
6. 11, 1973.
Allotype: CIB 7315014, Female; the same locality and date as the holotype.
Paratypes: CIB Nos. 731501 1, 7315013, Females. CIB Nos. 7315008-10, Juveniles; the same locality and
date as the holotype; CIB Nos. 73115037-38, Juveniles; between Tangmai and Yi'ong, Bomi Co.,
Vol. 8, p. 44 Asiatic Herpetological Research 1999
Xizang Autonomous Region; 2150 m; Coll. X. E. Wu; 7. 5, 1973.
Phrynocephalus vlangalii hongyuanensis Zhao, Jiang, and Huang , 1980
Acta Zool. Sinica, Beijing, 26(2): 178.
Holotype: CDS 785795, Male: Coll. E. M. Zhao: 7. 25, 1978.
Allotype: CIB 785825, Female; Coll. Y. M. Jiang; 8. 2, 1978.
Paratypes: CIB Nos. 7551 1 1-12, 7551 14-15, 785793-94, 785796-824, 785826-27. 7 Males and 27 Females;
Coll. Y. Gao; 8, 1978.
Hongyuan Co., Sichuan Prov.: 3500 m.
=Phrynocephalus hongyuanensis Zhao, Jiang, and Huang , 1980
Ref: Y Z. Wang and Y M. Jiang, (1992), in: Y. M. Jiang (ed.). Coll. Papers Herpetol., Chengdu: 111.
Phrynocephalus zetangensis Wang, Zeng, and Wu, 1996
Zoological Research, Kunming, 17(1): 27.
Holotype: CIB 0156, Male.
Allotype: CIB 0157, Female.
Paratypes: CIB 0151, Male: CIB Nos. 0154, 0158, Female; CIB 0155, Juvenile.
Zetang, Xizang Autonomous Region; 3950 m; Coll. Z. L. Fang and Z. J. Liu: 7. 5, 1993.
GEKKONIDAE:
Tenuidactylus medogensis Zhao and Li, 1987
Acta Herpetol. Sin., Chengdu, [new ser.], 6(1 ): 48.
Holotype: CIB 8380188, Female.
Paratype: CIB 8380187, Juvenile ( Male ?).
Kabu, Medog Co., Xizang Autonomous Region; 1250 m; Coll. S. Q. Li; 1983.
=Cyrtodactylus medogensis (Zhao and Li, 1987)
Ref: Zhao, E. M. and K. Adler, (1993), Herpetology of China, Oxford (Ohio), p: 179.
SCINCIDAE:
Eumeces liui Hikida and Zhao, 1989
Copeia, Gainesville, ( 1 ): 111.
Allotype: CIB 645026. Male; Wuchang, Hubei Prov.: 3. 31, 1965.
Scincella huanrenensis Zhao and Huang, 1982
Acta Herpetol. Sin., Chengdu, [new ser.], 1(1 ): 3.
Paratypes: CIB Nos. R810012, R810014, R810015-18, R810040-41; Huanren Co., Liaoning Prov.; 700 m;
Coll. K. C. Huang; 5. 8, 1981.
Leiolopisma tsinlingensis Hu and Zhao, 1966
Acta Zool. Sin., Peking, 1 8( 1 ): 82.
Holotype: CIB 627050, Male; 1800 m; Coll. G. F Wu and E. M. Zhao; 6. 13, 1962.
Allotype: CIB 627039, Female: 1820 m: 6. 10, 1962.
Paratypes: Cib Nos. 627025-27, 627029, 627051-53, Males, CIB Nos. 627020-24, 627034-36, 627040-
627049, 627069, Females, OB Nos. 627028, 627030-32, 627054-62, 627070, Juveniles.
Mt. Tsinling [= Qinling], Chouchih [= Zhouzhi Co.], Shaanxi Prov..
=Scincella tsinlingensis (Hu and Zhao, 1966)
Ref: Y Z. Wang and E. M. Zhao, (1986), Acta Herpetol. Sin., Chengdu, [new ser.], 5(4): 276.
1999 Asiatic Herpetological Research Vol. 8, p. 45
SERPENTES
XENOPELTIDAE:
Xenopeltis hainanensis Hu and Zhao, 1972
Key Chin. Snakes [= Mater. Herpetol. Res., 1 1, Chengdu: 36.
Holotype: Cib 64III6016, Male; Dali, Mt. Diaoluo, Hainan Prov.; 200 m: 5. 15, 1964.
Allotype: CIB 64III6650, Female; Yacha Matou, Baisa Co., Hainan Prov.; 217 m; 9. 4, 1964.
=Xenopeltis hainanensis hainanensis Hu and Zhao, 1972
Ref: E. M. Zhao, (1995), Sichuan Jour. Zool., Chengdu, 14(3): 107.
COLUBRIDAE:
Achalinus meiguensis Hu and Zhao, 1966
Acta Zootaxon. Sin., Peking, 3(2): 162.
Holotype: CIB 639101, Female; Liang He Kou, Meigu Co., Sichuan Prov.; 2520 m; Coll. X. Y Tang; 5. 22,
1963.
Paratypes: CIB Kang076, Female: Tu Ba Kou, Baoxing Co., Sichuan Prov.; CIB Nos. 561836-37, 570080,
Female, CIB Nos. 562154, 562174, 600030, Male; Mt. Omei, Sichuan Prov..
Natrix optata Hu and Zhao, 1966
Acta Zootaxon. Sin., Peking, 3(2): 160.
Holotype: CIB Chuan3624, Male: Liangfeng Gang, Mt. Omei, Sichuan Prov.: 700 m; Coll. C. C Liu; 8. 9,
1940.
Paratypes: CIB Nos. 561760, 562168, 562221, 570072, 600039, 645201, Males, Cib Nos. R001, 561764,
562167, 562231, Females, 2 Juveniles; Mt. Omei, Sichuan Prov.; 1956-1960.
=Amphiesma optata (Hu and Zhao, 1966)
Ref: E. M. Zhao and Y M. Jiang, ( 1986), Acta Herpetol. Sin., Chengdu, [new ser.], 5(3): 239.
Dinodon rosozonatum Hu and Zhao,1972
Key Chin. Snakes [= Mater. Herpetol. Res., 1 ], Chengdu: 36.
Holotype: CIB 64III6089, Male; Dali, Mt. Diaoluo, Hainan Prov.; 200 m; 5. 21, 1964.
Allotype: CIB 64III5246, Female; Mt. Wuzhi, Hainan Prov.; 540 m: 5. 1 1, 1964.
Paratypes: 3 Males and 5 Females; Mt. Diaoluo, Mt. Wuzhi and Haikou, Hainan Prov.; 80-580 m; 1964-
1972.
Macropisthodon rudis multiprefrontalis Zhao and Jiang , 1981
Acta Herpetol. Sin., Chengdu, [old ser.], 5(7): 55.
Holotype: Cib 6515143, Male; Xichang, Sichuan Prov.; 2650 m; Coll. C. C. Liu; 6. 8, 1965.
Allotype: CIB 6515142, Female; Xichang, Sichuan Prov.: Xichang, Sichuan Prov.; 2650 m: Coll. G. F. Wu:
6. 8, 1965.
Paratypes: CIB Nos. 6515001, 65II5148, Males, CIB Nos. 6515034, 65U5012, Females, CIB 580960, Juve-
nile; Huili Co., Zhaojue Co., Yuexi Co., and Ganluo Co., Sichuan Prov.; 2000-2630 m; Coll. D. Y
Yang; 8, 1958 and 5-6, 1965.
Oligodon mulizonatum Zhao and Jiang, 1981
Acta Herpetol. Sin., Chengdu, [old ser.], 5(7): 54.
Holotype: CIB 80II0289, Male.
Allotype: CIB 80II0290, Male, CIB Nos. 80II0274, 80II0291, Juveniles.
Luding Co., Sichuan Prov.; 1400 m; 8. 17, 1980.
Opisthotropis guangxiensis Zhao, Jiang, and Huang, 1978
Vol. 8, p. 46 Asiatic Herpetological Research 1999
Mater. Herpetol. Res., Chengdu, 4: 21.
Holotype: CIB 602488, Male; Mt. Yao [ = Dayao Shan ], Guangxi Prov.; 6. 19, 1960.
Allotype: CIB 601588, Female; Mt. Yao [ = Dayao Shan ]. Guangxi Prov.; 4. 28, 1960.
Paratype: CIB 603583, Female; Longsheng Co., Guangxi Prov.; 7. 2, 1960.
Plagiopholis unipostocularis Zhao, Jiang, and Huang, 1978
Mater. Herpetol. Res. Chengdu, 4: 21.
Holotype: CIB 505121, Female; Yunnan Prov..
Rhabdophis adleri Zhao, 1997
Asiat. Herpetol. Res., Berkeley, 7: 166
Holotype: CIB 64III5917, Male; Dali Village in Mt. Diaoluo. Lingshui Co., Hainan Prov.; 225 m: 6. 10.
1964.
Allotype: CIB 64HI5228, Female; Mt. Wuzhi, Qiongzhong Co.. Hainan Prov.; 500 m: 5. 10, 1964.
Paratypes: CIB Nos. 64IU51 12, 51 14-15, Females; 4. 24-25, 1964; CIB 64III5883, male, CIB 64III5441,
Juvenile, 6. 1-9, 1964; Mt. Diaoluo, Lingshui Co., Hainan Prov.; 82-217 m; CIB 64III6612, Juvenile;
Mt. Yinggeling, Baisha Co., Hainan Prov.; 670 m; 8. 25, 1964.
Rhabdophis nuchalis pentasupralabralis Jiang and Zhao, 1983
Acta Herpetol. Sin., Chengdu, [new ser.], 2(1 ): 60.
Holotype: CIB 80110040, Male; 2750 m; Coll. E. M. Zhao; 7. 26, 1980.
Allotype: CIB 80II0056, Female: 2750 m; Coll. Y M. Jiang; 7. 26, 1980.
Paratypes: 95 Males, 48 Females, and 65 Juveniles; 2750-2850 m; 7. 24-28, 1980.
Jiulong Co.. Sichuan Prov..
=Rhabdophis pentasupralabralis Jiang and Zhao, 1983
Ref: E. M Zhao, (1995), Jour. Suzhou Rail. Teach. Coll. (Nat. Sci.), Suzhou (Jiangsu), 12(2): 38.
Sibynophis chinensis miyiensis Zhao and Kou, 1987
Chin. Herpetol. Res., Chengdu, No. 1: 4.
Holotype: CIB 105027, Male; Miyi Co., Sichuan Prov.: 880 m: Coll. S. H. Kang: 6, 1986.
Allotype: CIB 105025, Female; Miyi Co., Sichuan Prov.; 880 m; Coll. S. H. Kang; 6, 1986.
Paratypes: CIB Nos. 105026, 105028, 105030-31, Males; CIB 105029. Female; Lugu Lake, Sichuan- Yun-
nan border; 2600 m; Coll. Z. T. Kou; 1985.
VIPERIDAE:
Trimeresurus mangshanensis Zhao, 1990
Sichuan Jour. Zool., Chengdu, 9( 1 ): 11.
Holotype: CIB ZS8901, Female.
Paratype: CIB ZS8902, Female.
Pingkeng, Mt. Mang, Yizhang Co., Hunan Prov.; 700-900 m; Coll. G. H. Chen and Y L Tao; 9, 1989.
=Ermia mangshanensis (Zhao, 1990)
Ref: Zhang, F. J., ( 1993), in: Zhao. E. M. et al. (eds.), Proceedings of the First Asian Herpetological Meet-
ing, Beijing, p: 56.
Agkistrodon shedaoensis Zhao, 1979
Acta Herpetol. Sin., Chengdu, [old ser.], 1( 1 ): 4.
Holotype: CIB 7910005, Male; Shedao, Liaoning Prov.; 5. 19, 1979.
=Gloydius shedaoensis (Zhao, 1979)
Ref: A. R. Hoge et al. , ( 1978/79), Poisonous Snakes of the World. Part I. Check list of the Pit Vipers Viper-
oidae, Viperidae, Crotalinae. Mem. Inst. Butantan, Sao Paulo, 42/43. p: 194.
Trimeresurus monticola zayuensis Jiang, 1977
1999 Asiatic Herpetological Research Vol. 8, p. 47
Acta Zool. Sin., Beijing, 23( 1 ): 67.
Holotype: CIB 7315024, Male; 1800 m; 7. 22, 1973.
Allotype: CIB 7315025, Female: 2070 m: 7. 30. 1973.
Paratype: CIB 73II5349, Male; 1965.
Zayu Co., Xizang Autonomous Region.
=Ovophis zayuensis (Jiang, 1977)
Ref: E. M. Zhao. (1995). Jour. Suzhou Rai. Teach. Coll. (Nat. Sci.), Suzhou (Jiangsu), 12(2): 37.
Ovophis monticola zhaokentangi Zhao, 1995
Sichuan Jour. Zool., Chengdu. 14(3): 109.
Paratype: CIB 740003, Male; Pianma, Lushui Co., Yunan Prov.; 1980 m; 3. 17, 1974.
Tritneresurus medoensis Zhao, 1977
Acta Zool. Sin., Peking, 23( 1 ): 66.
Holotype: CIB 73II5208, Male; 1200 m; Coll. E. M. Zhao and Y. Gao.
Allotype: CIB 73II5209, Male; 1400 m; Coll. E. M. Zhao and X. E. Wu.
Near A-nie Bridge, Medog Co., Xizang Autonomous Region; 8. 3, 1973.
Tritneresurus stejnegeri ehenbihuii Zhao, 1995
Sichuan Jour. Zool., Chengdu, 14(3): 1 10.
Holotype: CIB 64III5599. Male: Mt. Diaoluo, Lingshui Co., Hainan Prov.; 250 m: 6. 6, 1966.
Allotype: CIB 64III5945, Female; Mt. Diaoluo, Lingshui Co., Hainan Prov.; 250 m: 6. 11, 1966.
Paratypes: CIB Nos. 64ID.5906, 64III5944, 641115978-79, 64IB6013, 641116043-44, 64III6069, 64III6101,
64III6104, 64III6107, Males; 64III5600, 64III5735, 64HI6014, Females; Mt. Diaoluo, Lingshui Co..
Hainan Prov.; 225-290 m; 6. 6-15, 1964. CIB Nos. 64IH5110, 64III5181, 641115261-62, Males; Mt.
Wuzhi, Qiongzhong Co. Hainan Prov.; 500 m: 4. 23-5. 12, 1964.
Tritneresurus xiangchengensis Zhao, Jiang, and Huang, 1978
Mater. Herpetol. Res., Chengdu, 4: 21.
Holotype: CIB 725050, Male; 3100 m; 10. 7, 1972.
Allotype: CIB 725049, Female; 3200 m.; 10.10, 1972.
Paratypes: CIB 725048, Male; CIB Nos. 725051-57, 5 Females and 2 Juveniles; Xiangcheng Co., Sichuan
Prov.: 3000-3200 m; 10. 1-28, 1972.
Acknowledgments
We wish to express our deep gratitude to Prof. Er-Mi Zhao for reviewing the manuscript and offering suggestion.
This project is supported by the Special Fund for Biology Collections, the Chinese Academy of Sciences, and by
Chengdu Diao Sciences Fund, the Chinese Academy of Sciences.
1999
Asiatic Herpetological Research
Vol. 8. pp. 48-52
Correlations of Reproductive Parameters of Two Tropical Frogs from Malaysia
Ibrahim H. Jaafar1, Ahmad Ismail2, and Abd-rahman Kurais2
Biological Sciences Program, School Of Distance Education, Universiti Sains Malaysia, 11800, Minden,
Penang, Malaysia. "Department of Biology, Faculty of Science and Environmental Studies, Universiti Putra
Malaysia, 43360. UPM, Selangor, Malaysia.
Abstract.- A study on the relationships of reproductive parameters such as fecundity, egg size, clutch weight and
body size of two frogs, Rana cancrivora (Gravenhorst) and R. limnocharis (Boie), from Malaysia was carried
out in February 1992. The results showed that all the parameters quantified were greater in R. cancrivora than in
R. limnocharis. No correlation was found between the spawned clutch size and egg size for both species.
However, correlation analyses of unspawned clutch showed that there exist positive relationships between female
size and clutch size, female size and clutch weight, female size and egg weight, clutch size and clutch weight,
and clutch weight and egg weight in R. cancrivora. For R. limnocharis positive correlations were found between
clutch size and clutch weight, and clutch weight and egg weight for the unspawned complement. The advantages,
non-advantages, correlation and non-correlations of these parameters with respect to their reproductive strategies
and success of these frogs are discussed and compared with the current information from the literature.
Key words.- Aiiura, Ranidae, Rana cancrivora, R. limnocharis, Malaysia, reproductive parameters, female size,
clutch size, egg size, clutch weight, egg weight.
Introduction
The fecundity or clutch size in amphibians is highly
variable depending on body size and reproductive
mode (Salthe, 1969: Salthe and Duellman, 1973:
Kaplan, 1980). As a general rule, large species pro-
duce more eggs than smaller ones and species that
have generalized reproductive modes have larger
clutches than those with specialised modes (Duellman
and Trueb, 1986). The fecundity and hatching success
of an amphibian population play an important role in
the propagation and future survival of the population
(Ibrahim and Ahmad, 1992). Reproductive success of
a female depends upon the number of eggs produced
and their quality, but are constrained by physiological
capacities of the female and the trophic quality of the
environment (Rafinska, 1991). The number of eggs
deposited by amphibians varies greatly from species
to species and this large disparity in fecundities is
explained by differences among amphibians in sizes
of eggs, patterns of development, sizes of females and
reproductive behaviour (Porter, 1972: Salthe and
Duellman. 1973: Kuramoto, 1978; Kaplan, 1980).
Studies on the fecundity of temperate frogs have gen-
erated considerable data on this facet of amphibian
reproduction (Collins, 1975: Kuramoto, 1978; Duell-
man and Trueb, 1986), but information on tropical
oriental species are few and far between. Berry (1964)
reported that seven anuran species in Singapore
exhibited difference in fecundities between and within
species, while four species of frogs from Malaysia
also showed differences in fecundities both between
and within species (Ibrahim and Ahmad, 1992). Inger
and Bacon (1968) found that four large ranids in
Borneo have clutch sizes in excess of a thousand eggs,
while Yorke (1983) reported that the average clutch
size for a rhacophorid in Malaysia to be 225 eggs.
Ovum size is another important aspect of anuran
reproductive biology. Large ovum size is generally
associated with large female body size and thus
directly hints of better fitness and survival value. Egg
size variability in amphibians has been interpreted as
adaptive since, where breeding habitats vary unpre-
dictably, production of a wide range of sizes may
enhance adult fitness more than does the output of a
single 'optimal' egg size (Tejedo and Reques, 1992).
The egg size of numerous temperate anurans are well
documented in the literature (e.g. Salthe, 1969; Salthe
and Duellman, 1973; Bell and Lawton, 1975; Collins,
1975; Kuramoto, 1978; Jorgensen, 1981; Duellman
and Trueb, 1986; Reading, 1986; Rafinska, 1991;
Tejedo and Reques, 1992), but again however, only a
few reports concerning this parameter are available
for tropical species (e.g. Liem, 1959; Alcala, 1962;
Inger and Bacon, 1968; Uchiyama et al., 1990).
Rana cancrivora (Gravenhorst) and R. limno-
cluiris (Boie) are two species of anura that have a
wide distribution across the oriental zoogeographical
realm (Church, 1960: Alcala, 1962; Berry 1964;
Inger, 1966; Kuramoto, 1978). In spite of this only a
1999
Asiatic Herpetological Research
Vol. 8, p. 49
handful of information have been published concern-
ing the fecundity and size of their eggs (Alcala, 1962;
Berry, 1964; Kuramoto. 1978). It is also evident from
the literature that there exist considerable variations in
the relationships of body size, egg size and fecundity
within the Amphibia (Salthc, 1969; Collins, 1975;
Kuramoto, 1978; Jorgensen, 1981; Reading, 1986;
Duellman and Trueb, 1986). This paper therefore
determines the fecundity and egg size of both R. can-
crivora and R. limnocharis and then examines the
existing relationships in the reproductive parameters
of both frogs.
The Study Site
The place chosen for the study is a rice growing
region near the small town of Tanjung Karang (3°
20'N. 101° 10'E), in the state of Selangor, elevation
about 3 m above mean sea level. It is situated about
100 km to the northwest of Kuala Lumpur, the Malay-
sian capital. Previously this area was a freshwater peat
swamp forest which was opened up and converted to
paddy fields by settlers in the 1920's. Presently due to
the improved and upgraded irrigation and drainage
system, the farmers are planting two rice crops a year.
Material and Methods
To determine the fecundity and egg size of spawned
eggs, newly deposited egg clutches of both species
were collected from recently innundated rice fields.
Breeding choruses were visited, amplecant pairs of
frogs were located and their positions marked with
wooden pegs. Male frogs usually start calling as soon
as dusk sets and individuals of both species usually
initiated mating as soon as the males begin clasping
the females. This usually occurs at around OlOOhrs or
0200 hrs. The pairs will then move into the flooded
rice paddy and egg laying will occur around 0500 hrs.
The number of eggs in each clutch were then recorded
and the eggs collected and preserved in 4% formalin
and kept in labeled, airtight plastic 40 dram bottles. In
the laboratory, 30 to 50 eggs from each clutch were
then randomly chosen and their diameters measured
under a stereo microscope with an ocular micrometer
to determine the mean size of eggs of each species.
All eggs measured were between Stages 3 and 9 of
Gosner(1960).
To investigate the relationship between female
body size and, (a) the number of unspawned eggs, (b)
weight of unspawned egg clutch and (c) the weight of
unspawned eggs, the snout-urostyle length of gravid
females with large pigmented ova in the oviducts
were measured, the unspawned egg complement were
weighed (clutch weight) and counted (clutch size or
fecundity). This is a modified method of Kuramoto
( 1978). Inger and Bacon (1968) reported that in most
Indomalayan frogs the eggs in the ovary are esscn
tially in two size classes : an enlarged or developing
set and a much smaller, white "undeveloped set' ; the
latter contributes no significant portion to the total
volume of the ovary.
Results
Forty-two spawned batches of R. cancrivora eggs and
thirty-four of R. limnocharis were collected from the
field in February 1992. These were investigated for
fecundity and size of spawned eggs. In addition thirty-
two batches of R. cancrivora eggs and thirty of R. lim-
nocharis were obtained from sacrificed gravid
females.
The results showed that the average number of
eggs laid by R. cancrivora females from Tanjung
Karang is 1077.9 (sd = ± 238.97, range 662 tol677).
That for R. limnocharis 405.5 (sd = ± 92.45, range
233 to 657). Weighted t-test for unequal variance
(Cochran and Cox, 1957) showed that the number of
eggs oviposited by R. cancrivora is significantly
greater than that laid by R. limnocharis (t = 16.751, p
<0.001,df=74).
The mean diameter of R. cancrivora eggs is 1.35
mm (sd = ±0.091, range 1.16 to 1.53) while the mean
diameter of R. limnocharis eggs is 1.15 mm (sd = ±
0.027, range 1.10 to 1.21). Again a weighted t-test for
unequal variance showed that the egg size for both
species is significantly different (t = 12.980, p <
0.001, df =74). However, no correlation was found
between the spawned clutch size and egg size for both
species.
For clutch complement of unspawned R. cancriv-
ora eggs, the average clutch size was 2904.6 (sd = ±
1600.6, range 889 - 7573), the average clutch weight
was 2.25 g (sd = ± 1.726, range 0.37 - 5.71) and the
average egg weight was 0.75 mg ( sd = ± 0.257, range
0.28 - 1.35). The same parameters for R. limnocharis
was 702.6 (sd = ± 306.49, range 312 - 1659), 0.40 g
(sd = ± 0.264, range 0.074 - 1.04) and 0.55 mg ( sd =
± 0.249, range 0.237 - 1.01) respectively. Weighted t-
tests for unequal variance on the clutch size, clutch
weight and egg weight between the two species
showed that these parameters were significantly dif-
ferent ( t = 7.634, p < 0.001, df = 60; t = 6.799, p <
0.001, df =60; and t = 3.019, p < 0.05, df = 60 respec-
tively).
Correlation analyses carried out on the reproduc-
tive parameters of unspawned eggs for each species
showed that for R. cancrivora there is a positive corre-
Vol. 8, p. 50
Asiatic Herpetological Research
1999
lation between female size and clutch size (p < 0.001,
r = 0.6333), female size and clutch weight (p< 0.001, r
= 0.6867), female size and egg weight (p < 0.05, r =
0.4073), clutch size and clutch weight (p < 0.001. r =
0.8870) and clutch weight and egg weight (p < 0.001.
r = 0.5983). There was no statiscally significant corre-
lation between clutch size and egg weight. For R. lim-
nocharis however, there exists positive correlation
between clutch size and clutch weight (p < 0.001, r =
0.7501 ) and clutch weight and egg weight (p < 0.001,
r = 0.6818) only, while no correlation was found
between female size and clutch size, female size and
clutch weight, female saize and egg weight, and
clutch size and egg weight.
Discussion
The number of eggs oviposited by breeding females
of both species were lower than that found in their
ovaries. This is not unexpected because presumably
the breeding females were depositing the complement
of eggs that were mature and retaining the unripe ones
for later oviposition ( Inger and Bacon, 1968; Telford
and Dyson, 1990). It is likely that both females of/?.
cancrivora and R. limnocharis in Tanjung Karang
may breed more than once during the breeding sea-
son. Wells (1976) concluded that one of the major
advantages of a prolonged breeding period may be the
capacity for females to breed twice or more in a single
season. Hence it is possible that as a security measure
the females only release a portion of eggs from their
ovarian complement. The incidence of multiple
clutches is not uncommon in amphibians and have
been reported in anumber of anuran species (Collins,
1975; Howard, 1978; Perril and Danial, 1983; Telford
and Dyson, 1990; Rafinska, 1991).
Alcala (1962) and Uchiyama (1990) reported that
the clutch size for R. cancrivora was probably more
than 2000 and 1800 eggs respectively. Our study
found a lower clutch size than these two. Berry (1964)
presented data on the number of ovarian eggs in Sin-
gaporean R. limnocharis. Calculations based on her
data gave the average clutch size for her samples as
576.4 eggs (range 266-1318). This is comparable to
the results of this study. However, Kuramoto (1978)
reported larger clutch size, clutch weight and egg
weight for R. limnocfiaris from Japan. This discrep-
ancy could be due to the clinal effect within the spe-
cies (Duellman and Trueb, 1986) or even
geographical differences, since the Japanese frog
would be at the northernmost edge of its distribution.
The difference in egg size between different dif-
ferent populations of amphibian species have been
attributed to adaptation of the population to their par-
ticular environment (Pettus and Angleton, 1967;
Salthe and Duellman. 1973; Jorgensen, 1981). There
exists a positive correlation between egg size and
hatchling size in frogs (Salthe and Duellman, 1973)
and a large metamorphic size is important because of
the interrelationship of body size, time of metamor-
phosis, age at first reproduction and fecundity ( Wil-
bur, 1972; Wilbur and Collins, 1973; Doty, 1978).
Thus the observed larger egg size of R. cancrivora
over R. limnocharis could probabaly be assumed to
confer reproductive advantage with respect to fecun-
dity, and could probably also be assumed to do the
same with respect to metamorphic size, post meta-
morphic growth and age at first reproduction.
The interspecific differences in the sizes of eggs in
amphibians is well documented in the literature (Inger
and Bacon, 1968; Collins, 1975; Kuramoto, 1978;
Duellman and Trueb, 1986). For example. Collins
(1975) found that there is significant difference in
average egg diameter between Hyla versicolor, R. syl-
vatica, Bufo americanus and R. catesbeiana, while for
H. crucifer and Psuedoacris triseriata there was no
significant difference. Generally this reflects the great
variety in amphibian species with respect to egg pro-
duction, reproductive modes and other demographic
parameters (Salthe and Duellman, 1973; Kuramoto,
1978; Kaplan, 1980; Duellman and Trueb, 1986) as
well as the diversity of adaptations to the different
array of environmental selection and pressure. Pheno-
typic plasticity related to female age, size, trophic
conditions and genetic factors also contribute to the
observed egg size variation in amphibians (Berven,
1982; Rafinska, 1991). Hence it is not surprising that
there exists significant difference in egg size between
R. cancrivora and R. limnocharis in this study since ,
as mentioned earlier, a number of workers have con-
cluded that within a reproductive mode, the greater
the female size, the larger will be the ovum size
(Salthe and Duellman, 1973; Kuramoto, 1978;
Kaplan, 1980).
For R. cancrivora in this study, there exist positive
correlations between female size and clutch size,
female size and clutch weight, clutch size and clutch
weight, and clutch weight and egg weight. Since body
size is an indication of body condition, the high corre-
lation between body size and clutch size is expected
(Reading, 1986). Other workers also found that there
is a positive relationship between clutch size and
female body size (Pettus and Angleton, 1967; Salthe
and Duellman, 1973; Collins, 1975; Howard, 1978;
Kuramoto, 1978; Banks and Beebee, 1986; Gibbons
and McCarthy, 1986; Reading, 1986). The positive
relationship between clutch size and clutch weight.
1999
Asiatic Herpetological Research
Vol. 8, p. 51
and clutch weight and egg weight in R. cancrivora is
also anticipated because generally speaking, the
greater the egg number, the greater will be the clutch
weight, and the greater the egg weight, the higher the
clutch weight. Kuramoto (1978) also found the same
phenomenon in some of his Japanese anurans and
similarly Reading ( 19861 found that there was a trend
as a whole in the population of British B. bufo for egg
weight, egg number and ovary weight to increase with
female size.
Collins (1975) reported that there was positive
correlation between egg diameter and female body
size in R. sylvatica, H. versicolor and B. americanus
from Michigan. Banks and Beebee (1986) found that
snout-vent lenght is correlated with egg size in B.
calamita from England and suggested that this was, in
part, an adaptation to survive in habitats with erratic
pond provisions. However, in this study no correlation
could be found between female body lenght and egg
size (as quantified by egg weight) in both R. cancriv-
ora and R. limnocharis, nor could Kuramoto (1978)
find a relationship between female body weight and
egg weight in R. limnocharis, R. tagoi, R. hrevipoda,
H.japonica and Rhacophorus schlegelii. He attributed
this event to the fact that all these species are lentic
water-breeding frogs that generally produced their
egg output, not in smaller number of large eggs but in
larger number of small eggs. Thus no obvious advan-
tage is procured in producing large eggs by large
females. Also Jorgensen ( 1981 ) reported that egg size
is not directly related to body size in R. temporaria in
Denmark, while Howard (1978) wrote that the aver-
age egg size for R. catesbeiana from Michigan is not
correlated to female size. Rafinska (1991) found no
correlation between egg size and snout-vent lenght in
European Bombina bombina, and Collins (1975) also
found no statistically significant correlation between
egg diameter and female body size in P. triseriata, H.
crucifer and R. catesbieana. Why some species exhib-
ited correlation between female size and egg size
while others do not lack complete explaination at this
point, and even Howard (1978) was convinced that the
underlying reasons for such relationships remain
unclear.
It is thus evident that variations occuring in the
relationships of reproductive parameters in various
amphibian species are results of selective forces and
environmental constraints that shape their life history
traits such that a species will optimize reproductive
energy into producing the optimum number of off-
springs to ensure future survival and continuance of
the species. And since anuran species occupy various
and diverse types of habitats and have different types
of reproductive strategies, they are thus subjected to
various differences in environmental pressures to
which they must adapt in order to survive and prosper.
This then manifests into the huge variability of
amphibian reproductive demography as what we are
witness to today.
Acknowledgments
The authors wish to express their gratitude to Univer-
siti Putra Malaysia for use of facilities, and to the
Malaysian Government for financing the project
under the Intensified Research in Priority Areas Grant.
The participation of IHJ was made possible through a
study grant from the Univcrsiti Sains Malaysia.
Literature Cited
Alcala, A.C. 1962. Breeding behaviour and early
development of frogs of Negros. Philippine Islands.
Copeia 1962: 679-726.
Banks, B. and T.J.C. Beebee. 1986. A comparison of
the fecundities of two species of toads Bufo bufo and
B. calamita from different habitat types in Britain.
Journal of Zoology, London 208: 325-337.
Bell, G. and J.H. Lawton. 1975. The ecology of the
eggs and larvae of the Smooth Newt, Triturus vulgaris
(Linn.). Journal of Animal Ecology 44: 393-424
Berry, PY. 1964. The breeding patterns of seven spe-
cies of Singapore anura. Journal of Animal Ecology
33: 227-243.
Berven, K.A. 1982. The genetic basis of altitudinal
variation in the Woodfrog Rana sylvatica II: An
experimental analysis of larval development. Oecolo-
gia (Berlin) 52: 360-369.
Church, G. 1960. The effects of seasonal and lunar
changes on the breeding patterns of the Edible Jav-
anese Frog Rana cancrivora Gravenhorst. Treubia 25:
215-233.
Cochran, W.G. and G.M. Cox. 1957. Experimental
Designs. 2nd edition. John Wiley and Sons, New
York.
Collins, J. P. 1975. A comparative study of the life his-
tory strategies in a community of frogs. Ph. D. Thesis.
University of Michigan.
Doty, T.L. 1978. A study of larval amphibian popula-
tion dynamics in a Rhode Island vernal pond. Ph. D.
Thesis. University of Rhode Island.
Duellman, W. E. and L. Trueb. 1986. Biology of
Amphibians. MacGraw-Hill Book Co.. New York.
Gibbons, M.M. and T.K. McCarthy. 1986. The repro-
ductive output of frogs Rana temporaria (L.) with
Vol. 8, p. 52
Asiatic Herpetological Research
1999
particular reference to body size and age. Journal of
Zoology, London 209: 579-593.
Gosner, K.L. 1960. A simplified table for staging anu-
ran embryo and larvae with notes on identification.
Herpetologica 16: 183-190.
Howard, K.D. 1978. The influence of male defended
oviposition sites on early embryo mortality in Bull-
frogs. Ecology 59: 189-198.
Ibrahim, H.J. and P. Ahmad. 1992. A preliminary
study of the fecundity and hatching rates of four anu-
ran species from Penang, Malaysia. Proceedings of
the 2nd Symposium of Malaysian Society of Applied
Biology. Pp. 104-107. Malaysian Society of Applied
Biology, Kuala Lumpur.
Inger, R.F. 1966. The systematics and zoogeography
of the amphibians of Borneo. Fieldiana, Zoology 52:
1-402.
Inger, R.F. and J.P Bacon, Jr. 1968. Annual reproduc-
tion and clutch size in rainforest frogs in Sarawak.
Copeia 1968: 602-606.
Jorgensen, C.B. 1981. Ovarian cycle in a temperate
zone frog, Rana temporaria, with special reference to
factors determining number and size of eggs. Journal
of Zoology. London 195: 449-458.
Kaplan, R.H. 1980. The implications of ovum size
variability for offspring fitness and clutch size within
several populations of salamanders (Ambystoma).
Evolution 34: 51-64.
Kuramoto, M. 1978. Correlations of quantitative
parameters of fecundity in amphibians. Evolution. 32:
287-296.
Liem, K.H. 1959. The breeding habits and develop-
ment of Rana chalcanota (Schlegle) (Amphibia).
Treubia 25: 89-111.
Perril, S.A. and R.E. Danial, 1983. Multiple egg
clutches in Hyla regilla, H. cinerea and H. grariosa.
Copeia 1983:921-930.
Pettus D. and G.M. Angleton. 1967. Comparative
reproductive biology of Montane and Piedmont Cho-
rus Frogs. Evolution 21: 500-507.
Porter, K. 1972. Herpetology. W.B. Saunders Co..
Philadelphia.
Reading, C.J. 1986. Egg production in the Common
Toad Bufo bufo. Journal of Zoology, London 208: 99-
107.
Rafinska, A. 1991. Reproductive biology of the fire-
bellied toads Bombina bombina and B. variegata
(Anura : Discoglossidae): egg size, clutch size and
larval period lenght differences. Biological Journal of
the Linnean Society 43: 197-210.
Salthe, S.N. 1969. Reproductive modes and the num-
ber and sizes of ova in Urodeles. American Midland
Naturalist 81: 467-489.
Salthe, S.N. and W.E. Duellman. 1973. Quantitative
constraints associated with reproductive modes in
anurans. Pp. 229-249. In J.L. Vial (ed.) Evolutionary
Biology of the Anurans : Contemporary Research on
Major Problems. University of Missouri Press,
Columbia, Missouri.
Tejedo, M. and R. Reques. 1992. Effects of egg size
and density on metamorphic traits in tadpoles of the
Natterjack Toad Bufo calamita. Journal of Herpetol-
ogy 26: 146-152.
Telford, S.R. and M.L. Dyson. 1990. The effects of
rainfall on the interclutch interval in the Painted Reed
Frog (Hyperolius marmoratus). Copeia 1990: 644-
648.
Uchiyama, M., T. Murakano and H. Yoshizawa. 1990.
Notes on the development of the Crab-eating Frog
Rana cancrivora. Zoological Science 7: 73-78.
Wells, K.D. 1976. Multiple egg clutches in the Green
Frog (Rana clamitans). Herpetologica 32: 85-87.
Wilbur, H.M. 1972. Competition, predation and the
structure of the Ambystama-Rana sylvatica commu-
nity. Ecology 53: 3-21.
Wilbur, H.M. and J.P. Collins. 1973. Ecological
aspects of amphibian metamorphosis. Science 182:
1305-1314.
Yorke, CD. 1983. Survival of the embryos and larvae
of the frog Polypedates leucomystax in Malaysia.
Journal of Herpetology 17: 235-241.
1999
Asiatic Herpetological Research
Vol. 8, pp. 53-59
Utilization of Energy and Material in Eggs and Post-hatching Yolk in an
Oviparous Snake, Elaphe taeniura
XlANG Jl', PlNG-YUE SUN1, SHUI-YU FU2, AND HUA-SONG ZHANG2
Department of Biology, Hangzhou Normal College, Hangzhou 310036, Zhejiang, China; Email (XJ):
[email protected]; ''Department of Chemistry, Hangzhou Normal College, Hangzhou 310036, Zhejiang, China
Abstract. -The duration of incubation of Elaphe taeniura eggs at 30±0.3°C averaged 54.9 days. During
incubation, pliable-shelled eggs of E. taeniura increased in wet mass. Dried shells of the freshly laid egg
averaged 17.6c/< of the entire egg dry mass. Freshly laid eggs had significantly heavier shells than did hatched
eggs with the same wet mass at oviposition. Dry mass conversion from egg contents of the freshly laid egg to
hatchling averaged 84.5%. During incubation, approximately 74.6% of non-polar lipids and 80.8% of energy in
egg contents of the freshly laid egg were transferred to the hatchling, with 25.4% of non-polar lipids and 19.2%
of energy used for embryogenesis. Shells from freshly laid eggs had higher levels of calcium and magnesium
than did shells from hatched eggs. Fully developed embryos could obtain almost all magnesium from the yolk
but withdraw approximately 35.6% of their total calcium requirements from the eggshell. A few days after
hatching, a decrease in post-hatching yolk mass was accompanied by an increase in carcass mass, indicating that
post-hatching yolk could be used to support early growth of hatchlings.
Key Hwd.s.-Reptilia: Squamata: Elaphe taeniura: Incubation; Egg; Post-hatching yolk; Hatchling
Introduction
As for reproductive investments in eggs and embry-
onic development, there are two patterns that seem to
be common in oviparous reptiles. One pattern is that
total energy and material stored in eggs generally
exceed the needs for producing a complete hatchling.
Hence, a portion of yolk, namely post-hatching yolk
or residual yolk, may remain unutilized at the time of
hatching. Post-hatching yolk represents a supply of
energy and material for early activities of hatchlings
(Kraemer and Bennett, 1981; Troyer, 1983, 1987;
Wilhoft, 1986; Congdon and Gibbons, 1989); how-
ever, the exact function of this portion of resources
allocated by the mother in eggs is not very clear.
There is a growing evidence showing that resources in
the post-hatching yolk can be transferred to the car-
cass (=total hatchling-yolk sac-fat bodies). The conse-
quence of this transference is that carcass increases in
mass during the first post-hatching days of hatchlings
(Ji et al., 1997a). The other pattern is that embryos
must mobilize minerals (e.g., calcium) from the egg-
shell to complete development (e.g.. Bustard et al.,
1969: Jenkins, 1975: Packard and Packard, 1984,
1989; Packard et al„ 1984a, b; Shadrix et al„ 1994; Ji
et al„ 1996, 1997a, b). As the consequence of this
mobilization, eggshell decreases in mass and ash con-
tents during incubation, particularly at the late stage
of incubation (Ji et al., 1996, 1997a, b; Zhao et al„
1997). In this paper, we present data on a colubrid
snake. Elaphe taeniura. We address the following top-
ics: ( 1 ) conversion of energy and material from egg to
hatchling during incubation, (2) sources of calcium
and magnesium during embryogenesis, and (3) post-
hatching yolk and its contribution to early growth of
newly emerged hatchlings.
Material and Methods
Elaphe taeniura is one of the most common snakes in
our study areas in the Zhoushan Islands (29° 32'-31°
04' N, 121° 30'-123° 25' E), Zhejiang, eastern China.
The distributional range of E. taeniura covers most
provinces of China (including Taiwan and Hainan),
India (Darjeeling and Assam), Indochina, and the
northern half of Malay Peninsula (Zhao and Adler,
1993). For this species, many aspects of biology spe-
cies have been previously examined, but little infor-
mation on incubation and reproduction is available
other than incidental notes (see Huang and Jin, 1990).
Four gravid E. taeniura [snout-vent length: 1 10.0-
155.0 cm; body mass (excluding the clutch): 233.4-
778.7 g] were obtained from a private collector in
Baiquan, Dinghai, the Zhoushan Islands, in mid-June
1994. The snakes were individually maintained in our
laboratory in 80 x 80 x 80 cm wire cages until ovipo-
sition (mean=16.3 days). We removed eggs from the
Vol. 8, p. 54
Asiatic Herpetological Research
1999
cages, measured and weighed them within 6 h of ovi-
position, and then randomly selected two eggs from
each of the first three clutches and one egg from the
last clutch to determine egg composition. Egg con-
tents (embryo plus yolk) of the dissected freshly laid
eggs were removed, placed in pre-weighed small
glass dishes, and weighed to the nearest 0.1 mg.
Shells from the freshly laid eggs were rinsed briefly,
weighed to the nearest o.l mg, and then were saved
for later analysis. All dissected freshly laid eggs con-
tained a small embryo, which was too small and frag-
ile to be sampled separately, and therefore was
included with yolk.
Eighteen eggs, 1/3-buried in moistened substra-
tum, were incubated in a constant temperature cham-
ber at 30±0.3°C. The incubation medium consisted of
sand to water in a ratio of 4: 1 , and water was added
periodically to keep the initial water content. We mea-
sured and weighed the incubating eggs at weekly
intervals before day 42. and daily intervals thereafter.
Four eggs failed to hatch following incubation.
Hatchlings were measured and weighed immediately
after they left the eggs. Shells from hatched eggs were
rinsed briefly, weighed to the nearest 0.1 mg, and then
were frozen for later analysis. Nine hatchlings (2-3
from each clutch; hereafter 0-day hatchling) were fro-
zen immediately after hatching. The remaining 5
hatchlings (1-2 from each clutch; hereafter 7-day
hatchling) were fasted at room temperatures (26-
38°C) for 7 days, and then frozen. The preserved
hatchlings were later thawed, dissected, and separated
into the carcass, yolk sac. and fat bodies.
All samples for determinations of non-polar lipids,
ash, calories, calcium, and magnesium were oven
dried to constant mass at 65 °C, weighed, and then
ground in a mortar and pestle. Non-polar lipids were
extracted from all samples of egg contents, carcass,
post-hatching yolk, and fat bodies for a minimum of
5.5 h using absolute ether in a Soxhlet apparatus. The
mass of non-polar lipids in each sample was calcu-
lated as the difference in sample dry mass before and
after extraction.
Ash and calories of samples of egg contents, car-
cass, post-hatching yolk, and fat bodies were deter-
mined using a GR-2800 adiabatic bomb calorimeter
(Changsha Instruments). Titrations were performed of
the residue after calorimetry to correct for nitrogenous
wastes. Samples of eggshells were burned in a muffle
furnace at 550 °C for 24 h to determine ash mass.
Samples for calcium and magnesium determina-
tions were weighed out into glass tubes and digested
completely in hot concentrated nitric acid. Digestates
were brought to volume in volumetric glassware and
stored in a refrigerator until analysis for calcium and
magnesium. Concentrations of the two elements in the
digestates were determined using a WFX-1B model
atomic absorption spectrophotometer (The 2"
Beijing Optical Instruments). To check if there were
any differences in calcium and magnesium contents
between shells from freshly laid eggs and hatched
eggs, we took equal amount of sample from each
shell, pooled separately the samples from the freshly
laid eggs and hatched eggs, and treated them as two
different samples.
All variables were tested for normality using Kolmog-
orov-Smirnov test and for homogeneity of variance
using Bartlett's test prior to further statistical analysis,
and arc-sine transformation was performed for per-
centage data. We used analyses of variance (ANOVA),
analysis of covariance (ANCOVA), regression statis-
tics, and partial correlation analysis to analyze our
data. Significance level was set at a=0.05. Prior to
testing for differences in adjusted means, the homoge-
neity of slopes was checked. Throughout this paper,
values are presented as mean±l standard error.
Results
Elaphe taeniura laid pliable-shelled eggs. Clutch size
in our sample averaged 8.8+0.9 (range=8-ll, N=4).
Freshly laid eggs averaged 26.8±0.6 g (range=20.8-
32.3, N=35) wet mass, 54.1±0.9 mm (range=45.7-
63.2, N=35) length, and 28.8±0.4 mm (range=25.0-
33.1, N=35) width. During incubation, eggs increased
in wet mass and, one day prior to hatching, weighed
110.0±3.5% (range=98.6-135.9, N=14) of egg wet
mass at oviposition. The incubation time averaged
54.9±0.2 days (range=54. 1-55.7, N=14). Newly
emerged young averaged 17.1±0.7 g (range=13.2-
21.8, N=14) wet mass, 381.4±3.5 mm (range=357.0-
405.0, N=14) SVL, and 88.5±1.9 mm (range=77.0-
103.0, N=14) tail length.
The data on components of the freshly laid eggs and
0-day hatchlings are given in Table 1. Egg contents
averaged 74.0% water by mass; egg contents averaged
92.4% organic material, 7.6% ash, 31.5% non-polar
lipid, 1 .36% calcium, and 0.39% magnesium by dry
mass (Table 1 ). Shells from the freshly laid eggs aver-
aged 17.6% of total egg dry mass, and 81.7% organic
material and 18.3% ash by shell dry mass (Table 1).
Shells from freshly laid eggs had higher levels of cal-
cium (8.21%) and magnesium (0.75%) than did shells
from hatched eggs (calcium: 6.31%; magnesium:
0.61%).
0-day hatchlings averaged 70.6% water by mass.
These hatchlings averaged 89.1% organic material.
1999
Asiatic Herpetological Research
Vol. 8, p. 55
Table 1 . Components and F values of the ANCOVA for 7 Elaphe taeniura freshly laid eggs and nine 0-day
hatchlings. Data are expressed as adjusted meam+1SE with total egg wet mass at oviposition as the covariate.
Symbols immediately after F values represent significant levels: NS P>0.05, * P<0.05, " P<0.01, and *** P<0.001.
10.8% ash. 27.8% non-polar lipids, 2.49% calcium,
and 0.48% magnesium by dry mass (Table 1 ). Shells
from hatched eggs averaged 85.1% organic material
and 14.9% ash by dry mass (Table 1 ).
0-day hatchlings contained significantly lower quanti-
ties of total dry mass, organic mass, non-polar lipids,
and energy, but significantly higher quantities of cal-
cium and ash mass than did egg contents (Table 1).
There was no significant difference in the quantity of
magnesium between egg contents and 0-day
hatchlings (Table 1 ). Shells from hatched eggs con-
tained lower quantities of total dry mass and ash mass
than did shells from the freshly laid eggs. No signifi-
cant difference in organic mass was found between
shells from the freshly laid eggs and hatched eggs
(Table 1 ).
During incubation, approximately 84.5% of dry mass,
74.6% of non-polar lipids, and 80.8% of energy in egg
contents of the freshly laid egg were transferred to the
hatchling, with 15.5% of dry mass, 25.4% of non-
polar lipids, and 19.2% of energy used for embryo-
genesis (Table 1 ). Fully developed embryos could
obtain almost all magnesium from the yolk, but
should withdraw 35.6% of their total calcium require-
ments from sources other than yolk (Table 1 ).
Egg contents (1.3610.07%, range=1.14-1.62%, N=7)
of the freshly laid egg had a higher level of calcium
than did post-hatching yolk (0.9910.10%,
range=0.64-1.45%, N=9) (ANOVA: FU4=8.38,
P<0.05). There was no significant difference in the
level of magnesium between egg contents
(0.3910.03%, range=0.32-0.45%, N=7) and post-
hatching yolk (0.4210.05%, range=0.27-0.62%, N=9)
(ANOVA: FU4=0.54, P>0.05).
Dry masses of carcass (r=0.96, Fj 7=157.76,
P<0.001) and fat bodies (r=0.88, F, 7=55.29,
Vol. 8, p. 56
Asiatic Herpetological Research
1999
Table 2. A comparison between nine 0-day and five 7-day hatchlings of Elaphe taeniura. Data are expressed as
mean±1 SE; all mass units are in grams.
0-day hatchling
7-day hatchling
Hatchling wet mass at hatching
Hatchling wet mass 7 days after hatchling
Decrease in wet mass
Hatchling dry mass
Carcass
Yolk sac
Fat bodies
% water of hatchling
18.8±0.9
5.28±0.31
3.51 ±0.20
0.66±0.05
1.11±0.09
70.6+0.5
15.7±0.3
15.0±0.2
0.70±0.22
4.00±0.06
3.18±0.05
0.09±0.01
0.7310.02
73.2±0.3
P<0.001 ) of the 0-day hatchlings were both correlated
with total hatchling dry mass. In the 7-day hatchlings,
we only found a positive correlation between carcass
dry mass and total hatchling dry mass (r~=0.88,
F, 3=22.34, P<0.05). 7-day hatchlings had signifi-
cantly heavier carcasses than did 0-day hatchlings
with the same wet mass at hatching (ANCOVA:
Fu |=16.38, P<0.01) (Table 2). There was a negative
correlation between post-hatching yolk dry mass and
carcass dry mass when holding total hatchling dry
mass and fatbody dry mass constant (r=-0.90, t=6.53,
df=10, P<0.001 ). There was no significant correlation
between post-hatching yolk dry mass and fatbody dry
mass when holding total hatchling dry mass and car-
cass dry mass constant (r=0.43, t=1.50, df=10,
P>0.05). There was no significant correlation between
carcass dry mass and fatbody dry mass when holding
total hatchling dry mass and post-hatching yolk dry
mass constant (r=-0.20, t=0.65, df=10, P>0.05). 7-day
hatchlings (23.2±0.4%, range=22.1-24.1%, N=5) had
significant lower levels of non-polar lipids than did 0-
day hatchlings (27.4±0.6%, range=25.3-29.5%, N=9)
(FU2=32.1,P<0.001).
Discussion
Similar to that reported for pliable-shelled eggs of
other reptiles (e.g.. Fitch, 1954; Fitch and Fitch, 1967;
Andrews and Sexton, 1981; Vitt and Cooper, 1986;
Vleck, 1991: Ji et al., 1996, 1997a, b), eggs of E. tae-
niura overall increased in wet mass and swelled dur-
ing incubation due to a net gain of water absorbed
from the substrate on which the eggs were incubated.
However, water uptake seemed not to be obligate for
E. taeniura eggs, because some eggs whose final mass
was less than initial mass also hatched successfully.
Small E. taeniura embryos were present in all
freshly laid eggs, but they, relative to the large egg
size, were too small to be considered as an important
part of the egg at oviposition. Therefore, the transfer-
ence of energy and material from egg to hatchling
during incubation was approximately equal to the
transference overall. This makes it possible to com-
pare our data with those for other oviparous reptiles
whose freshly laid eggs also contain small embryos
and embryonic stage is near the oviparous end in the
oviparity-viviparity continuum (Shine, 1983). Elaphe
taeniura exhibited high conversion efficiencies of
energy and material from egg to hatchling. The values
in Table 3 show that the conversion efficiencies of
energy and material recorded in E. taeniura were
higher than those reported for any other studied rep-
tiles. The values in the Table also show that the con-
version efficiencies vary considerably among species;
however, the explanations to these differences are
unknown at this time. It has been known that costs of
embryonic development vary considerably among
reptiles (Dmf el, 1970; Black et al., 1984), parental
investment in each offspring should be related to its
survivorship (Congdon ad Gibbons, 1989; Fischer et
al., 1991), and incubation environments may influ-
ence embryonic development (Gutzke and Pachard,
1987). So, further studies in a wider field covering
parental reproductive investment, embryonic metabo-
1999
Asiatic Herpetological Research
Vol. 8, p. 57
Table 3. Comparison of conversion efficiencies of dry mass, non-polar lipids, and energy between Elaphe taeniura
and other oviparous reptiles.
lism, and ecology of neonates will be very important
for our giving reliable explanations.
As in other oviparous squamates (Packard et al.,
1984a, 1985; 1988; Ji et al., 1996, 1997a, b), turtles
(Packard et al., 1984b; Packard and Packard 1986),
and the American alligator (Packard and Packard,
1989), Elapeh taeniura embryos use eggshell as a sec-
ondary source of calcium. The result that eggshells
decreased in mass and calcium content during incuba-
tion supports this interpretation. The level (35.6%) of
calcium withdrawn by E. taeniura embryos from the
eggshell was much lower than the values reported for
crocodilians and turtles (50-80%; Bustard et al., 1969;
Jenkins, 1975; Packard and Packard, 1984, 1989). In
squamates, the level was slightly lower than that
reported for Eumeces fasciatus (39%; Shadrix et al.,
1994) but higher than those reported for Eumeces
chinensis (19%; Ji et al., 1996), Coluber constrictor
(20%; Packard et al., 1984a), Elaphe carinata (31%;
Ji et al., 1997a), and Naja naja atra (14%; Ji et al.,
1997b). These differences presumably reflect the
interspecific differences in eggshell structure and allo-
cation of minerals between eggshell and yolk.
The level of calcium in E. taeniura post-hatching
yolk was significantly lower than that in egg contents
of the freshly laid egg. This suggests that E. taeniura
Vol. 8, p. 58
Asiatic Herpetological Research
1999
embryos deplete the yolk of almost of its calcium
before hatching and none of the calcium withdrawn
from the eggshell is deposited in the yolk. This pattern
of mobilization and deposition of calcium is similar to
that observed in other non-crocodilian reptiles (e.g.,
Packard et al., 1984b, 1985, 1987; Packard and Pack-
ard. 1986: Packard and Packard, 1988: Shadrix et al.,
1994).
The estimated amount of magnesium in egg con-
tents of the freshly laid egg (95.9% of total magne-
sium in the hatchling) was slightly less than that in the
hatchling. We are presently not very certain that E.
taeniura embryos use the eggshell as an additional
source of magnesium, because any slightly biased
estimation might account for the remaining 4.1% of
magnesium. However, the fact that shells from
hatched eggs were lighter in mass and lower in the
level of magnesium seemed to imply that E. taeniura
embryos should withdraw a small portion of magne-
sium from the eggshell. Since studies of embryonic
magnesium metabolism have been unfortunately
extremely limited, we cannot discuss this problem in
detail. In the American alligator (Packard and Pack-
ard, 1989) and other species of snakes that have stud-
ied by us, embryos apparently obtain all magnesium
necessary for development from the yolk.
One interesting finding In this study was that a
decrease in post-hatching yolk mass was accompa-
nied by an increase in carcass mass a few days after
hatching. This finding quantitatively confirms that
post-hatching yolk can be used to support early
growth of hatchlings. Compared with post-hatching
yolk, fat bodies were used mainly for hatchling main-
tenance. An obvious decrease in the level of non-polar
lipids in the 7-day hatchlings supports this interpreta-
tion.
Acknowledgments
The work was supported by a grant from the Natural
Science Foundation of China to XJ (NSFC-
39270124). A grant from Paos' Foundation supported
XJ to complete writing this paper in Spain.
Literature Cited
Andrews, R. M., and O. J. Sexton. 1981. Water rela-
tions of the eggs of Anolis auratus and Anolis limi-
frons. Ecology 62: 556-562.
Black, C. P., G. F. Birchard, G. W. Schuett, and V. D.
Black. 1984. Influence of incubation water content on
oxygen uptake in embryos of the Burmese python
(Python molurus bioittatus). In R. S. Seymour (ed.),
Respiration and Metabolism of Embryonic Verte-
brates, pp. 137-145. Dordrecht, Dr W. Junk Publish-
ers.
Bustard, H. R., N. K. Jenkins, and K. Simkiss. 1969.
Some analyses of artificially incubated eggs and
hatchlings of green and loggerhead sea turtles. J.
Zool. (Lond.) 158:311-315.
Congdon, J. D., and J. W. Gibbons. 1989. Posthatch-
ing yolk reserves in hatchling American alligator.
Herpetologica 45: 305-309.
Congdon, J. D., J. W. Gibbons, and J. L. Greene.
1983. Parental investment in the chicken turtle (Deiro-
chelys reticularia). Ecology 64: 419-425.
Dm'iel, R. 1970. Growth and metabolism in snake
embryos. J. Embryol. Exp. Morph. 23: 761-772.
Ewert, M. A. 1979. The embryo and its eggs: develop-
ment and natural history. In M. Harless and H. Mor-
lock (eds.). Turtles: Perspectives and Research, pp.
333-413. John Wiley and Sons, New York.
Fischer, R. U., F. J. Mazzotti, J. D. Congdon, and R.
E. Gatten, Jr. 1991. Post-hatching yolk reserves:
parental investment in American alligators from Loui-
siana. J. Herpetol. 25: 253-256.
Fitch, H. S. 1954. Life history and ecology of the five-
lined skink Eumeces fasciatus. Univ. Kans. Publ.
Mus. Nat. Hist. 8: 1-156.
Fitch, H. S., and A. V Fitch. 1967. Preliminary exper-
iments on physical tolerance of the eggs of lizards and
snakes. Ecology 48: 160-165.
Gutzke, W. H. N., and G. C. Packard. 1987. Influence
of the hydric and thermal environments on eggs and
hatchlings of bull snakes Pituophis melanoneucus.
Physiol. Zool. 60:9-17.
Huang, M.-H., and Y.-L. Jin. 1990. Reptilia. In M.-H.
Huang, Y.-L. Jin, and C.-M. Cai (eds. ), Fauna of Zhe-
jiang (Amphibia and Reptilia), pp. 153-281. Zhejiang
Science and Technology Publishing House, Hang-
zhou.
Jenkins, N. K. 1975. Chemical composition of the
eggs of the crocodile (Crocodylus novaeguineae).
Comp. Biochem. Physiol. 51A: 891-895.
Ji, X., S.-Y. Fu, H.-S. Zhang, and P.-Y Sun. 1996.
Material and energy budget during incuabtion in a
Chinese skink, Eumeces chinensis. Amphibia-Reptilia
17: 209-216.
Ji, X., P.-Y. Sun, S.-Y. Fu, and H.-S. Zhang. 1997a.
Utilization of energy and nutrients in incubating eggs
and post-hatching yolk in a colubrid snake, Elaphe
carinata. Herpetol. J. 7: 7-12.
Ji, X., P.-Y. Sun, H.-S. Zhang, and S.-Y. Fu. 1997b.
Incubation and utilization of energy and material dur-
1999
Asiatic Herpetological Research
Vol. 8, p. 59
ing embryonic development in eggs of Naja naja alra.
J. Herpetol. 31:302-306.
Kraemer, J. E., and S. H. Bennett. 1 98 1 . Utilization of
posthatching yolk in loggerhead turtle, Caretta
caretta. Copeia 1981: 406-41 1.
Packard, M. J., and G. C. Packard. 1984. Comparative
aspects of calcium metabolism in embryonic reptiles
and birds. In R. S. Seymour (ed.). Respiration and
Metabolism of Embryonic Vertebrates, pp. 155-179.
Dordrecht, The Netherlands, Junk.
Packard, M. J., and G. C. Packard. 1986. The effect of
water balance of eggs on growth and calcium metabo-
lism of embryonic painted turtles (Chrysemys picta).
Physiol. Zool. 59: 398-405.
Packard, M. J., and G. C. Packard. 1988. Sources of
calcium and phosphorus during embryogenesis in
bullsnakes (Pituophis mekmoleucus). J. Exp. Zool.
246: 132-138.
Packard, M. J., and G. C. Packard. 1989. Mobilization
of calcium, phosphorus, and magnesium by embry-
onic alligators (Alligator mississippiensis). Am. J.
Physiol. 257: R1541-R1547.
Packard, M. J., and G. C. Packard, J. D. Miller, M. E.
Jones, and W. H. N. Gutzke. 1985. Calcium mobiliza-
tion, water balance, and growth in embryos of the aga-
mid lizard Amphiholurus barbatus. J. Exp. Zool. 235:
349-357.
Packard, M. J., and G. C. Packard, and W. H. N.
Gutzke. 1984a. Calcium metabolism in embryos of
the oviparous snake Coluber constrictor. J. Exp. Biol.
110:99-112.
Packard, M. J., and G. C. Packard, T. M. Short, G. C.
Packard, and T. A. Gorell. 1984b. Sources of calcium
for embryonic development in eggs of the snapping
turtle Chelydra seipentina. J. exp. Zool. 230: 81-87.
Shadrix, C. A., D. R. Crotzer, S. L. McKinney, and J.
R. Stewart. 1994. Embryonic growth and calcium
mobilization in oviposited eggs of the scincid lizards,
Eumeces fasciatus. Copeia 1994: 493-498.
Shine, R. 1983. Reptilian reproductive modes: the
oviparity-viviparity continuum. Herpetologica 39: 1-
M. W. J. Ferguson (eds.), Egg Incubation, Its Effect
on Embryonic Development in Birds and Reptiles, pp.
213-228. Cambridge University Press, Cambridge.
Vitt, L. J., and W. E. Cooper, Jr. 1986. Skink repro-
duction and sexual dimorphism: Eumeces faciatus in
the southeastern United States, with notes on Eumeces
inexpectatus. J. Herpetol. 20: 65-76.
Wilhoft, D. C. 1986. Egg and hatchling components
of the snapping turtle (Chelydra serpentina). Comp.
Biochem. Physiol. 84A: 483-486.
Zhao, E.-M., and K. Adler. 1993. Herpetology of
China. Published by Society for the Study of Amphib-
ians and Reptiles. Oxford, Ohio, USA, 521pp.
Zhao, Q., J-Q. Zhang, H.Y. Huang, and X. Ji. 1997.
Utilization of egg energy and material by Rhabdophis
tigrinus lateralis embryos during incubation. J. Hang-
zhou Normal Coll. 97 (3): 60-64.
Troyer. K. 1983. Posthatching yolk energy in a lizard:
utilization pattern and interclutch variation. Oecologia
(Berl.) 58: 340-344.
Troyer, K. 1987. Potshatching yolk in a lizard: inter-
nalization and contribution to growth. J. Herptol. 21:
102-106.
Vleck, D. 1991. Water economy and solute regulation
of reptilian and avian embryos. In D. C. Deeming, and
1999
Asiatic Herpetological Research
Vol. 8, pp. 60-68
Redescription and Generic Redesignation of the Ladakhian Gecko
Gymnodactylus stoliczkai Steindachner, 1969
Muhammad S. Khan1 and Herbert Rosler2
'12731 SW8th Ct.. Davie, Florida, 33325 USA 2F Freiligrath Str. 51, 06502 Thale/Harz, Germany
Abstract.- Gymnodactylus stoliczkai is redescribed on the basis of recently collected topotypes, and is
redesignated to the genus the Cyrtodactylus. It is found to be morphologically distinct from C. walli and C.
yarkandensis with which species it has long been synonymized. Reproduction, ecology and distribution of this
highland gecko is discussed.
Key words.- Cyrtodactylus stoliczkai, taxonomy, reproduction, ecology, zoogeography.
Introduction
In 1866 Dr. Ferdinand Stoliczka deposited a collec-
tion of animals, collected from different parts of the
Indo-Pak subcontinent, in Naturhistoristorisches
Museum Wien, Austria (NMW). The collection con-
tained a gecko from Karoo, north of Dras. Kashmir,
apparently collected during geological survey of west-
ern Himalayas, which was described by Steindachner
in 1867 as a new taxon, Gymnodactylus stoliczkai,
honoring its collector. The specimen is still available
in the museum under registry number NMW 16756
(Tiedemann et al., 1994). Ever since the description of
this taxon, it has become a habit with herpetologists
working on collections from northern Pakistan, to try
to place almost every angular-toed gecko encoun-
tered, in the synonymy of G. stoliczkai without going
into details of morphological comparisons: Smith,
1935 (Gymnodactylus walli Ingoldby, 1922): Minton,
1966 (Cyrtodactylus mintoni Golubev and Szczerbak,
1981) and Mertens, 1969 (Cyrtodactylus dattanensis
Khan, 1980), creating taxonomic chaos. Recent col-
lections from circum-Himalayan region has shown
that G. stoliczakai does not belong to the fauna of
Pakistan, moreover, all the geckos placed in its synon-
ymy are themselves valid independent taxa (Khan,
1992, 1993, 1994; Khan and Baig, 1992).
A long, detailed morphological redescription of
Gynnodactylus stoliczkai is urgently due, to make
intertaxal comparisons possible and to come out of
"stoliczkai myth". Due to lack of working material
the present project has considerably been delayed.
The type specimen (NMW 16756) and syntype in the
Museum of Comparative Zoology, Cambridge (MCZ
7132) are not allowed to be loaned for study. There-
fore the data for present study is drawn from several
sources: one of us (HR) has studied series of 14 topo-
types of this species in Zoologische Staatssammlung
Munchen (ZSM: Table 1: collected by Gruber, 1981),
while Dr. G. R. Zug (National Museum of Natural
History, Washington) has kindly taken data on topo-
type MCZ 7132 for us. Moreover, present redescrip-
tion is further supplemented with the data available in
literature (Steindachner, 1867:15: Boulenger,
1890:63; Smith, 1935:57; Constable, 1949:84; Szcz-
erbak and Golubev, 1986:205). Photographs of topo-
types (Fig. 1; ZSM 124.77) and (Fig. 2; ZSM 45.77),
and type NMW 16756 (Khan, 1994; Fig. 2) have
helped us immensely to understand morphology of
this important taxon.
Taxonomic Notes
Sprix's (1825:17) genus Gymnodactylus included all
the then known non dilated angular-digited geckos
(Boulenger, 1885:22, 1890:59; Annandale, 1913:309;
Smith, 1935:37). Until Underwood (1954) restricted
this genus to South American angular-digited geckos,
placing all south Asian geckos in the genus Cyrtodac-
tylus Gray 1827. Most of the subsequent workers on
the herpetology of Pakistan have followed Under-
wood's view point (Minton, 1966; Khan, 1980; Khan
and Mirza, 1977). However, Mertens (1969) is ortho-
dox and a bit cautious by retaining Gymnodactylus as
a genus and placing Pakistani geckos in the subgenus
Cyrtodactylus.
A recent break through towards a solution comes
from Szczerbak and Golubev (1984, 1986): the genus
Tenuidactylus is erected to include Palearctic angular-
digited geckos. It is divided in three subgenera to
accommodate the rest of the southeast Asian gekkota:
subgenus Tenuidactylus includes two Pakistani spe-
cies T. montiumsalsorum and T. kohsulaimanai, and
the group of Tibeto-Himalayan species: T. tibetanus.
1999
Asiatic Herpetological Research
Vol. 8, p. 61
Table 1 . Range of scale counts and measurements of topotype series of Tenuidactylus stoliczkai in Zoologische
Staatssammlung Munchen (ZSM) collection (data from juvenile ZSM 1 19/77 not taken into account).
Character
Range
Supralabials 9-11
Infralabials 7-9
Nasals 3-3
Internasals 1 -3
Postmentals 2-2
Loreals 10-15
Scales between eye-ear 15-20
Interorbitals 17-19
Tubercle rows across body middorsum 8- 1 2
Sale rows across midbelly 25-30
Midventrals 110-133
Lamellae under first toe 11-14
Lamellae under fourth toe 22-27
Cloacal spines 2-3
Granular scale rosette around dorsal tubercle 7-9
SVL 27-49.4 mm
TL 25-49.7 mm
Head length 8-1 1 .5 mm
Head width 5-10.7 mm
Head height 3-6.1 mm
Nostril-eye distance 2-4.4 m
Eye-ear distance 2-4.1 mm
Body length 10-23.6 mm
Eye diameter 2-2.8 mm
Ear diameter 0.4-0.9 mm
Head length/head width 0.99-1 .43 mm
SVUbody length 2.09-2.64 mm
Head length/head width 0.99-1 .43 mm
Distance nostril-eye/eye-ear 0.98-1.29 mm
Eye/ear diameter 2.33-5 mm
Vol. 8, p. 62
Asiatic Herpetological Research
1999
thS/1977-
Figure 1. Cyrtodactylus stoliczkai (ZSM 124.77), adult
female, with unregenerated tail.
T. mintoni, T. chitralensis, T. stoliczkai and T.kirman-
ensis; the genus Cyrtopodion Fitzinger, 1 843 is resur-
rected as a second subgenus to include four Pakistani
forms: agamuroides, scaber, watsoni and kachhensis.
A third subgenus Medioductylus is left floating (Gol-
ubev, pers. comm.. 1996).
Undoubtedly southeast Asian cyrtodactylid geckos
are morphologically distinct from Palearctic tenuidac-
tylids (Leviton and Anderson, 1970: Khan, 1988,
1989, 1991; Khan and Tasnim, 1990). Khan (1993)
maintains the genus Cyrtodactylus Gray, 1827, to
include Tibeto-Himalayan species group and all the
southeast Asian species (Smith, 1935). The southeast
Asian cyrtodactylids are a very heterogeneous assem-
blage of closely allied species. Their shared characters
are: smooth tubercular granular scales with scattered
round-oval smooth or slightly keeled tubercles on
head and body dorsum; more than 25 heterogeneous
interorbitals; subcylindrical and subequal body and
tail; dorsal vivid pattern; subdigital lamellae about
twice as broad as high with a pair of lateral row of
granular scales, lamellae not swollen at the digital
angles; 2-10 preanal pores in male, rare femoral
pores; small blunt caudal tubercles, subcaudals small
rarely broad. In the past there have been several
attempts to arrange them in a logical array (Annan-
dale, 1913; Smith, 1935: Khan, 1993). Considering
morpho-ecogeography of these geckos, we distin-
guish two lineages:
Circum-oceanic group: tropical, scattered along sub
continental coastal strip and oceanic islands, confined
between lat. 7-32° N, long 75-105° E; dorsal pattern
of vivid cross bars or spots, dorsal granular scales
mixed with larger rounded, smooth or slightly keeled
tubercles, tail and body cylindrical, tail often longer
/tfDACH4L
Figure 2. Cyrtodactylus stoliczkai (ZSM 45.77), adult
female, with regenerated tail.
than body: Cyrtodactylus pulchellus, interrnedius,
consobrinoides, angularis, khasiensis, rubidus, trie-
drus, nebulosus, collegalensis, dekkanensis, albofas-
ciatus and jayporensis.
Circum-Himalayan group: subtropical, highland
forms, mainly extending between lat. 34-4° N, long
75° 50-50'E, tubercular, beady, scarcely imbricate
granular dorsal scales, interspersed by 2-3 times
larger oval keeled or keelless tubercles arranged in
more or less in 12-13 longitudinal rows; body and tail
subequal and subcylindrical, subcaudals small in sev-
eral rows, inconspicuous dorsal pattern of transverse
bands, spots or reticulation.
Further distinguished in three subgroups:
stoliczkai subgroup: body and tail rather flat in cross
section, caudal tubercles flat, smooth; anterior half of
tail segmented, segments laterally lobulated in older
animals, regenerated tail flattened and abnormally
swollen, no preanal and femoral pores. Includes high-
land species: Cyrtodactylus lawderanus, C. stoliczkai,
C. yarkendensis and C. baturensis.
tibetinus subgroup: Body and tail round in cross sec-
tion, tail segments not distinct, 4-10 preanal pores,
feebly keeled caudal tubercles, regenerated tail not
flattened. Dorsal pattern of vivid cross bars, spots or
reticulation. Includes Tibeto- Himalayan low altitude
submountain geckos: Cyrtodactylus tibetinus, C.
himalayanus, C. mintoni, C. dattanensis and C. bat-
talensis.
walli subgroup: Body flatter, tail quadrangular in
cross section, distinctly segmented, caudal tubercles
large slightly keeled, median row of subcaudals trans-
versely enlarged; 4-6 preanal pores. Species included
are: Cvrtodactvlus kinnanensis and C. walli.
1999
Asiatic Herpetological Research
Vol. 8, p. 63
Table 2. Comparison of morphology of 1= Tenuidactylus yarkandensis (J. Anderson, 1872) with its closest conge-
ners: 2= T. stoliczkai (Steindachner, 1867), 3= T. iva///(lngoldby, 1922) and 4= T. baturensis Khan and Baig, 1992;
vl=vertical, (measurements in mm).
Redescription
Cyrtodactylus stoliczkai (Steindachner, 1867)
Gymnodactylus stoliczkai Steindachner,
1867, Reise Novara, Zool., 1:15 Rept. 1, Plate
2, Fig. 2, 2a.
Cyrtodactylus stoliczkai Underwood, 1954,
Proc. Zool. Soc. London, 124:475.
Type locality: near Karoo, north of Dras, Kashmir.
Holotype: NMW 16756 (Fig. 1), female, near Karoo,
north of Dras, 3200 m, Kashmir (34° 28' N, 75° 46'
E), donated by Stoliczka in 1866.
Paratypes: MCZ 7132, female, pholidosic counts and
measurements by Dr. Zug, (per comm., 1989) Ladak.
3100 m, Stoliczka, 1908.
Topotypes (14, examined): ZSM 45.77 (1,2, 3, 4, 5)
and 149.77 (1, 2, 3, 4, 5), 2 males, 5 females, three
juveniles. Phyang Ghompa, Ladakh, 3600 m, 5.7.77
and 19.8.77: ZSM 46.77, and 124.77, 2 females,
Hemis, Ladakh, 3700 m, 6.7.77 and 17.8.77: ZSM
119.77, juvenile, Kargiul. Ladakh, 2750 m, 12.8.77:
ZSM 121.77, female, Saspool, Ladakh, 3100 m,
16.8.77, all collected by Ulrich Gruber ( 1981 ).
Diagnosis: Body and tail moderately depressed, tail a
little longer than body, caudal segments of unregener-
ated tail deeply sected on lateral sides to anterior half
of the tail, three tubercles, and several series of small
subcaudals arranged in four transverse rows: body
dorsum with flat, mostly juxtaposed granular scales,
distinctly arranged in transverse rows, interspersed
with large flat smooth oval tubercles, about three
times larger than granular scales, more or less
arranged in 9-10 transverse rows across middorsum
and 19-20 along paravertebral line; 16-20 interorbital
tubercular scales: 27-32 scales across midabdomen,
117-150 midventrals; both preanal and femoral pores
not indicated: dorsal pattern of M-shaped transverse
Vol. 8, p. 64
Asiatic Herpetological Research
1999
dark bands with heavier posterior margin, broader
than interspaces.
Description of holotype NMW 16756, Fig. 1, (state-
ments in parenthesis are from paratype and topotypes
adding up to the original description of holotype
NMW 16756 by Steindachner, 1867:15): (habitus
depressed); rostral scale big (7-angular, broader than
deep), slightly convex at the upper edge, and forked in
the middle reaching the anterior end of the snout
(median dorsal rostral longitudinal furrow narrowly
misses anterior border of the rostral scale); nasal
opening (small, dorsolateral) bordered in front by ros-
tral plate, (ventrally by) second upper lip shield (first
supralabial. Note rostral shield is regarded as first
supralabial in original description), posteriorly by
three small nasal shields, of which upper most is the
largest (separated from that of other side by a pair of
granular scales, rostral area with heterogeneous tuber-
cular scales mostly arranged in longitudinal rows, 1 1-
12 tubercular loreal scales between posterior nasals
and anterior rim of orbit; head with heterogeneous
granular tubercular scales, 19-20 between orbits
arranged in longitudinal rows, smaller on eye bulg-
ings; a series of sharp supraciliary scales jutting out
from posterior half of the upper eyelid border fol-
lowed by a row of large tubercular round scales run-
ning along the eyelid; temporals and neck with small
tubercular granular scales: ear opening round, much
larger than largest dorsal tubercle).
19-21 upper lip shields (10-11 supralabials, first
three of the same size; suture between first supralabial
and rostral scale almost equals former's length along
oral orifice); 13 lower labial shields (7-9 infralabials,
second narrowest while fourth the longest; 2-3 rows
of sublabials). The anterior most lower lip shield
(mental scale) is very large, triangular (about twice
deep as broad, extends deep between first pair of post-
mentals), three pairs of chin shields (first pair, largest,
narrowly in contact with each other behind posterior
tip of mental scale, second pair smaller, less than half
the size of first not in contact with each other), third
pair (smallest) almost fully separated from lower labi-
als (on right while in contact on left).
Body dorsum clearly granulated (with flat, juxta-
posed, rarely slightly imbricate granular scales,
arranged in transverse rows) with numerous, only lit-
tle bigger fully rounded tubercles (interspersed with
2-3 times large, flat, smooth, round or oval tubercles,
scattered evenly on body dorsum, more or less
arranged in longitudinal rows, separated from each
other by 3-4 granular scales, a rosette of 7-9 granules
around a tubercle; tubercles on sides slightly conical).
(Gular scales flat, juxtaposed or slightly imbricate,
mostly arranged in transverse rows interspersed with
larger scattered tubercles, becoming flatter and pen-
tagonal on chest, at abdomen flat, hexagonal, broader
than long, slightly imbricate rarely juxtaposed,
arranged in transverse rows, 30-32 scales across
midabdomen; slightly marked lateral abdominal folds,
5-6 rows of lateral abdominal scales differ little from
dorsals, however clearly marked from abdominals;
femoral and preanal pores absent (even their site not
marked by distinct scales; 142-149 midventral scales
between first pair of submental and anterior anal lip. A
pair of lateral cloacal tubercles, no postanal bulge).
(Limbs medium sized, covered with imbricate
smooth scales arranged in transverse and longitudinal
rows, without tubercles; subfemorals in 5-6 transverse
rows, as large as abdominals: median-subtibial scales
largest, imbricate, arranged in trans verse rows; gran-
ular postfemorals extend on to the sides of preanals,
with no tubercles; tips of finger-claws extend to ante-
rior of eye, when forelimbs are adpressed forward,
those of toes a little anterior of axilla; subdigital
lamellae 23-24 under fourth toe, equally broad
throughout, not enlarged under basal and angular
parts of digits).
Tail, as it appears in the specimen examined by us,
is regenerated in the anterior, somewhat longer than
the body. Lined on each (dorso- lateral) side by three
rows of large, spike shaped raised tubercles, of which
those of lower most row are the biggest and conical.
No large transverse plates under side of the tail
(regenerated?, this parenthesis is by Steindachner),
posterior half of the tail is with uniform scales (mor-
phologically tail of the holotype reminds original tail
of older specimens of Hemidactylus flaviviridis.
Doubtless the type specimen has original tail which is
normal for older animals of the species as in ZSM
124.77. The tail is moderately depressed, its stump is
less than half the width of body and the segmented
part almost equals body's width, a median dorsal and
ventral longitudinal slight furrow runs along its
length. Its anterior half is divided in 10 distinct later-
ally lobulated segments, while posterior unsegmented
half gradually narrows to sharp terminal tip; dorsolat-
eral^ caudal tubercles are given from the middle of
the segments, four on 1st to 5th segment, three on 6th
to 10th. The dorsal tubercles are small roundish about
2-3 times smaller than laterals which are elongated
conical blunt, in contact with each other, are gradually
reduced in size, until almost indistinct in posterior
half of the tail. Dorsally 6-7 transverse rows of hetero-
geneous, slightly imbricate, smooth, tubercular scales
cover anterior caudal segments while 4 transverse
1999
Asiatic Herpetological Research
Vol. 8, p. 65
rows of small imbricate subcaudals are present on
ventral side of segment. In the posterior quarter dorsal
and ventral caudal scales become indistinct from each
other, get longer, flatter, pointed at tips and are
strongly imbricate).
Color: Body dorsum light blue grey, with pink edged
transverse bands with denser wavy posterior edges,
broader than interspaces, three on nape, six on body
and 13 on tail (in preserved specimens bands are dark
and does not extend on subcaudals). (Head), labials
and tail plates with fine grey dots, limbs and digits
barred, ventrum light.
Measurements (in mm): Snout vent length 48, tail
length 52, trunk length 24, head length 1 1 .5, head
width 10, head height 7, eye diameter, not including
bony orbit 2.5: snout length 5: oculo-orbital space 5,
Variation: Table 1 presents the measurements and
pholidosic counts in ZSM series which fall within the
range of the type specimen NMW 1 6756 and paratype
MCZ 7132, differing in minor details of pholidosic
morphology: rostral scale is protrubrant in most of the
specimens, however, in some it is flat, the median ros-
tral groove in some specimens extend to middle,
while in other it narrowly misses the anterior end of
the scale: the supraciliary pointed scales vary in their
pointedness; dorsal tubercles uniformly scattered on
dorsum, 2-3 times larger than dorsal granular scales,
separated from each other by 2-4 granular scales, sur-
rounded by a rosset of 6-9 granular scales; lateral
abdominal folds strongly or poorly indicated.
Study of tail morphology of MCZ 7132 and speci-
mens in ZSM series indicates that the tail of the holo-
type NMW 16756 is undoubtedly original.
Steindachner (1867) himself was doubtful about its
being "(regenerated?)". In young specimens with
unregenerated tail, the tail is uniformly broad from
basal stump till mid-tail, where it gradually tapers to
its tip (ZSM 45.77:5, 1 19.77, 124.77, 149.77: 1, 2, 4,
5). As animals get older (NMW 16756 and ZSM
124.77), the anterior half of the original tail becomes
broader, flatter and deeply sected on sides so much so
it appears laterally lobulated at segments. From lateral
lobes caudal tubercles strongly jet out. While in
regenerated tail, MCZ 7132 and ZSM 49.77,the tail
swells up almost round at the base, with no indication
of segmentation, lobulations and tubercles, while pos-
teriorly it abruptly tapers. Moreover, instead of trans-
verse bands of original tail, the regenerated tail is
spotted with longitudinal spots, scattered all over it.
Tail in ZSM 45.77, 49.77:3, 45.77, 121.77 and ZSM
49.77 represent different stages of tail regeneration in
Tenuidactylus stoliczkai.
Dorsal pattern of bands is vividly distinct in juve-
niles (ZSM 1 19.77), but is gradually lost as the animal
grows older.
Sex: Though dissection is the sure way of sex deter-
mination of geckos, however, presence of prcanal and
femoral pores in males and their absence in females
arc almost universal sex indicators in these animals. In
the type specimen of Tenuidactylus stoliczkai NMW
16756, paratype MCZ 7132 and ZSM series the prea-
nal and femoral are absent, moreover their position is
not indicated by distinctiveness of scales in the area.
On the other hand, swollen postanal sacs are usually
distinct in male less so in female geckos (Smith, 1933,
1935: Khan and Baig, 1992). There is no indication of
postanal sacs in type nor in paratype, however, are
well indicated in two specimens in ZSM series which
are males. Constable (1949:84) designated MCZ 7132
as a male specimen, which on dissection is proven to
be an adult female with well developed vitellogen fol-
licles (Zug, personal communications, 1989).
Ecology: Ladakh lies around 3000 m, above timber-
line. It is completely dry snow desert, with sparse veg-
etation of herbs, shrubs and grasses. The area is
highly arid with sub-tropical continental highlands
cold climate. Heavily snowy winters, getting rain in
winter and spring. Maximum summer July tempera-
ture is 24.7° C, minimum 10.2°, while maximum win-
ter temperature in January is -1.4° C, dropping to
minimum -13.3°. Maximum rain fall, 15.0 mm, is
received during August, minimum, 1.0 mm during
November (Ahmad, 1951).
Gruber (1981) collected T. Stoliczkai from rocky
habitat, where this gecko prefers desert, bare, dry situ-
ations in the non-irrigated areas without or with very
sparse vegetation, apparently avoiding direct neigh-
borhood of human settlements. Other reptiles col-
lected from the area are Phrynocephalus theobaldi.
Laudakia himalayana, and Scincella ladacensis,
while Bufo latastii is the only amphibian recorded
from waters of the area.
Comparison with congeners: Absence of trihedral
tubercles, preanal and femoral pores, broader subdigi-
tal lamellae and peculiar tail morphology differentiate
Tenuidactylus stoliczkai from Palearctic group of
Pakistani tenuidactylid Cyrtopodion geckos: C
scaber (Heyden, 1827), C. watsoni (Murray, 1892), C.
kachhensis (Stoliczka, 1872), C. montiumsalsorum
(Annandale, 1913) and C. kohsulaimanai (Khan,
1991 ). While Pakistani members of Tibeto-Himalayan
group of cyrtodactylid geckos: C. mintoni (Golubev
and Szczerbak, 1981), C. dattanensis (Khan, 1980) C.
battalensis Khan, 1993 are similar to T. stoliczkai in
the morphology of subdigital lamellae, body configu-
Vol. 8, p. 66
Asiatic Herpetological Research
1999
ration, larger number of interorbitals, subabdominals,
however, they differ markedly from it because of their
plump rounded body and tail, tail morphology, dorsal
tuberculation and pattern which extends on the tail
ventrum, presence of preanal pores in male.
The tenuidactylid group of Pakistani geckos: T.
indusoani (Khan, 1988), T. rohtasfortai Khan and
Tasnim, 1990 and T. fortmunroi Khan, 1993 are dis-
tinguished from the nominated species by their differ-
ent body configuration, smaller number of
interorbitals, subabdominal pholidosic counts, dorsal
scalation and pattern, caudal morphology with keeled
large tubercles, single row of subcaudals, presence of
both preanal and femoral pores.
Following Annandale (1913:316), Smith
(1935:39) grouped T. stoliczkai with low altitude T.
lawderanus (Stoliczka, 1972), despite very obvious
differences from the former: more flattened body and
tail, few and feebly developed dorsal tubercles, incon-
spicuous dorsal pattern, single pair of nasal scales,
presence of preanal pores in male, tail morphology
(compare Fig. 18, Smith, 1935).
C. yarkandensis (J. Anderson, 1872) and C. walli
(Ingoldby 1922), have long been synonymized with
C. stoliczkai and C. chitralensis (Smith, 1935), mostly
due to their similar dorsal pattern, body configuration,
dorsal tuberculation and absence of pores (Boulenger.
1885; Blanford, 1878; Annandale, 1913; Smith, 1935;
Minton, 1966: Mertens, 1969: Szczerbak and Gol-
ubev, 1986). C. chitralensis has been found to be con-
specific with C. walli (Khan, 1992).
Cyrtodactylus stoliczkai is defined by the follow-
ing combination of characters: dorsal granular scales
smooth, round, beady, juxtaposed, interspersed with
oblong, smooth beady tubercles, arranged roughly in
longitudinal rows; normal tail in juveniles uniformly
broad from basal stump till mid-tail, where gradually
tapering to tip, as animal gets old, the anterior half of
the original tail becomes broader, flatter and deeply
sected on sides in lateral lobules at segments, regener-
ated tail much swollen and rounded; subcaudals
small, in several rows; caudal tubercles thick and
blunt.
Geographical Distribution
All evidence goes in favor of the idea that the family
Gekkonidae evolved in southeast Asia and dispersed
westward through southwestern Asia into Indo-Paki-
stan and Africa (Kluge, 1967). Ranges of several cir-
cum-Indian oceanic cyrtodactylids overlap, however
circum-himalayan highland geckos are widely distrib-
uted and the ranges of none of them are known to
overlap: the northern most extralimital, Cyrtodacty-
lus. yarkandensis, is known from lat. 38° 40'N, long
77° 50'E, along the western border of China's Xin-
jiang Province (Khan, 1994) and Cyrtodactylus stolic-
zkai is confined to Ladak, between lat. 34c-35° 45' N,
long 75° 50-76° 70'E (Annandale. 1913; Schmidt,
1922; Gruber, 1981). A highland Pakistani gecko, C.
baturensis, is reported from Gilgit Agency at lat. 36°
20'N, long 74° 50' E (Khan and Baig, 1992). The
western most Pakistani form, C. walli, occurs between
lat. 35-36° N, long 71-72° E. while the western extral-
imital Iranian gecko, C kirmanensis, is reported from
lat. 30° N, long 58° E (Szczerbak and Golubev. 1986).
Worldwide distribution of some geckos is largely
known to be due to human transportation (Darlington,
1957). The circum-oceanic coastal forms are charac-
teristically carried by sailors from coast to coast, how-
ever, some of the species penetrated deep inland.
Similarly, westward dispersal of Cyrtodactylus in the
lower Himalayas appears largely due to westward
migrations of Buddhist peoples and seasonal nomadic
high-low-high altitude migrations which played
important role in the distribution of cyrtodactylid gec-
kos of the area. Massive pagoda buildings and temples
are still the frequent haunts of these geckos. In the
valley-complex of the sub Himalayan system they
evolved into closely allied forms: C. mintoni, C. dat-
tanensis and C. battalensis. A parallel example of
human transportation of a gecko is presented by the
recent record of Palearctic geckos. Hemidactylus per-
sicus. from Rohtas Fort, Jhelum valley. Punjab, Paki-
stan (Khan and Tasnim, 1990). The fort was built from
1542 to 1550 with rock-blocks transported from
Balochistan. H. persicus is the dominant house-gecko
in Balochistan and has never been reported from Pun-
jab (Khan 1987; Khan and Ahmed, 1987). The present
disjunct population most probably descended from
few individuals so transported. Presently the few
observed individuals are in severe competition with
the common indigenous house gecko, H. flaviviridis,
which is dominant throughout the building. The few
individuals of H. persicus are still holding on in
remote recesses of the fort.
Acknowledgments
We wish to express our indebtedness to Dr. George R.
Zug of NMNH for taking pholidosic counts and mea-
surements on MCZ 7132 and to Dr. Michael Golebev.
Seattle, Washington, USA for valuable discussions on
the internet and translation of Russian texts.
1999
Asiatic Herpetological Research
Vol. 8, p. 67
Literature Cited
Ahmed, K. S. 1951. Climale Regions of West Paki-
stan. Pakistan Geographical Review, 6(1): 1-35.
Annandale, N. 1913. The Indian geckos of the genus
Gymnodactylus. Record Indian Museum, 9(21): 309-
326.
Boulenger, G. A. 1890. Fauna of British India, includ-
ing Ceylon and Burma. Reptilia and Batrachia. Lon-
don.
Constable, J. D. 1949. Reptiles from the Indian penin-
sula in the Museum of Comparative Zoology. Bulletin
Museum Comparative Zoology. 103:60-160.
Darlington, P. J. 1957. Zoogeography: the geographi-
cal distribution of animals. John Wiley & Sons, New
York,: 1 -675.
Golubev, M. L. and N. N. Szczerbak. 1981. A new
species of Gymnodactylus Spix, 1923 (Reptilia, Sau-
ria, Gekkonidae) from Pakistan. Fauna Systematics,
1981:40-45, (in Russian).
Gruber, U. 1981. Notes on the herpetofauna of Kash-
mir and Ladakh. British Journal of Herpetology,
6:145-150.
Ingoldby, C. M. 1922. A new stone gecko from Hima-
layas. Journal Bombay Natural History Society,
28:1051.
Khan, M. S. 1980. A new species of gecko from north-
em Pakistan. Pakistan Journal of Zoology, 12:1 1-16.
Khan, M. S. 1987. Checklist, distribution and zoogeo-
graphical affinities of herpetofauna of Balochistan.
Proceedings 7th Pakistan Zoological Congress,
1987:105-112.
Khan, M. S. 1988. A new cyrtodactylid gecko from
northwestern Punjab, Pakistan. Journal of Herpetol-
ogy, 22:241-243.
Khan, M. S. 1989. Rediscovery and redescription of
Tenuidactylus montiumsalsorum (Annandale, 1913).
Herpetologica,45:46-54.
Khan, M. S. 1991. A new Tenuidactylus gecko from
Sulaiman Range, Punjab, Pakistan. Journal of Herpe-
tology, 25:199-204.
Khan, M. S. 1992. Validity of mountain gecko Tenui-
dactylus walli (Ingoldby, 1922). British Herpetologi-
cal Journal, 2:106-109.
Khan, M. S. 1993. A new angular-toed gecko from
Pakistan, with remarks on the taxonomy and a key to
the species belonging to genus Cyrtodacrylus (Rep-
tilia: Sauria: Gekkonidae). Pakistan Journal of Zool-
ogy, 25:67-73.
Khan. M. S. 1994. Validity and redescription of Tenui-
dactylus yarkandensis (J. Anderson). Pakistan Journal
Zoology, 26:139-143.
Khan, M. S., and Ahmed, Naeem, 1987. On a collec-
tion of amphibians and reptiles from Balochistan,
Pakistan. Pakistan Journal Zoology, 19:361-370.
Khan, M. S. and K. J. Baig, 1992. A new Tenuidacty-
lus gecko from northeastern Gilgit Agency, North
Pakistan. Pakistan Journal of Zoology, 24:273-277.
Khan, M. S., and M. R.Mirza. 1977. An annotated
checklist and key to the reptiles of Pakistan. Part II:
Sauria (=Lacertalia), Biologia (Lahore), 23:35-58.
Khan, M. S., and R. Tasnim. 1990. A new gecko of the
genus Tenuidactylus from northwestern Punjab, Paki-
stan and southwestern Azad Kashmir. Herpetologica,
46:142-148.
Kluge, A. G. 1967. Higher taxonomic categories of
gekkonid lizards and their evolution. Bulletin Ameri-
can Museum Natural History, 135:1-59.
Leviton, A., and S. C. Anderson. 1984. Description of
a new species of Cyrtodacrylus from Afghanistan with
remarks on the status of Gymnodactylus longipes and
Cyrtodacrylus fedtschenkoi. Journal of Herpetology,
18:270-276.
Mertens, R. 1969. Die Amphibien und Reptilien West-
Pakistans. Stuttgarter Beitrage zur Naturkunde, 197:1-
96.
Minton, S. A. Jr. 1966. A contribution to the herpetol-
ogy of West Pakistan. Bulletin Museum Natural His-
tory, 134:1-184.
Schmidt, K. P. 1926. Amphibians and reptiles of the
James Simpson-Roosevelt Asiatic expedition. Field
Museum Natural History Publication No. 237, Zool-
ogy Series, 12(13): 167-173.
Smith, M. A. 1935. The fauna of British India, includ-
ing Ceylon and Burma. Reptilia and Amphibia Vol.2.
Taylor and Francis, London.
Steindachner. F. 1867. Reptilia. In Reise der Osterre-
ichischen Fregatte Novara um die Erde in den Jahren
1857, 1858, 1859 unterden befehlen des Commodore
B. Von Wullerstorf-Urbair. Zoology, vol.1, part 4.
Kaiserlich-Konigl. Hof-Staatsdruckerei, Vienna.
ZoologischerTheil Vienna, 1:1-98.
Szczerbak, N. N. and M. L. Golubev. 1984. On the
generic assignment of the Palearctic Cyrtodacrylus
lizard species. Vestnk Zoology, 1984 (2):50-56 (in
Russian).
Szczerbak N. N. and M. L. Golubev. Geckos of the
USSR fauna and adjoining countries. Naukova
Dumka, Kiev 1-232. (in Russian).
Vol. 8, p. 68
Asiatic Herpetological Research
1999
Tiedemann, R, M. Haupl, and H. Grillitsch. 1994.
Katalog der Typen Herpetologiscen Sammlung nach
dem Stand vom 1. Janner 1994. Teil II: Reptilia. Selh-
stverlag Naturhistorisches Museum Wien. Kataloge
Band 10, Vertebrata Heft 4:1-110.
Underwood, G. 1954. On the classification and evolu-
tion of geckos. Proceedings Zoological Society Lon-
don, 124:469-492.
Appendix 1. Abbreviations used
BMNH= British Museum, Natural History. London:
CAS= California Academy of Sciences, California,
USA; MSK= Herp laboratory, 15/6 Darul Saddar
North, Rabwah 35460, Pakistan (author's personal
collection); NMW= Naturhistorisches Museum Wien,
Austria; SR= Institute of Zoology, Academy of Sci-
ences, Kiev-30, Ukraine; UF= Florida State Museum,
Gainesville, USA; USNM= National Museum of Nat-
ural History, Washington, D.C.
Appendix 2. Additional material exam-
ined
Cyrtodactylus battalensis BMNH 1990.2; C. collega-
lensis BMNH 82.4.14.28-29; C. fasciolatus BMNH
1913.11.1 1.2; C. nebulosus BMNH 82.4.14.32-33; C.
oldhami BMNH 1916.6.22.4; C. pulchellus BMNH
1916.3.27.1-2; C.triedrus BMNH 68.3.17.11-12; C.
dattanensis MSK 0056.78: C. yarkandensis BMNH
72.3.22.4; C. tibetinus CAS 196850, CAS 196854;
Gymnodactylus walli BMNH 1910.7.12.1; G. chi-
tralensis BMNH 1946.8.23.19: Tenuidactylus batu-
rensis BMNH 1990.3; T. longipes CAS 115944, SR
307:3267-68; T. longipes voraginosus CAS 130323;
T. montiumsalsorum BMNH 1904.11.19.1 and MSK
014.86; T. indusoani MSK 0467.86; T. mhtasfortai
USNM 284133; Gymnodactylus stoliczkai (photo-
graph) NMW 16756; Tenuidactylus fedtschenkoi SR
1078:8837-8; T. caspius SR 2546:16713-14; T. turc-
menicus SR 961:8016-17.
1999
Asiatic Herpetological Research
Vol. 8, pp. 69-74
Distribution and Natural History of the Lidless Skinks, Asymblepharus alaicus
and Ablepharus deserti (Sauria: Scincidae) in the Aksu-Djabagly Nature
Reserve (Western Tian-Shan Mountains), Kazakstan
Vladimir Kolbintzev1, Larissa Miroschnichenko2, and Tatjana Dujsebayeva2
Aksu-Djabagly Nature Resene. Tjulkubas Region. South Kazakstan District 487964. Kazakstan: Department
of Biology, Kazak State University. Al-Farabi Pr. 71, Almaty 480078. Kazakstan
Abstract.- The data of 8 years observations on two species of the Lidless Skinks, Asymblepharus alaicus and
Ablepharus deserti from the Aksu-Djabagly Nature Reserve (Western Tian-Shan Mountains) are analysed with
special attention to geographical distribution and to some aspects of the natural history of these lizards. It is noted
that in spite of altitude contiguity the two species form few sympatric zones with low population density. Both
species have prolongated seasonal activity, ranging from March- April to October-November. The appearance of
the skinks after winter hibernation, their activity and the beginning of breeding season depend on climatic
conditions, slope exposition and altitude of the site.
Key words.- Reptilia, Squamata, Scincidae, Asymblepharus alaicus, Ablepharus deserti, Kazakstan, distribution,
activity, breeding.
Introduction
The Aksu-Djabagly Reserve is one of the unique natu-
ral reserves of Kazakstan. Its flora and fauna are of a
great interest because of the presence a number of
endemic and localized species, as well as of species
adapted to extreme environmental conditions. The
Aksu-Djabagly Reserve occupies the western part of
the Talas Alatau Range in the Western Tian-Shan
Mountains between 1100-4200 m s. 1. Permanent
snow level is at about 3000 m. The climate is very
continental with an average monthly temperature of -
4.9 C tor the coldest month (January) and of +21.6 C
for the hottest month (July). Four basic altitudinal
zones are present in the Reserve (Karmisheva, 1973:
Kovschar, Ivashzhenko, 1990). These are mountain
foothill zone with a low mountain dry steppe and xer-
ofitic plant association; the steppe meadows, with
scattered tree-like Juniperus forests; subalpine zone
and alpine high mountain meadows.The relatively
small territory of the Aksu-Djabagly Reserve (7400 h)
is inhabited by many species typical for the zoogeo-
graphical provinces of the Europe, North Africa and
Middle Asia. Among reptiles (total number 10 spe-
cies) there are two species of the skinks , the Alpine
Lidless Skink (Asymblepharus alaicus) and the Desert
Lidless Skink (Ablepharus deserti). The first species
(Fig. 1) is widespreaded in the Reserve, the other is
rare species of the region .
Asymblepharus alaicus and Ablepharus deserti are
of an interest from few points. The taxonomic posi-
tion Asymblepharus alaicus and Ablepharus deserti
was cleared only recently after detailed revision by
Eremchenko and Shzherbak (Eremchenko, 1981;
Eremchenko a. Shzherbak, 1986) who separated the
genus Asymblepharus and suggested an independent
evolution for the two lineages of ablepharid lizards.
Data on morphology and biology of the Alpine and
the Desert Lidless Skinks are not numerous and scat-
tered through a number of works (Atayev, 1985; Ban-
nikov et al., 1977: Bogdanov, 1960; 1965; Bruschko,
1995; Said-Aliyev, 1979; Shammakov, 1981: Shnitni-
kov, 1929; Terentjev a. Chernov, 1949; Yakovleva,
1964). The monograph by Eremchenko and
Shzherbak (1986) deservs special attention because it
contains all known data on the morphology, distribu-
tion and biology of the ablepharid lizards of the
former USSR.
The distribution and biology of two skink species
remains poorly studied. The present paper deals
mainly with the distribution of the Alpine and the
Desert Lidless Skinks in the Aksu-Djabagly Nature
Reserve and presents data on their natural history.
Material and Methods
Field observations together with the description of
live and museum material carryed out on Asymble-
pharus alaicus and Ablepharus deserti over a period
of 8 years (1988-1996) and surved as a basis for the
present paper. We observed and collected skinks from
22 localities of the Aksu-Djabagly Nature Reserve
(Fig. 2). We identifyied the species in the field basing
on their external morphology and altitude distribution.
Vol. 8, p. 70
Asiatic Herpetological Research
1999
Figure 1 . The map of the localities of the Lidless Skink in the Aksu-Djabagly Nature Reserve (Western Tian-Shan
Mountains). Asymblepharus alaicus and Ablepharus deserti have independent enumeration: open circles repre-
sent the localities of Asymblepharus alaicus, closed circles represent the localities of Ablepharus deserti. Asym-
blepharus alaicus: 1) Chuuldak (2000 m); 2) Minzhilky Ravine (2600 m); 3) Kshy-Kaindy Pass (2200 m); 4) Kshy-
Kaindy Ravine (1850 m); 5) Ulken-Kaindy Pass (2900 m); 6) Ulken-Kaindy Ravine (2000 m); 7) Kaskabulak (2600-
3300m); 8) Aksay Pass (2900 m); 9) the Upper of the Djabagly River (3000 m); 10) Kizolgenkol Lake (2200 m); 1 1)
the upper of the Middle Karasay River (3000-3100 m); 12) Low Karasay Ravine (3000-3100 m); 13) south-western
slope of Kokseky Ravine (3100-3200 m); 14) eastern slope of the Aksay Ravine (2600 m). Ablepharus deserti: 1)
western mountain foothill of theTalas Alatau Range (1300 m); 2)Taldibulak Ravine (1100 m); 3) northern moun-
tain foothills of theTalas Alatau Range near Djabagly Village (1200m); 4) Djabaglitau Range (1300 m); 5) valley
between Aksu and Baldabrek Rivers near the Kizilblek Village (1400m); 6) eastern slope of the Baldabrek Ravine
(1600 m); 7) mountain foothills near the Ergaly Ravine (1200 m).
Additionaly we used museum material fixed in 10 %
neutralized formalin and preserved in 70 ethanol. The
confirmation of species identification was mainly
based on the peculiarities of the scalation around the
eyes (see Eremchenko a. Shzherbak, 1986).
We also described character of the skink habitats
together with plant composition and visually classi-
fied the dominant substrate of the sites. Altitudes and
slope exposition were also taken into consideration.
All colonlected and museum specimens were mea-
sured in mm according to Eremchenko and Shzherbak
( 1986); their life history stages were recorded as juve-
nile, subadult, adult. All the skinks captured for the
present study were returned to the sampling sites.
Skink populaton density inferred by counting the
numbers of lizards active on the ground surface along
a transect and by turning over stones which were ref-
uges over certain small square areas.
Results and Discussion
Distribution, habitats and density of the populations-
Figure 2 shows 22 localities of two species examined.
All the records (including museum material) were
made by the authors themselves.
In the Aksu-Djabagly Nature Reserve the Alpine
Lidless Skink mostly inhabits the subalpine and
alpine zones between 2500-3000 m where the density
of the lizards is highest, particularly just on passes
and on mountain ridges. For example, on 5 August
1988 we recorded 47 specimens of Asymblepharus
alaicus along the main ridge of the Kazanchukur
Range (3100 m) over an area of 50 x 50 m and over
turning more than 150 stones. During a sunny midday
1999
Asiatic Herpetological Research
Vol. 8, p. 71
Fig. 2. Asymblepharus alaicus.
in July 1995 we observed 16 adult specimens in an
area of 200 x 30 m in the course of half of hour on the
Ulken-Kaindy Pass (2900 m). Transect accounting on
the way down to 2400 m revealed 8 specimens over an
in area of 40 x 4 m. Using secondary ranges and lat-
eral splinters of the main ridge the skinks can come
down to a slope as low as 1500 m (extremely rare to
1200 m) where they have very low population density.
The habitats of Asymblepharus alaicus in the
Aksu-Djabagly are very variable. There are alpine
meadows scattered with stones (Fig. 3), rocky slopes
with Juniperus brush (Fig. 4) and scree slopes. There
is practically no Alpine Lidless Skink in sparse Juni-
perus forests. A combination of the slopes with differ-
ent exposition is the first important condition for
Asymblepharus habitats because of the possibility of
using them during different times of the day. The sec-
ond essential condition is in the presence of suitable
refuges represented by bushes, screes or stone rub-
bles.
Typical habitats for the Desert Lidless Skink in
the Aksu-Djabagly Reserve are dry-south exposed
slopes of no more than 2000 m in altitude (Fig. 5). As
a rule, the plant community includes Ferula plant xer-
ofitic steppe, with bushes of Rosa, Honeysucle, Coto-
neaster, Spirea scattered juniper trees (Fig. 6).
However, the density of Ablepharus deserti popula-
tion in the Reserve is not high in general. Only in rare
cases we observed the lizards near human settlements.
The Aksu and Djabagly rivers with their banks of
southern and northern exposure are the natural bound-
aries separating the habitats of the Alpine and the
Desert Lidless Skinks in the reserve. The two species
were found as sympatric in few areas only. This
occurs in the valleys of rivers flowing down a slopes
Fig. 3. Subalpic meadow at 3000 m of altitude is a typi-
cal locality of Asymblepharus alaicus in the Aksu-Dja-
bagly Reserve.
Fig. 4. The locality of Asymblepharus alaicus in the
Ulken-Kaindy Valley (2100 m).
having northern exposition. In this situation around at
1200-1500 m Asymblepharus alaicus occupies, as a
rule, the river banks and Ablepharus deserti inhabits
the slopes having an eastern and western exposition
(Fig. 7). However, both species have here very low
density .
Vol. 8. p. 72
Asiatic Herpetological Research
1999
Fig. 5. The locality of Ablepharus deserti in the mouth
of the Djabagly River (1200 m).
Daily and seasonal activity
Eremchenko and Shzherbak (1986) noted that the
appearance of the skinks after winter hibernation
depends on climatic conditions, slope exposition and
altitude . According to these authors, the earliest
appearance of Asymblepharns alaicus in northern Kir-
gizstan was registrated on 26 March 1977 in the Kir-
giz Range (1600 m). In the mountains bordering the
eastern coast of the Issik-Kul Lake (2400 m) and on
the slopes of the San-Kul-Too Range having western
exposition (2700 m) the lizards appear by late April.
Yakovleva (1964) noted an earlier activity of males in
comparison with females.
Our observations on the Alpine Lidless Skink in
the Aksu-Djabagly show that lizards appear after win-
ter hibernation in mid April and, as a rule, are active
untill late October-early November. On 29 October
1992 we observed some active adult specimens on the
northexposed slopes at 1900 m. On 1 November 1995
skinks were registrated on northern slope at 1300 m.
For southern slopes , active lizards were recorded later
. Based on data of Eremchenko and Shzherbak (1986)
the last active lizards in the Kirgiz Range (up to 3000
m) were registrated on 3 November 1974. It seems the
skinks have very prolonged seasonal activity. Accord-
ing to Veventzev (1978) who studied Asymblepharus
alaicus in the Almaty Nature Reserve (Northern Tian-
Shan Mountains) some individuals were occasionally
found active during sunny days even in January-Feb-
ruary when small areas of ground get free of snow. On
5 August 1988 at altitude 3100 m we recorded the
beginning of morning activity of the lizards about
11:00 hrs; air temperature +13C. That low tempera-
ture be enough for primary skink activity may shed
some light on the prolonged yearly activity of the liz-
ards.
The daily activity of the Alpine Skink from the
Aksu-Djabagly doesn't visibly differ from that of the
Fig. 6. View on southern slopes of the Djabaglitau
Range (1 500 m). The locality of Ablepharus deserti is
in the background , the locality of Asymblepharus ala-
icus in the foreground.
Alpine skink, described by Eremchenko and
Shzherbak ( 1986) for the Kirgiz Range. These authors
wrote that in spring (April - first half of May) skinks
were active between 11:00-12:00 hrs and 19:00-20:00
hrs. According to our data for summer period, these
lizards appear on ground surface earlier and are active
untill 20:00-21:00 hrs. In autumn their activity shifts
to the second half of the day.
As a rule, Ablepharus deserti appears after winter
hibernation earlier than Asymblepharus alaicus
because of lower altitude of its habitats and the exclu-
sively southern slope expositions. In the Aksu-Djaba-
gly the earliest record for the beginning of Ablepharus
deserti spring activity was noted on 8 March 1989 at
1300 m. Most of the population, however, emerges
from hibernation in mid March. Kaluzhina (1951)
reported that also in the Turkmenistan the Desert
Skink appears after hibernation in first half of March.
According to Yakovleva (1964), in Kirgizstan lizards
of this species come to the ground surface around mid
March Paraskiv (1956) studied the Desert Skink in
southern Kazakstan also noted the first half of March
as the time for the beginning of lizard activity.
In the Aksu-Djabagly the Desert Lidless Skink is
active untill late October-early November. The latest
record here belongs to 3 November 1988. In other
regions of southern Kazakstan the skinks have the
same activity pattern (Paraskiv, 1956). Yakovleva
(1964) for Kirgizia and Said-Aliyev (1979) for Tad-
jikistan reported late September - mid October as the
perod for winter leaving of Ablepharus deserti. The
daily activity pattern of Ablepharus deserti in the
Aksu-Djabagly Reserve doesn't differ markedly from
that of the Desert Skink previously described by other
authors from the surrounding territories. A visibly
variable daily activity of A. deserti was observed by
Bogdanov (1960) in Uzbekistan. For two months in
1999
Asiatic Herpetological Research
Vol. 8, p. 73
the year (March and September) skinks are active for
most of the day (from 10:00-1 1:00 hrs to 18:00-19:00
hrs), whereas in summer they have a two-peak day
activity. The first peak occupies the time between
09:00 and 12:00 hrs. The second peak is between
17:00 and 19:00 hrs. In February and October their
activity is maximal after the midday. A two-peak
activity is also typical for the Desert Skink from Kir-
gizia (Yakovleva. 1964).
All previous authors noted that juveniles and sub-
adults appear after winter hibernation earlier than
adult specimens and return later to their winter ref-
uges.
Breeding
As was first observed by Shnitnikov (1928), viviparity
is a typical feature of Ablepharus (=Asymblepharus )
alaicus. According to Yakovleva (1964), period of
breeding activity of Asymblepharus alaicus in Kir-
gizstan occupies May-June, although some specimens
copulate in July as well. Such data contraddict to
Eremchenko and Shzherbak' (1986) who registrated
frequent copulation lizards in Kirgizstan in late
March-early April. However, this contradiction could
be a consiquence of different climatic conditions in
different years . According to Said-Aliyev' (1979) in
the southern regions of Tadjikistan the Alpine Skink
copulates in late March-April, in the northern regions
in late May-first decade of June. A single female preg-
nant with the eggs of 8.2 x 5.1 mm; 10.2 x 5.0 mm
and 10.1 x 5.0 mm in diameter was found on 3 July
1954.
In the Aksu-Djabagly Reserve, we have found 5
gravid females on 5 August 1988 at an altitude of
3100 m. One of these delivered 3 youngs on the next
day. Some pregnant females approaching delivery we
have also observed 20 July 1995 at the Ulken-Kaindy
Pass (2900 m). On the next day the new born lizards
were met at 1900m. Based on our own data and Yak-
ovleva's (1964) notes over a two-month period of
embryonic development of Asymblepharus alaicus
we consider mid May - mid June as a period of copu-
lating activity of the Alpine Skink in the Aksu-Djaba-
gly Reserve.
As noted by previous authors , for Ablepharus
deserti the egg-laying period varies depending on the
geographical location of the population. In Kirgizstan.
this period occupies the first decade of June (Yakovl-
eva, 1964). In Uzbekistan, the Desert Skink lays its
eggs after mid May. Paraskiv (1956) recorded mid
May - early June as optimal time for egg-laying by A.
deserti in the Betpak-Dala Desert (southern Kazak-
stan) and in the northern coastal territory of the Aral
Sea.
Unfortunately, we have no data on the breeding
season or on the clutch size of Ablepharus deserti in
the Aksu-Djabagly Reserve. However, some informa-
tion on the breeding activity of the Desert Skink in
Kazakstan are present in the work by Bruschko
( 1995), who notes that the beginning of the breeding
season depends on altitude. In the Borolday Moun-
tains females with eggs at the last stage of the devel-
opment were found from mid May to the second half
of June. For Northern Aral Sea region Paraskiv (1956)
recorded the beginning of egg-laying by A. deserti in
second the half of May. As Eremchenko and
Shzherbak (1986) wrote, in Kirgizstan the clutch size
of the Desert Skink varies from 1 to 5 eggs and rarely
reachs 1 1 per female. Yakovleva ( 1964) recorded 2-8
eggs per female for the Kirgizstan populations. Said-
Aliyev (1979) has found 10 July 1959 one female
having 3 eggs in every oveduct, the sizes of which
varied from 9,1 x 3,2 mm to 11,1 x 4,1 mm in diame-
ter. Shammakov ( 1981 ) notes 3-5 eggs in the clutch of
the Desert Skink from Turkmenistan.
The lizards of both species become sexually
mature in the second year (Eremchenko a. Shzherbak,
1986; Said-Aliyev, 1979).
Enemies
According to literature data (Eremchenko a.
Shzherbak, 1986 ; Said-Aliyev, 1979: Yakovleva,
1964) and to our own observation, the Halys Pit Viper
Agkistrodon halys , the Mountain Raser Coluber
ravergieri, the Dione Snake Elaphe dione, the Steppe
Ribbon Snake Psammophis lineolatum, the Steppe
Viper Vipera ursini and the among birds the Legger
Grey Shrike Lanius cristatus, the Long-tailed Shrike
L. scliasch and the Rock Thrush Monticola saxalitis
are the main enemies of both the Alpine and the
Desert Skinks in nature. We also found skink rem-
nants in the nests of the Black-billed Magpie (Pica
pica). Kuzmina (1970) observed the Himalayan Ruby
Throad (Calliope pectoralis) feeding on the Alpine
Skink in the Almaty Nature Reserve.
Acknowledgments
We thank to Sergey Gryasev who helped us in the col-
lection of the animals. We are deeply grateful to Prof.
Ilya Darevskiy (Zoological Institute of Russian Acad-
emy of Sciences, St-Petersburg, Russia) who com-
mented on an early draft of this manuscript. Our
special gratitude to Prof. Emilio Balletto (University
of Torino, Italy) and Mrs. Bell (United Kingdom) for
Vol. 8, p. 74
Asiatic Herpetological Research
1999
their useful remarks on the manuscript and detail cor-
rection of English.
Literature Cited
Atayev, Ch. 1985. Reptiles of the Mountains of Turk-
menistan. Ilym. Ashkhabad. 344 pp. (In Russian).
Bannikov, A.G., I.S. Darevsky, V.G. Ishzhenko, A.K.
Rustamov and N.N. Shcherbak . 1977. Guide to the
Amphibians and Reptiles of the Fauna of the USSR,
Prosveshcheniye, Moscow. 415 pp. (In Russian).
Bogdanov, O. P. 1960. The Fauna of Uzbekskoy SSR.
Amphibians and Reptiles. Tashkent. 260 pp. (In Rus-
sian).
Bogdanov, O.R 1965. The Ecology of the Reptiles of
Middle Asia . Nauka, Tashkent. 258 pp. (In Russian).
Bruschko, Z.K. 1995. The lizards of the deserts of
Kazakhstan. Konzhik, Almaty. 228 pp. (In Russian).
Eremchenko, V.K. 1981. Systematics of Eurasian
lygosomid skinks of the genera Asymblepharus Yeri-
omchenko et Szczerbak, 1980 and Ablepharus (Fitz-
inger in Lichtenstein, 1823) (Sauria, Scincidae). Pp.
54-55. In Problems of Herpetology, Abstr. All-Union
Conf., Nauka, Leningrad. (In Russian).
Eremchenko, V.K. and N.N. Shzherbak . 1986. Able-
pharid lizards of the fauna of USSR and adjacent
countries. Ilym, Frunse. 172 pp. (In Russian).
Karmisheva, N.C. 1973. The flora and vegetation of
the Aksu-Djabagly Nature Reserve. Nauka, Alma-
Ata. 180 pp. (In Russian).
Kovshar, A.F and A. A. Ivashzhenko. 1990. The
Aksu-Djabagly Nature Reserve. Pp. 80-102. In
Sokolov, V.E., and E.E. Siroechkovskiy (eds.). Nature
Reserves of Middle Asia and Kazakstan. Misl, Mos-
cow. (In Russian).
Kuzmina, M.A.1970. The genus Caliope. Pp.610-618.
In Dolgushin, I. A., and M.N. Korelov (eds.). The
birds of Kazakstan. Vol. 3. Alma-Ata, Nauka. (In Rus-
sian).
Paraskiv, K. P. 1956. The Reptiles of Kazakhstan.
Academy of Sciences of Kazakhstan, Alma Ata. 228
pp. (In Russian).
Said-Aliyev, S.A. 1979. The Amphibians and Reptiles
of Tadjikistan. Donisch. Dushanbe. 147 pp. (In Rus-
sian).
Shammakov, S. 1981. The Reptiles of Turkmenistan.
Ilym, Ashgabat. 312 pp. (In Russian).
Shnitnikov, V.N. 1928. The Reptiles of Semirechye.
Society for the study of Kazakstan, Kizil-Orda. 85 pp.
(In Russian).
Terentyev, PV. and S.A. Chernov . 1949. Field guide
of the reptilians and amphibians. Sovetskaya Nauka,
Moscow. 340 pp. (In Russian).
Yakovleva, I.D. 1964. The Reptiles of Kirgisia.
Frunse. 272 pp. (In Russian).
Veventzev, V 1978. On the ecology of Asymblepharus
alaicus in the Almaty Nature Reserve. Pp. 15-21. In
The book of scientific works of the students of Kazak
Paedagogical Institute. Almaty. (In Russian).
1999
Asiatic Herpetological Research
Vol. 8, pp. 75-80
Seasonal Variations of Testicular and Epididymal Structure and Plasma Levels
of Testosterone in the Soft-shelled Turtle (Pelodiscus sinensis)
Wei-ping Mao and Zhao-xian Wang
Department of Biology, Nanjing Normal University; 122 Ninghai Road, Nanjing 210097, China.
Abstract.- For purpose to consider the annual cycle of testis in soft-shelled turtle, Pelodiscus sinensis, the testes
and epididymides were examined histologically, and the plasma levels of testosterone was measured by
radioimmunoassay (RIA) though the year. Gradual increase in testicular weight from May to August was
followed by a decrease in degrees. Spermatocytogenesis was first observed from late April to early May which
remained active to August. Spermatogonial division became to decline in September and stopped by the end of
November. The epididymal weights rose from August to November and remained heavy during hibernation with
a rapid decline of about 53.76% in the mating period of next year. From July to September, the epithelial cells of
epididymal ductus grew and increased in height especially. There were a great number of secretory granules in
the cytoplasm with active synthesis. The plasma concentration of testosterone started to rise in April, which then
fell in May and June. In July, it rose rapidly to peak levels and then declined to minimum. We suggested that it's
more important that the peripheral testosterone promotes reproductive behaviour and stimulates secretion
synthesis in epithelial cells of epididymis.
Ke\ words.- Pelodiscus sinensis, testosterone.
Introduction
Only scattered and equivocal literature can be found
concerning the reptilian gametogenetic cycle, the
endocrinological function of testis and pituitary gonad
interrelationships. The information is almost exclu-
sively derived from investigations on squamate spe-
cies (Bartholomew, 1953; Lofts, 1971; Courty, 1980).
One does find, however, a few studies on such reptiles
as turtles, for example: Chrysemys picta (Callard,
1976); Pelodiscus sinensis (Lofts and Tsui, 1977);
Chrysemys dorbigni (Silva, 1984). The authors of
those studies hold identical views that the testicular
structure and function of reptiles change in annual
cycle, and the epithelium of seminiferous tubule has
spermatogenetic ability in several months while in
other months it is in a static condition (Lofts, 1987).
The aquatic soft-shelled turtle, Pelodiscus sinen-
sis, lives in rivers, lakes and ponds. The available lit-
erature on its reproduction relates only to its gonads.
Hu Zeng-Gao (1988) reported that the testis of Pelo-
discus sinensis produced sperms in reproductive
period, which were used for copulation in same
period. Lofts and Tsui ( 1977) in Hong Kong reported
the results of their studies on the histological and his-
tochemical changes in the testis. They were of the
opinion that Pelodiscus sinensis has a postnuptial pat-
tern which the spermatozoa are produced soon after
mating period. The spermatozoa are stored in the epi-
didymal canals from October until their discharge in
the following April. Seasonal changes in size and his-
tology of the testis and the accessory sexual organs
(epididymis) are well known in a lot of reptile species
(Lofts, 1969; Courty, 1979), and correlated variations
in androgen levels are documented but still poorly
detailed.
It has been shown by metabolic conversion of pre-
cursors that testosterone is the principal androgen in
some reptiles as in mammals (Callard, 1967; Hews
and Kime, 1978; Courty, 1979). Seasonal changes in
the level of circulating testosterone have been
reported in a few species of reptiles but data tend to be
differ with different species (Bourne and Seamark.
1975; Callard, 1976; Silva, 1984). Some researchers
suggested that the spermatogenesis correlated with
the plasma testosterone levels in turtles (Kuchling.
1981; Silva, 1984). In other references we found that
the highest plasma testosterone levels did not appear
in spermatogenesis period, but in mating period (Cal-
lard, 1976). Lofts and Tsui (1977) considered that the
interstitial tissue was active in steroids synthesis dur-
ing mating period, but inactive during spermatogene-
sis period. The purpose of our study, therefore, was to
determine if the variations in the plasma testosterone
levels during the annual cycle in Pelodiscus sinensis
are correlated with histological variations of the ger-
minal epithelium and epididymal canals.
Vol. 8, p. 76
Asiatic Herpeiological Research
1999
Material and Methods
Animals and samples collection
The samples used in our experiments were provided
by Chang Zhou Breeding Center of Soft-Shelled Tur-
tle (near Nangjing in Jiangsu Province in east China).
The breeding environment was similar to their natural
living condition. Except December and January every
month we obtained blood plasma, testes and epid-
idymides that those were from six adult male soft-
shelled turtles, Pelodiscus sinensis (there body
weights were about 650-1000g) in one year. The
blood plasma samples were stored at -24° until the
testosterone analysis was performed. The tissue sam-
ples of testes and epididymides were weighted and
fixed in Bouin fluid.
Histological procedures
For the histological examination, a piece of testis and
a piece of epididymis (about 25mm" ) were fixed in
Bouin fluid for 24 hours. After discolored, the sam-
ples were embedded in paraffin, cut in 5um sections,
and then stained with haematoxylin and eosin.
Testosterone assay
We determined the plasma concentration of test-
osterone by radioimmunoassay (RIA) using a tech-
nique provided by WHO. The kits used in our
experiments were from Hua Mei Biological Engineer-
ing Co. (a Sino-US joint venture). Briefly, the hor-
mone was extracted from plasma samples (250-7501)
twice with 5 ml of anhydrous ether, with an average
recovery of 96%. The extract was dried at 40° by con-
stant temperature bath, and dissolved in 2 ml phos-
phate-buffered saline containing gelatin (GPBS). we
placed 0.5 ml of this solution in duplicate assay tubes
and incubated with radio labeled testosterone (H-T
10.000 cpm) and anti-testosterone antiserum (0.1 ml)
for 18-24 h at 4°C. After removing the unbound frac-
tion with dextran-coated chorale, the samples were
placed in scintillation fluid (TP-POPOP-toluene) and
the radioactivity (cpm) was detected on a liquid scin-
tillation counter. RIA data were analyzed with a pro-
gram utilizing a weighted logic-log regression
analysis on an IBM PC. All data are as the mean
±SEM.
Results
Weight and histology
The seasonal weight variations in testes and epid-
idymides of Pelodiscus sinensis are shown as unit
body weight in Figure 1. From March (shortly after
emergence from hibernation) to April, testicular
weights remained low (particularly in April). The
seminiferous tubules remained atrophied and sper-
matogenetically inactive. The germinal epithelium
contained Sertoli cells and spermatogonia only (Fig.
2A). In April there was a significant reduction (by
about 53.76%) in the epididymal weights as sperma-
tozoa were evacuated from the epididymal canals.
During May and June the epididymal weights
declined continuously (by about 19.65%, Fig. 1).
1
35 r
30
25
20
15
10
16
14
12
%
3
8-
s.
8
O
( month )
«
10 1
M
— "
m
6 J
Figure 1 . Seasonal variations in testis and epididymis weight in the soft-shelled turtle, Pelodiscus sinensis. Each point repre-
sents mean of six values.
1999
Asiatic Herpetological Research
Vol. 8, p. 77
Figure 2. Microscopic figures of testis in the soft-shelled turtle, Pelodiscus sinensis. A. The seminiferous tubules
contracted and contained Sertoli cells (St) and spermatogonia (Sg) in April 200. B.The germinal epithelium con-
tained dividing spermatogonia, spermatocytes and spermatids in May 200. C. Spermatozoa (S) were released
from germinal epithelium in June 132. D. The thickness of spermatogenetic epithelium increased but spermatozoa
decreased in July 132. E: Spermatozoa occluded the lumen of the seminiferous tubules in August132. F: The ger-
minal epithelium atrophied in February 200.
Spermatocytogenesis started from late April to early
May, and the spermatocyte layers increased progres-
sively in germinal epithelium. The testicular weights
began to increase in May. By the end of the month,
the germinal epithelium contained dividing sper-
matogonia, spermatocytes and a few spermatides (Fig.
2B). In June, spermatozoa were released from germi-
nal epithelium (Fig. 2C) without accompanying
apparent increase in epididymal weights. The active
spermatogonia division progressed until July. The
thickness of spermatogenetic epithelium increased
and the diameter of seminiferous tubules reached
Vol. 8, p. 78
Asiatic Herpetological Research
1999
T^mm
Figure 3. Microscopic figures of epididymis in the soft-
shelled turtle, Pelodiscus sinensis. A. There were great
amount of spermatozoa (S) in the ductus, The simple
columna was thin in March 200. B. The heights of epi-
thelial cells were at maximum, great amount of sper-
matozoa could be seen in the ductus in August 200.
maximum (Fig. 2D). By the end of August, when the
testicular weights were at their top values, a large
amount of spermatozoa gathered in the lumen of the
distended seminiferous tubules (Fig. 2E) and passed
into the epididymal canals with the epididymal
weights increasing rapidly.
In September, spermatogonia! division started to
decline with less frequent mitotic figures. The germi-
nal epithelium contained mainly spermatides and
spermatozoa. At that time, testicular weights began to
decrease. By the end of November, testis atrophied
highly. And there were only a few spermatozoa
remaining in the seminiferous tubules. During hiber-
nation, the testis remained atrophied, and the germinal
epithelium was composed of Sertoli cells as well as
spermatogonia only and was heavily lipoidal (Fig.
2F). Often, there were necrotic cells in the lumen of
the seminiferous tubules.
2500 -
2000 •
1000
500
Figure 4. Seasonal variations in plasma testosterone
concentration in soft-shelled turtle, Pelodiscus sinensis.
Each point represents mean SEM of six values
In the ductus of the epididymis, spermatozoa
could be recognized in great number in most months.
Although in March soon after emergence from hiber-
nation epididymal weights were high and their ductus
were full of numerous spermatozoa (Figs. 1, 3A).
Only in June (after mating period) were there mark-
edly less spermatozoa present in the ductus of the epi-
didymis. At this time the simple columnar epithelium
of epididymis became thin and the nuclei moved
toward the basal region of the cells. From the end of
July, we could see that the spermatozoa were trans-
ported form the testis into the ductus of epididymis,
and their epithelial cells increased their heights and
secretory granules in cytoplasm. In August, their
heights reached the maximum (Fig. 3B).
Plasma testosterone concentration
The variations of the plasma testosterone concentra-
tions are shown in Figure 4. In March and April
(spring), when the testis still remained atrophied, the
mean values of plasma testosterone concentration
started to rise from 160.87 pg/ml to 613.79 pg/ml.
After that, there was a fall in plasma testosterone con-
centrations which coincided with the progressive atro-
phy of the epididymides. The plasma content
remained relatively low in June, but rapidly increased
to the highest levels (2104.97 pg/ml) in July. It did not
drop significantly until September. After that, the
plasma values fell sharply to their baseline levels in
October. It could be seen that in an annual cycle of the
plasma testosterone concentration had two peaks. The
lower peak occurred during the spring and the higher
one was in summer. The higher peak coincided with
the maximal testicular weight and the hypertrophy of
the germinal epithelial cells as well as the full growth
of epithelial cells at the epididymal ductus.
1999
Asiatic Herpetological Research
Vol. 8, p. 79
Discussion
The present study has demonstrated that the sper-
matogenetic activity of germinal epithelium changes
with season in Pelodiscus sinensis. Resemhling that of
most turtles reported (Lofts, 1987), its spermatogene-
sis resumes relatively soon after the mating period, so
that advanced germinal stage is completed before the
onset of the colder winter months. Spermatozoa are
stored in the epididymal canals until the breeding sea-
son of next year. This result is consistent with that
reported by Lofts an Tsui (1977) in Pelodiscus sinen-
sis. We have to pointed out that spermatogenetic peak
that we observed is in July and August, which is
somewhat later than that observed by Lofts and Tsui.
We suggest that this discrepancy might be due to the
different temperatures and photoperiods at different
latitudes.
The measurement of plasma testosterone in the
male Pelodiscus sinensis indicates that an annual
increase in peripheral levels begins in spring after
emergence from hibernation period and is interrupted
from the end of May through June. In July and
August, the plasma testosterone rises to its maximum
level. This finding is identical to that in tortoise,
Testudo h. hermanni, reported by Kuchling ( 1981 ). In
fresh water turtle, Chrysemys picta, the highest levels
were in spring and the lowest were in summer, while
in autumn the testosterone levels increased signifi-
cantly (Callard, 1976). Although in Chrysemys dor-
higni there was only one peak of plasma testosterone
levels, the increase started in mating period and
reached the maximum value in autumn during the
principal period of spermatogenesis {Silva, 1984). It is
similar to that in Pelodiscus sinensis.
Lofts (1968) described lipid accumulation in the
interstitial cells of the testis in Pelodiscus sinensis
which occurred prior to regression of the cells them-
selves, this indicated the cessation of steroidogenesis.
Lofts and Tsui (1977) reported that they detected 3-
HSD (-3-hydroxy steroid deydrogenase) activity in
Pelodiscus sinensis. It showed that the interstitial cells
had a positive reaction for 3-HSD and were consider-
ably depleted of lipoidal droplets in the mating period
(March- April) and in the period of enhanced epididy-
mal weight (August-October), but in active spermato-
genesis period the interstitial cells were negative to
the tests. And they said that the seminiferous tubules
gave same histochemical feature of high testosterone
secretory activity at the onset of spermatogenesis. As
well known, the secretory activity of interstitial cells
coincides with the variations of plasma testosterone
levels, because the Leydig cells are the main origin of
the plasma testosterone. Therefore, there is a discrep-
ancy about the annual cycle of the secretory activity
of interstitial cells between the histochemical study
reported by Lofts and Tsui (1977) with the direct
determination of plasma testosterone levels in our
study. We also found that the seminiferous tubules
have the ability to secrete testosterone (unpublished
result).
In the turtle Chrysemys dorbigni and the tortoise
Testudo hermanni, the maximum value of plasma test-
osterone acts on the secondary sexual organs in
autumn, preparing them for the storage of spermato-
zoa which occurs in winter (Kuchling, 1981; Silva,
1984). This situation which can also be observed in
our study. The decline of plasma testosterone levels in
Pelodiscus sinensis in May and June is associated
with the decrease in epididymal weights and the atro-
phy of the epididymal epithelium. The epididymal
epithelial cells enlarge in July and August, when the
plasma levels are highest. They increase secretary
granules progressively. During this period, the epid-
idymal weights increase significantly accompanying
with the spermatogenesis. The spermatozoa are stored
and matured in the epididymis until the following
mating period.
In our study the seminiferous tubules are sper-
matogenetically inactive when the plasma testoster-
one increases in the mating period. However, when
plasma levels are low in May, the spermatogenesis
begins. It implied that the germinal epithelium is sen-
sitive to testosterone when environmental temperature
rises. Our conclusion is that the peripheral testoster-
one in Pelodiscus sinensis is more important to sup-
port reproductive behavior and stimulate the actions
of epididymis.
Acknowledgments
We wish to express our deep gratitude to Mr. Chang
Hue for assistance in our experiment. We are grateful
to Professor Ning-Zheng Sun and Mr. Shu-Yu Gu for
graphics technical assistance. This work was sup-
ported by a grant of Education Commission of Jingsu
Province, China.
Literature Cited
Bartholomew, G. A. (1953) The modification by tem-
perature of the photoperiodic control of gonadal
development in the lizard, Xantusia vigilis. Copeia,
1953:45-50.
Bourne. A. R., and R. F. Seamark (1975) Seasonal
changes in 1 7-hydroxysteroids in the plasma of a
Vol. 8, p. 80
Asiatic Herpetological Research
1999
male lizard (Tdiqua ntgosa). Comp. Biochem. Phys-
iol., 506:535-536.
Callard, I. P. (1967) Testicular steroid synthesis in the
snake Natrix sipedon pictiventris. J. Endocrinol.,
37: 105-106.
Callard, I. P., G. V. Callard, V. Lance, and S. Eccles
(1976) Seasonal changes in testicular structure and
function and the effects of gonadotropins in the fresh-
water turtle, Chrysemys picta. Gen. Comp. Endo-
crinol., 50:347-356.
Courty, Y., and J. P. Dufaure (1979) Levels of test-
osterone in the plasma and testis of the viviparous liz-
ard (Lacerta vivipara Jacquin) during the annual
cycle. Gen. Comp. Endocrinol. J9:336-342.
Courty, Y., and J. P. Dufaure (1980) Levels of test-
osterone, dihydrotestosterone and androstenedione in
the plasma and testis of a Lizard (Lacerta vivipara
Jacquin) during the annual cycle. Gen. Comp. Endo-
crinol., 42:325-333.
Hews, E. A., and D. E. Kime (1978) Testicular steroid
biosynthesis by the green lizard Lacerta viridis. Gen.
Comp. Endocrinol., 35:432-435.
Zeng-Gao Hu (1988) Studies on relationship between
blood sexual hormone and gonadal development in
soft-shelled turtle, Trionyx sinensis Wiegmann. J.
Anhui Normal University, 4:44-51.
Kuchling, G. R. Skolek-Winnisch, and E. Bamberg
(1981) Histochemical and biochemical investigation
on the annual cycle of testis, epididymis and plasma
testosterone of the tortoise, Testudo hermanii herma-
nii Gmelin. Gen. Comp. Endocrinol.. 44:194-201.
Licht, P. (1977) Evolution in the roles of gonadotro-
pins in the regulation of the tetrapad testis. In: Repro-
duction And Evolution. J. H. Calaby and C. H.
Tyndale-Biscoe, eds. Australian Academy of Science,
Canberra, pp. 101-110.
Lofts, B. (1968) Patterns of testicular activity. In: Per-
spectives In Endocrinology: Hormones In The Lives
Of Lower Vertebrates. E. J. W. Barrington and C. B.
Jorgensen, eds. Academic Press, New York and Lon-
don, pp. 239-404.
Lofts, B. (1969) Seasonal cycles in reptilian testes.
Gen. Comp. Endocrinol. Suppl., 2:147-155.
Lofts, B., and L. Y L. Choy (1971) Steroid synthesis
by the seminiferous tubules of the snake Naja naja.
Gen. Comp. Endocrinol., 17: 588-591.
Lofts, B., and H. W. Tsui (1977) Histological and his-
tochemical changes in the gonads and epididymides
of the male soft-shelled turtle, Trionyx sinensis. J.
Zool., Lond. /S7:57-68.
Lofts, B. (1987) Testicular function. In: Hormones
And Reproduction In Fishes, Amphibians, And Rep-
tiles. O. N. David and E. J. Richard, eds. Plemum
Press, New York and London, pp. 283-325.
Silva, A. M. R., G. S.Moraes, and G. E Wassermann
(1984) Seasonal variations of testicular morphology
and plasma levels of testosterone in the turtle Chryse-
mys dorbigni. Comp. Biochem. Physiol., 78-4:153-
157.
Yip, D. Y. and B. Lofts (1976) Adenohypophysial
cell-types in the pituitary gland of the soft-shelled tur-
tle, Trionyx sinensis. I. seasonal cycles. Cell Tiss.
Res., 770:523-537.
1999
Asiatic Herpetological Research
Vol. 8, p. 81
Food Consumption and Growth of Juvenile Chinese Soft-shelled Turtles
(Pelodiscus sinensis) in Relation to Body Weight and Water Temperature
CUIJUAN NlU, TlNGJUN ZHANG AND RUYONG SUN
Department of Biology. Beijing Normal University; Beijing 100875, China
Abstract.- Food consumption and growth of juvenile Chinese soft-shelled turtles {Pelodiscus sinensis) with
different body weight were measured in the laboratory at 22, 26, 28, 30, 32 and 35 °C. At 30 °C, the daily
maximum consumption Cmax (J/ind. • day) showed the following relationship with body weight W (g): Cmax =
47.58 W^ . The correlation between the maximum daily food consumption rate Rmax (J/g • day) of a turtle
with a standard body weight of 40 g, and temperature could be described as: logRmax = -0.01 36T2 + 0.8372T -
1 1.42. At ± 31 °C. a turtle with a standard body weight of 40 g has the biggest daily consumption rate of 447 J/g
• day. The daily growth rate GR (g/day) had a functional relationship with body weight at 30 °C: GR =
0.04 W0-8-48. For a turtle with a standard body weight of 40 g, GR showed the following relationship with water
temperature: GR = 30.138 - 3.671T + 0.147T2 " 0.002T3, and at 30 °C, turtles had the biggest daily growth rate
of 1.06 g/day. Gross conversion rate of the juvenile turtles (9-109 g) did not vary with body weight, but
temperature had a distinct effect on it.
Key words.- Reptilia, Testudines, Trionychidae, Pelodiscus, China, bioenergetics.
Introduction
The Chinese soft-shelled turtle (Pelodiscus sinensis)
is an aquatic chelonian of great commercial impor-
tance, widely distributed in China. Resource of this
species has decreased sharply in recent years. There-
fore, its aquaculture has become more and more
important. Basic information on the biology of P. sin-
ensis is very important in developing the technology
of its cultivation. Bioenergetics of this species is one
aspect that has not been well-studied yet (Niu et al.
1994). The purpose of this study was to investigate the
effects of body weight and water temperature on food
consumption and growth of juvenile soft-shelled tur-
tles.
Material and Methods
The experimental animals were juveniles with a live
weight ranging from 7 g to 1 12 g reared in the labora-
tory. The diet used in the experiment contained 50%
crude protein, 3% crude fat, 9.5% carbohydrate and
15% ash. Energy value of the diet was 14.64 KJ/g.
Rearing conditions
Each experimental animal was housed in a 4.6 1 glass
aquarium filled with clean tap water. 6-8 aquariums
were placed in a water bath with water temperature
controlled to an accuracy of ± 0.5 °C. The animals
were tested at six different temperatures (22, 26, 28,
30, 32 and 35 °C). The photoperiod was 12L:12D.
Turtles were fed to satiation twice a day at 8:00 and
16:00. Each turtle was acclimated at the test tempera-
ture for at least one week before the feeding experi-
ment started.
Experimental process
Before the start of the feeding experiment, turtles
were not offered food for 48 hours and weighted. In
the experiment, turtles were fed to satiation with a
pre-weighted amount of food. The uneaten portion
and feces were collected with a decompression con-
centrition equipment and dried with control diet at 65
°C to a constant weight. Food consumed by a turtle
was the difference between the dry weight of pre-
weighed amount of food and the uneaten portion. The
feeding regime lasted for a month followed by two
days of fasting. After the experiment, fresh weight
was measured again and some of the experimental
animals were sacrificed and dried to a constant weight
on 65 °C. Caloric value of the dried diets, feces, and
turtles were all measured with a Schimdzu CA-4P
caloric meter.
Data analysis
The daily maximum consumption, Cmax is an average
value during the whole experimental period. R^^ =
Cmax/W. W is the mean value of the initial and final
weight of the turtle. The daily growth rate in wet
Vol. 8, p. 82
Asiatic Herpelological Research 1 999
3.6
2.6-
oo
0.6
y = -0.01 36x2 + 0.8372X - 1 0.8 r2 = 0.83
• Standard value
° Measured value
20
— r~
30
— i
40
Temperature (°C)
Figure 1. Relationship between the daily maximum consumption rate. Rmax (J/g ■ day) of a turtle with a standard
body weight of 40 g (average value of all experimental animals) and water temperature.
weight, GR = (W, _ W0)/t, where W, and W0 is the
body weight at the end and the beginning of the
experiment, respectively, and t is the experimental
period. The gross conversion efficiency, CE — named
as the percent of energy used for body growth to con-
sumed energy — was calculated. All data were analy-
sed with SPSS/PC statistical software.
Results
Analysis of covariance showed that the maximum
food consumption of a turtle was greatly affected by
body weight and water temperature. Multiple regres-
sion analysis showed the following relationships
among the daily maximum consumption, Cmax (J/ind.-
day), wet body weight, W (g) and water temperature,
T (°C): logCmax = 0.73381ogW + 0.83541ogT -
0.0136T2 " 1 1.00; (r = 0.98, n = 45, P < 0.01). At 30
°C, Cmax (J/ind.- day) showed the following relation-
ship with body weight W (g): Cmax = 47.58W0-7907;
(r = 0.92, n = 30).
Figure 1 shows the relationship between the daily
maximum consumption rate, Rmax (J/g • day) of a tur-
tle with a standard body weight of 40 g (average value
of all experimental animals) and water temperature.
Their relationship could be described as: logRmax = -
0.0136T2 + 0.8372T - 1 1.42 (r = 0.83, n = 45). At ±
3 1 °C, a turtle with a standard body weight of 40 g has
the biggest daily food consumption rate of 447 J/g •
day. The daily growth rate, GR (g/day) also had a
close relationship with body weight and water tem-
perature, which could be showed as the following: GR
= 0.0165W + 0.9142T - 0.0156T2 " 13.16 (r = 0.89,
n = 45, P < 0.01).
Figure 2 shows the relationship between the daily
growth rate, GR (g/day) of a turtle with a standard
body weight of 40 g and water temperature. At 30 °C,
a turtle with a standard body weight of 40 g has the
biggest daily growth rate of 1.06 g/day. At 30 °C, GR
had a functional relationship with body weight as: GR
= 0.04W08248 (r = 0.78, n = 39). At five different
body weight groups ranging from 9-109 g, no distinct
differences were found among their gross conversion
efficiency, CE (F4,20 = 0.96, P > 0.05), but the tem-
perature had a distinct influence on CE (F5.20 = 4.21,
P < 0.01 ). At 22 °C, CE was about 59%. At 26-32 °C,
CE ranged from 21-27%. At 35 °C, CE declined to
12%.
Discussion
According to the present work, temperature has a pos-
itive effect on the daily maximum food consumption
and growth under 3 1 °C, but above 3 1 °C, the effect
becomes negative. Temperature for maximum growth
rate is slightly lower than the temperature for maxi-
mum food consumption. This phenomenon has also
been observed in similar studies of the lizards Uta
1999
Asiatic Herpetological Research
Vol. 8, p. 83
y = -0.0019x3 + 0.1469x2-3.6708x + 30.138 r' = 0.99
v2P
2
O
Temperature CC)
Figure 2. Relationship between the daily growth rate, GR (g/day) of a turtle with a standard body weight of 40 g
and water temperature.
stansburiana (Waldschmidt et al. 1986) and Takydro-
mus septentrionalis (Ji et al. 1993), and the southern
catfish (Silurus meridionalis) (Xie and Sun 1992).
This study indicates that effects of temperature on
food consumption and growth of soft-shelled turtles
resemble that of most fishes (Brett and Groves 1979)
and some lizards. More comparative studies should be
conducted for other reptile species.
The body weight has a double logarithm relation-
ship with Cmax, and the slope of the regression line is
0.79. This value is very similar to the exponent b
value 0.75 in the metabolic rate to body weight
regression line for turtles (Bennett and Dawson 1976).
This phenomenon suggests that food consumption is
related to metabolic rate of the turtle. As energy loss
through metabolism is a large component in the
energy budget, metabolism level may affect energy
intake to remain an effective budget. Studies on the
relationship of food consumption and metabolic rate
are recommended. Perhaps the maximum consump-
tion rate can be defined as an index of daily metabo-
lism level of the animals.
The gross conversion rate, CE is a reflection of the
consumed energy alloted to body growth. Our work
showed that under 109 g body weight, CE values of
the juvenile turtles were similar. Temperature has a
distinct effect on CE. The relatively high CE (59%) at
22 °C may be explained by the distinctly low meta-
bolic cost at a low temperature. From 26-32 °C, CE
was relatively similar, but declined at 35 °C. Smith et
al. (1981) found that for juvenile walleye pollock
(Theragra chalcogramma), CE was higher at colder
temperatures. Cui et al. (1995) showed that water tem-
perature had no effect on CE in the grass carp
(Ctenopharyngodon idella). Perhaps the relationship
of temperature with CE varies with different species.
In this work we present mathematical models
relating maximum food consumption and growth rate
to water temperature and body weight. The results can
be utilized for estimating daily amount of food needed
by juvenile turtles according to water temperature and
body weight in a turtle-culture farm.
Acknowledgments
We thank Mrs. Xihuang Cheng for her assistance in
the experiments. Thanks are due to Dr. Balazs Farkas
for improving the manuscript. We also thank Dr. Yibo
Cui for his valuable comments on the paper. The work
Vol. 8, p. 84
Asiatic Herpetological Research\999
was supported by the Chinese National Foundation of
Natural Science and the Foundation of State Key Lab-
oratory for Freshwater Ecology and Biotechnology of
China.
Literature Cited
Bennett, A.F. and W.R. Dawson 1976. Metabolism.
Pp. 127-223 //; C. Gans (ed.), Biology of the Rep-
tilia, Volume 5. Academic Press, London and New
York.
Brett, J.R. and T.D.D. Groves 1979. Physiological
energetics. Pp. 279-352 In W.S. Hoar et al. (eds.).
Fish Physiology, Volume 8. Academic Press, New
York.
Cui. Y, S. Chen and S. Wang 1995. Effect of tempera-
ture on the energy budget of the grass carp,
Ctenopharyngodon idellus Val. Oceanologia et Lim-
nologia Sinica 26:169-174.
Ji, X., W.H. Zhou, G.B. He and H.Q. Gu 1993. Food
intake, assimilation efficiency and growth of juvenile
lizards Takydromus septentrionalis. Comparative Bio-
chemistry and Physiology 105A:283-285.
Niu, C.J., T.J. Zhang and R.Y Sun 1994. Energy
metabolism of the soft-shelled turtle Trionyx sinensis
— Aquatic respiration, relative to body weight and
water temperature. Journal of Beijing Normal Univer-
sity 30:536-539.
Smith. R.L., A.J. Paul and J.M. Paul 1986. Effect of
food intake and temperature on growth and conver-
sion efficiency of juvenile walleye pollock (Theragra
chalcogramma): a laboratory study. Journal du Con-
seil international pour l'Exploration de la Mer
42:241-253.
Waldschmidt, S.R., S.M. Jones and W.P Porter 1986.
The effect of body temperature and feeding regime on
activity, passage time, and digestive coefficient in the
lizard Uta stansburiana. Physiological Zoology
59(3):376-383.
Xie, X.J. and R.Y. Sun 1992. Maximum ration level in
the southern catfish (Silurus meridionalis Chen) in
relation to body weight and temperature. Acta Ecolog-
ica Sinica 12(3):225-231.
1999
Asiatic Herpetological Research
Vol. 8, pp. 85-89
First Record of the Lacertid Acanthodactylus boskianus (Sauria: Lacertidae)
for Iran
Nasrullah Rastegar-Pouyani
Department of Zoology, Goteborg University. Box 463, SE 405 30 Goteborg, Sweden
Abstract.- The first record of the lacertid li/.ard Acanthodactylus boskianus for Iran is presented based on
material collected by the author in 1995 and 1996 from 2 km west of Harsin, Kermanshah province, western Iran,
on the Astragalus -covered sandy hills at about 1420 m elevation. Systematics and distribution of this lizard are
discussed and its conventional known subspecies are questioned.
Key words.- Acanthodactylus boskianus, Lacertidae, Subspecies,
province, Harsin, Systematics, Distribution.
New record. Western Iran, Kermanshah
Figurel . The distribution of Acanthodactylus boskianus in
north Africa and the Middle East.
Introduction
The lacertid genus Acanthodactylus Wiegman, 1834
consists of about 30 species, distributed from Spain
and Portugal across the Sahara desert and its periph-
ery to the Red Sea, over most of Arabia and as far
north as Cyprus and the Syrian-Turkish border; it also
extends through Iraq, southern, and eastern Iran,
southern Afghanistan. Pakistan and northwestern
India (Arnold, 1983).
Apart from the present record, four additional spe-
cies of this genus occur in Iran, mainly in southern
and eastern parts of the country (A. micropholis, A.
grandis, A. schmidti, and A. blanfordi) (Anderson,
1974; Anderson, in press; Salvador, 1982). As well,
A. opheodurus Arnold, may occur in lowland south-
western Iran (Anderson, in press). The genus is
Saharo-Sindian in its affinities and distribution and
does not penetrate to a great extent into the Iranian
Plateau and only two species go beyond the plateau as
far east as Afghanistan, Pakistan, and northwestern
India (A. cantoris and A. micropholis) (Clark, 1990;
Figure 2. The locality of Acanthodactylus boskianus spec-
imens collected by the author from Harsin, southeast
of Kermanshah Province, western Iran. (|) = Harsin,
(□) = Locality of A. boskianus specimens.
Salvador. 1982). This genus has recently been revised
by Salvador (1982) and Arnold (1983) who divide it
into 9 species groups. Among these groups is the "A.
boskianus and A. schreiberi "group defined by several
distinguishing characters (Arnold, 1983: 315).
So far, there is no record in the literature for the
occurrence of A. boskianus in Iran. In this paper, I
report this taxon for the first time inside Iranian terri-
tory based on three specimens (two adults and one
juvenile) collected from Kermanshah province, west-
ern Iran during my two long-term excursions on the
Iranian Plateau in 1995 and 1996.
Acanthodactylus boskianus (Daudin, 1802)
Lacerta boskiana Daudin, 1802, 3: 188, PI. 36, Fig.
2 (type locality: Egypt).
Bosc's fringe-toed lizard.
Vol. 8. p. 86
Asiatic Herpetological Research
1999
j&k*.
Figure 3. Acanthodactylus boskianus, top to bottom:
male, female, juvenile.
Definition: Usually 4 entire supraoculars, occasion-
ally the 1st divided; anterior border of ear pectinate;
temporal scales more or less keeled; eyelids slightly
denticulated; conspicuous gular told; 3 series of
scales around fingers; ventrals usually in 10 (and
sometimes 12) straight longitudinal rows; usually
large, keeled, imbricate dorsals (sometimes small,
slightly keeled and imbricate); granular scales on
flanks; moderate to strong fringe on 4th toe: upper
surface of tail with large, imbricate, sharply keeled
scales.
Distribution: A. boskianus is the most widespread
species of the genus and occupies a large area from
north Africa (Mauritania, Morocco, Algeria, Mali,
Niger, Tunisia, Libya, Chad, Nigeria, Sudan, Ethio-
pia, Egypt) eastward into the Middle East (Israel,
Lebanon, Jordan, Iraq, Syria, Turkey, and Arabian
peninsula) (Salvador, 1982). It is also reported for the
first time from Iran [(present paper) (Figs. 1-2)].
Collecting of A. boskianus specimens
I conducted two long-term excursions and field work
in various parts of the Iranian plateau in 1995 and
1996. On July 8, 1995, I surveyed the area around
Harsin, a small town in southeastern Kermanshah
province, western Iran to collect Trapelus ruderatus
and Laudakia nupta for ongoing research. In 2 km
west of Harsin (34° 17' N, 47° 24' E) on the sandy
hills covered by various species of Astragalus, I col-
lected a lacertid specimen incidentally. It was an adult
male of A. boskianus (GNHM Re. ex. 5142). I sur-
veyed this locality several times in 1995, but I could
not find more specimens of A. boskianus. Again, on
August 29, 1996, and during my second field trip to
Iran, I surveyed the same area and collected two other
specimens of A. boskianus, an adult female and a
juvenile (GNHM Re. ex. 5143-4) (Fig. 3). I collected
all specimens on an Astragalus -covered sandy hill.
£*:•<
Figure 4. Acanthodactylus boskianus on the top of an Astragalus bush, 2 km west of Harsin, Kermanshah Province,
western Iran.
1999
Asiatic Herpetological Research
Vol. 8. p. 87
among or under the Astragalus bushes. It seems that
they have acquired special adaptations for living
among and on the spiny bushes of Astragalus (Fig.
4).
Remarks
The three specimens which I collected 2 km west of
Harsin, Kermanshah province, western Iran, have the
general characteristics of most other A. boskianus
specimens except that the dorsal scales are relatively
small, as is the case in the Iraqi and Syrian popula-
tions. The main characteristics of these specimens are
as follows:
Maximum SVL (Snout-Vent Length) = 65.5 mm;
maximum TL (Tail Length) = 134 mm; scales across
mid-dorsal region 43-48: ventral plates in 10 longitu-
dinal rows with an extra row of smaller plates on each
side; four entire supraoculars; temporal region
slightly keeled, subocular does not reach the mouth
and is wedged between the 4th and 5th supralabial; 7
/ 7 upper and 7/7 lower labials; temporal scales fee-
bly keeled: anterior edge of tympanum feebly ser-
rated: feeble to moderate pectination of eyelids; 5/5
supraciliaries; 22-25 femoral pores; dorsal scales rela-
tively small and feebly keeled: 3 rows of scales
around fingers; 8-9 collar plates; distinct gular fold;
25-27 scales in a longitudinal row from symphysis of
chin shields to collar; 2 1-23 keeled lamellae under the
forth toe which is not exceptionally pectinate; ventral
plates in 25-30 transverse rows; 13-15 scales between
hindlegs; 25-26 scales on the 5th caudal whorl behind
the vent.
Coloration and color pattern: In the male speci-
men dorsum sandy grey with two light dorsolateral
stripes on each side enclosing a broad brown band
with light reticulations, also a weakly visible dark-
brown vertebral stripe present; base of tail with two
light lateral stripes, distal 4 / 5 of tail uniformly grey
dorsally, upper surface of limbs greyish-brown with
numerous light spots: upper surface of head olive-
brown; all of the ventral surfaces whitish.
In the female specimen dorsum is dark brown with
7 narrow, light stripes, the two dorsolateral ones on
each side being lighter and in strong contrast with the
dark-brown pattern of back, the three vertebral and
paravertebral ones duller, proximal 1/4 ventral part of
tail whitish, distal 3/4 pink or bright-red, other ventral
surfaces whitish.
In the juvenile specimen, upper surface of head is
light olive, dorsum dark-brownish-black with 6
strongly contrasting light lines, vertebral stripe whit-
ish on neck, disappears towards the posterior part of
back.
Systematic account
As pointed out before, Acanthodactylus boskianus is
the most widespread species of its genus. It occurs
throughout a wide range which is extended from north
Africa into the Middle East. It is a polytypic taxon
and very well represented in most museum collections
and shows obvious geographic variation in different
parts of its range. Traditionally, A. boskianus has
been divided into three subspecies; A. b. boskianus
(Daudin, 1802) in the Nile delta and some parts of
Sinai, A. b. euphraticus Boulenger 1919, from
Ramadieh (central Iraq), and A. b. asper (Audouin,
1829) which covers almost the whole of the species
range (Arnold, 1983; Boulenger, 1919, 1921; Salva-
dor, 1982).
Boulenger (1919, 1921) divided the populations of
A. boskianus into three varieties (subspecies):
The first subspecies, A.b. boskianus (forma typ-
ica), characterized by the lack of subocular contact
with the lip, the common division of the first supraoc-
ular, and the small and numerous dorsal scales (34-
52). The second subspecies, A. b. asper, characterized
by a subocular which does not border the lip, an undi-
vided first supraocular, and the large, relatively few
dorsal scales (23-38). And the third subspecies, which
I have examined the syntypes, A. b. euphraticus
(described based on 8 specimens collected at
Ramadieh on the Euphrates Front, central Iraq, in
1918 by Boulenger's son Capt. C. L. Boulenger), is
characterized by a subocular which is usually border-
ing the mouth (in 7 out of 8 specimens = 87.5%), 38-
43 scales across middle of body, 14-16 scales between
hind limbs, and 23-37 femoral pores on each side.
This simple tripartite division is not satisfactory,
for some of the supposedly distinctive features of A. b.
euphraticus are not consistent and there is some dif-
ferentiation within the populations assigned to A. b.
asper (Arnold, 1983).
As the separation or contact of subocular with the
lip is not a fixed character, it can not be considered of
taxonomic value. As well, scale counts which were
once thought typical for subspecies proved to be clinal
and are therefore not apt to discriminate subspecies
(Schleichetal., 1996).
On the other hand, Salvador (1982) divided vari-
ous populations of -4. boskianus into four groups;
north African populations, Egyptian populations, Ara-
bian populations, and Iraq, Syria, and Jordan popula-
tions. According to this author, the populations of
Vol. 8, p. 88
Asiatic Herpetological Research
1999
north Africa are relatively uniform, suggesting a
recent invasion to this region. There is a progressive
degree of variation towards the eastern part of the
range, in the Middle East. As the position of the sub-
ocular greatly varies in individuals throughout this
species entire area of distribution (this being espe-
cially so in Iraq), the taxonomic value of this charac-
ter is greatly reduced (Salvador, 1982). According to
Arnold ( 1983), over most of north Africa, the number
of dorsal scales in a transverse row at mid-body varies
from 26-41. I have examined specimens of A. boski-
anus from Sudan, Morocco, and Libya (see under
material examined). All of these specimens have 35-
37 scales across mid-body and, apparently, belong to
A. b. asper. As well, Arnold (1980) regards all popula-
tions of this lizard in the Arabian peninsula as A. b.
asper. In the Nile delta and north Sinai, populations
assigned to A. b. boskianus have high dorsal scale
counts (34-52). Populations with high dorsal counts
(38-48) also occur in northeast of Jordan, northern
and central Iraq, east Syria and adjoining Turkey. In
one specimen from Jordan (GNM.Re. ex. 4799)
which I have examined, there are 40-43 scales across
middle of dorsum. Arnold (1983) believes that geo-
graphic variation in A. boskianus reflects differences
in niche across its range. This species is often associ-
ated with dense vegetation and large dorsal scales
may well be protective when shrubs are rigid and
spiny. The fine-scaled populations occur in relatively
mesic areas where vegetation is less damaging than in
more arid regions. Reed and Marx ( 1959) reported A.
schreiberi, based on having numerous dorsal scales,
from Jarmu. Kirkuk Liwa. northern Iraq, in an iso-
lated area far from the nearest known localities for
this taxon in Lebanon. Salvador (1982) examined
these specimens and attributed them to A. boskianus.
Due to scarcity of material, the presence of A.
schreiberi in Iraq needs more confirmation. I have
studied three specimens of A. schreiberi
(GNM.Re.ex. 4646 [1-3]) from Cyprus. They have
51-59 small, rather granular, smooth, or weakly
keeled, scales across widest part of dorsum and 12
ventral plates across the widest part of venter. As well,
the temporal scales are smooth and the anterior edge
of tympanum is not serrated or very weakly so.
According to Khalaf (1959), both A. b. asper and A.
b. euphraticus occur in Iraq without specifying their
exact localities. Also. Leviton et al. ( 1992) regard A. b.
asper as the subspecies found in Iraq.
Based on the fore mentioned discussion, and with
respect to characteristics of specimens collected by
the author, it is evident that these specimens belong to
a form with fine and numerous dorsal scales which are
weakly keeled, intact first supraocular, and lack of
subocular contact with the mouth. These specimens
do not entirely fit into the Boulenger's tripartite key
(Boulenger, 1919, 1921 ). Since there is no more mate-
rial at hand, it may be difficult to say if they represent
the fourth form of A. boskianus or not. An adequate
intraspecific treatment of A. boskianus is beyond the
scope of this paper. Thus, I have chosen not to use a
subspecific name for my own material, pending a
thorough and knowledgeable revisionary work on this
widespread and polytypic taxon. In spite of the con-
siderable variation which occurs in A. boskianus, as
mentioned above, there is as yet no definitive evi-
dence that it consists of more than one species. It
appears that A. schreiberi has originated as an isolate
of A. boskianus (Arnold, 1983).
Material examined
Acanthodactylus boskianus (n = 3): GNHM. Re. ex.
5142-44, from Harsin (34° 17' N, 47° 24' E), Ker-
manshah province, western Iran.
Acanthodactylus boskianus euphraticus (n = 8):
BMNH 1946. 8. 4. 83-90, from Ramadieh, Iraq (33°
25'N,43° 17' E).
Acanthodactylus boskianus asper (n = 4): GNHM.
Re. ex. 3333, 3346, 4799, 4937, from Sudan,
Morocco, Libya, and Gaza respectively.
Acanthodactylus schreiberi (n = 3): GNHM. Re. ex.
4646 (1-3), from Cyprus.
Abbreviations
BMNH = British Museum (Natural History);
GNHM. Re. ex. = Gothenburg Natural History
Museum, Reptilia exotica.
Acknowledgements
I wish to thank Goran Nilson, for critically reviewing
of the manuscript as well as providing me Acantho-
dactylus boskianus and A. schreiberi specimens from
the collections of Gothenburg Natural History
Museum. I would like to thank Colin MacCarthy,
Department of Zoology, British Museum (Natural
History) for loan of syntypes of Acanthodactylus
boskianus euphraticus.
I am also grateful to S. C. Anderson, Biological
Science Department, University of the Pacific, Stock-
ton, California, for all of his recommendations,
encouragements, and sending informative literature,
especially his unpublished work concerning the Ira-
nian lacertids, as well as critically reviewing of this
paper.
1999
Asiatic Herpetological Research
Vol. 8, p. 89
Also, my special thanks go to the Razi University
Authorities (Kermanshah, Iran) and Ali Rassuli for
their unsparing helps during field work in western
Iran.
This work was partly supported by grants from the
Royal Swedish Academy of Sciences (Hiertza-Ret-
zius Fond), Anna Ahrenbergs and Wilhelm and Mar-
tina Lundgrens Foundations.
Literature Cited
Anderson, S. C. 1974. Preliminary key to the Turtles,
Lizards, and Amphisbaenians of Iran. Fieldiana: Zool.
65: 27-44.
Anderson, S. C. (In press). The lizards of Iran. Society
for the study of Amphibians and Reptiles.
Arnold, E. N. 1980. The Reptiles and Amphibians of
Dhofar, Southern Arabia. Pp. 295-307. In The Journal
of Oman Studies, Special Report No. 2.
Arnold. E. N. 1983. Osteology, genitalia and the
relationships of Acanthodactylus (Reptilia: Lac-
ertidae). Bull. Brit. Mus. Nat. Hist. Zool. Sen, Vol. 44,
No. 5.
Audouin, J. V. 1829. Explication sommaire des
planches de reptiles (supplement) publiees par Jules-
Cesar Savigny. Pp. 97-140. In Description de 1' Egypt
(second edition), Vol. 24. C. L. F. Panckoucke, Paris.
Boulcnger, G. A. 1919. On a new variety of Acantho-
dactylus boskianus Daudin, from the Euphrates. Pp.
459-460. In Ann. & Mag. Nat. Hist. Ser. 9, Vol. 3.
Boulcnger, G. A. 1 92 1 . Monograph of the Lacertidae.
Vol. 2, British Museum (Natural History), London.
Clark, R., 1990. A report on herpetological observa-
tions in Afghanistan. Brit. Herp. Soc. Bull., 33: 20-24.
Daudin, F. M. 1802. Histoire naturelle generale et par-
ticuliere des reptiles. Dufart, Paris.
Knalaf, K. T. 1959. Reptiles of Iraq, with some notes
on the Amphibians. Ar-Rabitta press, Baghdad, vii +
96 pp.
Leviton, A. E., S. C. Anderson., K. Adler., and S. A.
Minton. 1992. Handbook to Middle East Amphibians
and Reptiles. Society for the study of Amphibians and
Reptiles, vii + 252 pp.
Reed, C. A., and H. Marx. 1959. A herpetological col-
lection from northeastern Iraq. Trans. Acad. Sci. Kan-
sas 62: 91-122.
Salvador, A. 1982. A revision of the lizards of the
genus Acanthodactylus (Sauria: Lacertidae). Bonner
Zool. Monogr. No. 16.
Schleich, H. H., K. Werner, and K. Kabisch. 1996.
Amphibians and Reptiles of North Africa. Biology,
Systematics, Field Guide. Koeltz Scientific Books
Pub., pp. 378-381.
1999
Asiatic Herpetological Research
Vol. 8, pp. 90-101
Two New Subspecies of Trapelus agilis Complex (Sauria: Agamidae) From
Lowland Southwestern Iran and Southeastern Pakistan
Nasrullah Rastegar-Pouyani
Department of Zoology, Gbteborg University, Box 463, SE 405 30, Goteborg, Sweden, e-mail:
[email protected]
Abstract.- Based on conducting long-term excursions and carrying out extensive field work in various parts of the
Iranian Plateau and studying preserved (museum) material including the syntypes of Olivier's Agama agilis, and
paralectotypes of Boulenger's Agama isolepis, two new subspecies of the wide-ranging Asian ground agamid
Trapelus agilis complex are described from the lowland southwestern Iran and southeastern Pakistan (and
adjoining northwestern India) respectively. The former of the new subspecies has conventionally been considered
as belonging to T. a. agilis, and the latter to T. a. isolepis. They are distinguishable from the other subspecies of T.
agilis complex by having several distinctive morphological characteristics. The distinctiveness of both
subspecies is confirmed according to the author's previous extensive studies on this complex using uni- and
multivariate analyses of morphological characters. Both subspecies mainly occur as geographical isolates in the
periphery of the main range of the complex, and both have mainly been separated from the central continuum (=
T. a. agilis) by eco-geographical barriers and are almost entirely restricted in distribution to the lowlands, desert
and semi-desert regions with high annual temperature. A taxonomic and biogeographic account as well as a key
to subspecies of T. agilis complex are presented.
Key words.- Trapelus agilis complex, T a. khuzistanensis, T a. pakistanensis. New subspecies, Agamidae,
Lowland southwestern Iran, Southeastern Pakistan, Systematics, Distribution, Biogeography.
Introduction
The, taxonomically, controversial ground agamid
Trapelus agilis is a wide-ranging species complex dis-
tributed from extreme southwestern Iran (ca 31° N,
47° E) to eastern Kazakhstan and western China (ca
48° N, 83° E) (Fig. 1 ), encompassing numerous local
populations (Rastegar-Pouyani, 1998). Traditionally,
this complex has been divided into three subspecies;
Trapelus agilis agilis (Olivier, 1804), T. a. sanguino-
lentus (Pallas, 1814), and T a. isolepis (Boulenger,
1885) (e.g., Anderson, 1974: Welch, 1983; Wettstein,
1951). The latter two subspecies are sometimes
regarded as full species by some authors (e.g., Anan-
jeva, 1981; Ananjeva and Tsaruk, 1987: Boulenger.
1885; Moody, 1980; Nikolsky, 1915; Zhao and Adler,
1993). On the other hand, Anderson (in press) places
all different forms of T. agilis complex under the
inclusive name "agilis" and believes that without a
firm statistical ground, it is not advisable to divide the
complex into separate taxonomic entities.
In a series of studies, using uni-and multivariate
statistics, the author analysed geographic variation in
T. agilis complex, synonymized T. a. isolepis (Bou-
lenger) with T. a. agilis (Olivier), designated a new
type locality as "terra typica designata" (central Ira-
nian Plateau, about 1 10 km southeast of Esfahan city)
Figure 1 . Geographic distribution of Trapelus agilis
complex. (□) = 7erra typica designata (central Iranian
Plateau, about 1 10 km southeast of Esfahan city)
(Fig. 1 ), and showed that T. agilis complex consists of
four distinct taxonomic entities (subspecies) and that
the traditional tri-partite division of the complex, to a
great extent, does not portray the actual phenetic pat-
terns of geographic variation (Rastegar-Pouyani, in
press, unpublished manuscript). The four distinct sub-
species identified are as follows:
T. a. agilis (Olivier, 1804) is distributed in the
central Iranian Plateau, central and southern Afghani-
stan, and southwestern Pakistan. Populations of this
1999
Asiatic Herpetalogical Research
Vol. 8, p. 91
Figure 2. Trapelus agilis khuzistanensis, holotype
(GNHM Re. ex. 5424); A- dorsal view, B- ventral view.
Note that almost all dorsal scales are distinctly small
and only slightly keeled.
form (as the central core of the complex) are morpho-
logically most similar to the syntypes of Olivier's
Agama agilis.
T.a. sanguinolentus (Pallas, 1814) is the northern
representative of the complex, distributed over a wide
area from northeastern Iran into the Central Asian
countries as far east as western China (Anderson, in
press; Rastegar-Pouyani, 1998; Zhao and Adlcr,
1993). The two other taxa, described in this paper as
new subspecies, are geographically isolated, occur-
ring in the southwestern and southeastern margins of
the main range of T. agilis, and mainly separated from
the central continuum (7^ a. agilis) by eco-geographi-
cal barriers. Both new subspecies are morphologically
different from the syntypes of Olivier's Agama agilis
based on several distinguishing characters (Table 1 ).
Since the subspecific name "isolepis" has been
synonymized with "agilis" and is no longer available
(Rastegar-Pouyani, in press), new taxonomic names
are designated for these two new subspecies.
So, the main objective of this work is to describe
and introduce these two new taxonomic entities based
on the study of distinguishing morphological charac-
ters which make them recognizable from the other
subspecies of T. agilis complex.
Material and Methods
I conducted three long-term excursions and carried
out extensive field work in various parts of the Iranian
Plateau in 1995, 1996, and 1998, collected hundreds
of specimens of Trapelus agilis and noted the pattern
of adaptation of different populations to the local con-
ditions as well as presence of eco-geographical barri-
ers which have been involved in differentiation and
subsequent evolution of all subspecies of this com-
plex. Also I studied preserved materials including the
syntypes of Agama agilis Olivier. 1804 and paralecto-
types of Agama isolepis Boulenger, 1 885, borrowed
from various museum collections around the world
(see under "Appendix I, Abbreviations, and Acknowl-
edgments").
In my previous studies, based on examination of
about 1000 specimens of T. agilis all over the range, I
employed uni-and multivariate statistical techniques
and explored the patterns of geographic variation in
morphological characters within this complex (Raste-
gar-Pouyani, in press, unpublished manuscript).
Indeed, the present paper is the continuation (and
part of the results) of my previous studies concerning
taxonomy and geographic variation in T. agilis com-
plex according to which both the lowland southwest-
ern Iranian as well as southeastern Pakistani
populations do warrant taxonomic recognition.
Subspecies accounts
Trapelus agilis khuzistanensis ssp. nov.1
(Figs. 2-6)
Khuzistan Ground Agama
Holotype and type locality: adult female, GNHM
Re. ex. 5224, collected by the author on 27 July 1996
from Iran, Khuzistan Province, 5 km northwest of
Haft-Gel on the road to Shushtar.
Paratypes: 14 specimens (ten males and four
females) have been designated as paratypes as fol-
lows: GNHM. Re. ex. 5225, same information as the
holotype: GNHM. Re. ex. 5226, collected by the
author on July 28, 1996 from Iran, Khuzistan Prov-
ince, 38 km south of Masjid-e-Suleiman, Golgir vil-
lage; CAS 86342, 86346, 86390, Iran, Khuzistan
Province, Tul-i-Bazum [31° 55' N, 49° 25' E], about
500 m elevation, collected by S. C. Anderson on 17
April and 22 May 1958; CAS 86403-6, Iran,
Khuzistan Province, along road to lake east of Haft-
Gel, about 300 m elevation, collected by S. C. Ander-
son on 23 May 1958; CAS 86418-19, Iran, Khuzistan
Province, along road between Haft-Gel and Masjid-
Suleiman, by S. C. Anderson on 23 May 1958: CAS
86556. Iran, Khuzistan Province, Haft-Gel (on golf
course) [31° 28' N, 49° 30' E], about 300 m elevation,
by S. C. Anderson on 5 October 1958; CAS 86464,
Iran, Khuzistan Province, along road south of Shush-
tar, by S. C. Anderson on 18 July 1958; FMNH
170936, Iran. Khuzistan Province, 85 km southeast of
Vol. 8. p. 92
Asiatic Herpetological Research
1999
Tablel . legend. Main morphological differences between T. a. khuzistanensis, T. a. pakistanensis, and the Olivier's
syntypes (T.a. agilis).
Ahwaz, Meshrageh, collected by D. Womochel and A
De Blase on 20 October 1968.
Diagnosis: Trapelus agilis khuzistanensis differs from
all other subspecies of T. agilis in its higher number of
scales around body (80-97); subequal and almost het-
erogeneous dorsal scalation with distinctly small dor-
sals and ventrals; a shorter head and neck:
significantly lower mean number of subdigital lamel-
lae under the fourth toe; reverse imbrication of the
posterior head and anterior neck scales; keeled or rug-
ose upper head scales; usually one, and sometimes
two rows of callose preanal scales (absent or slightly
developed in females); strongly compressed tail in
males of most populations; and an exclusive dorsal
coloration (yellowish-grey-cream with weak or with-
out reddish-brown cross bars).
Description of holotype: an adult female, preserved
in 70% ethyl alcohol in good condition; head short but
longer than broad with very convex forehead, its
length 0.26 of body length and 0.19 of tail length;
canthus rostralis more or less continued as a supracili-
ary ridge; nostril on, or, barely, above the canthus,
pierced in a flat shield and posteriorly directed; 3
internasals in a transverse row; upper head scales het-
erogeneous, keeled or rugose, imbricate and subim-
bricate; supraciliary ridge strongly developed,
composed of 9 scales on each side; 17-18 upper- and
Figure 3. T. a. khuzistanensis, holotype (GNHM Re. ex.
5424); neck and head regions with reversally-imbri-
cated scales.
17-17 lower labials; tympanum horizontally elliptical,
smaller than orbit, partly covered above by 4-5 small
spinose scales; scales of posterior part of head and
anterior part of neck distinctive in that their imbrica-
tion is reversed (i.e., towards the head) and the poste-
rior border of reversally-imbricated scales is defined
by a single large and pointed scale; gular pouch mod-
erately developed; gular region covered by small,
imbricate, slightly keeled or smooth scales; gular fold
and a fold in front of shoulder strongly developed;
body and head moderately depressed; limbs rather
slender; dorsal scales subequal to unequal, small,
imbricate, slightly keeled and mucronate; median dor-
1999
Asiatic Herpetological Research
Vol. 8, p. 93
Figure 4. T. a. khuzistanensis, one of the male
paratypes (FMNH 170936). Note the presence of a
strongly compressed tail and relatively heterogeneous
dorsal scalation.
Figure 6. Habitat and type locality of T. a. khuzistanen-
sis, 5 km northwest of Haft- Gel on the road to Shush-
tar, Khuzistan province, southwestern Iran. In the
foreground the author is attempting to capture the holo-
type from inside of its underground hole.
sals relatively larger, grading into distinctly smaller
scales of dorsolateral region which are only slightly
keeled and mucronate; 94-95 scales round middle of
body; scales of upper surface of limbs larger than
median dorsals, distinctly keeled, slightly mucronate:
lower surface of digits covered by bi-or tri carinate
lamellae, 18-19 under the fourth toe; ventral scales
almost as large as median dorsals, imbricate, very
slightly keeled or smooth, 84-85 scales in a single row
from gular fold to the anterior edge of anus; callose
preanal scales in one row, slightly developed, consist-
ing 10 scales; caudal scales larger than median dor-
sals, strongly keeled, distinctly mucronate, 34-36
around base of tail just behind vent; tail weakly com-
pressed at base, distinctly so towards the tip, its length
1 .39 of body length.
Coloration and color pattern: upper surface of head
and limbs uniformly yellowish-grey, ground color of
dorsum yellowish-grey-cream with 5 large, broad,
light-brown cross bars from nape to sacrum, inter-
rupted by a series of light, large vertebral ocelli and
Figure 5. T. a. khuzistanensis, posterior ventral region
of a male paratype (GNHM. Re. ex. 5426) with one row
of callose preanal scales.
two paravertebral rows of smaller ones, proximal
upper caudal region with distinct dark-grey bars; ven-
tral surfaces uniformly whitish.
Measurements (mm): Total length = 206; Snout-vent
length (SVL) = 86: Tail length (TL) = 120; Head
length (HL) = 23; Head width (HW) = 19; Head depth
(HD) = 12.8; Length of forelimb = 45; Length of
hindlimb = 62.
Variation of the type series: all paratypes closely
approximate the holotype both in morphology and
meristics.
The range of the number of scales around body for the
whole series (n = 14) is 82-97 and the mean 88.5; in
all paratypes the number of subdigital lamellae under
the fourth toe varies between 16-19; dorsal scales are
subequal or heterogeneous (especially in males); there
are some differences, however, between male and
female paratypes.
- Male paratypes: all male paratypes (n = 10) are
either uniformly yellowish-grey-cream dorsally or
with a weakly developed pattern of dark cross bars; as
well, the ventral pattern is either uniformly whitish or
with distinct pattern of bluish-brown on the gular
region, chest and flanks; tail strongly compressed in
almost all males; preanal callose scales in one or two
rows, in the latter case the second row weakly devel-
oped, their number varies from 10-21; dorsal scales
more keeled and mucronate and distinctly heteroge-
neous, approaching T. persicus in this respect; ven-
trals weakly keeled, gular sac distinctly developed;
reverse imbrication of the posterior head and anterior
neck scales relatively more pronounced and the large
scale on posterior end of these reversally-imbricated
scales more distinctive and mucronate than in
females.
- Female paratypes: all female paratypes (n = 4)
resemble the holotype in almost all pertinent details;
the preanal pores are only in one row. weakly devel-
Vol. 8, p. 94
Asiatic Herpetological Research
1999
Figure 7. Geographic distribution of T. a. khuzistanen-
sis (A) and T. a. pakistanensis (B). Squares represent
the type localities.
oped, each occupying the tip of a scale, their number
varies from 8 to 11; all the dorsal scales weakly
keeled and mucronate; tail round or weakly com-
pressed; slight differences in dorsal pattern occur (in
some specimens the dorsal cross bars are more
intense).
Habitat: in lowland southwestern Iran and in the
western foothills of the Zagros Mountains, this sub-
species mainly occurs on sand dunes, alluvial soils,
open plains, low hills, and on dry stream channels
(Anderson, 1966a, in press: personal observations).
The type locality is specified by numerous low sand
dunes as well as gypseous hills imminented with an
open plain. The vegetation is sparse, mainly Artemi-
sia, Alhagi, Zygophylluni, and Euphorbia association.
The climate conditions being harsh, with hot and long
summers (about 40°- 50°C) and mild, short winters. It
seems that this lizard is active throughout the year but
Anderson first observed it in the western foothills of
the Zagros in early March, becoming numerous by
mid-April; both newly hatched and half-grown juve-
niles were observed in late October and early Novem-
ber (Anderson, 1963: 446).
The holotype and one of the paratypes were collected
about 5 km northwest of Haft-Gel on the road to
Shushtar. They were active when air temperature was
45°C and the substrate was 49.5°C. When alarmed,
unlike most of the central Plateau populations which
usually retreat into the base of dense bushes, they
retreated into the underground holes; this may be due
to vegetation scarcity. Both specimens were captured
inside their underground holes (Fig. 6). The third
specimen collected near the mouth of an old well in
the vicinity of the village of Golgir (38 km south of
Masjid-e-Suleiman) while trying to retreat into the
well.
Distribution: the main distributional range of this
subspecies is the Khuzistan Plain which is an exten-
sion of the Mesopotamian lowlands (Fig. 7). Also, it
penetrates into the western foothills of the Zagros
Mountains up to 900 m elevation. It is the western-
most representative of the wide-ranging T. agilis spe-
cies complex. The Zagros Mountains serve as an
strong barrier to its further eastward distribution, so it
has almost no contact with the central Iranian Plateau
nominal subspecies (T. a. agilis), except in the south-
eastern regions of Bushehr province, southern Iran
where the two taxa occur as parapatric (Rastegar-
Pouyani, Manuscript, a). Its occurrence in the lowland
southeastern Iraq is almost unlikely and, so far, there
is no proper record inside the Iraqi territory [except
the Olivier's original record (1804) which is strongly
doubtful]. If it occurs in southeastern lowland regions
of Iraq, then the Tigris might have served as an effec-
tive barrier to its further westward distribution.
In some areas of lowland southwestern Iran (e.g., 85
km southeast of Ahvaz) it occurs as sympatric with
Trapelus persicus (Blanford, 1881) but there is no
proper record of intergradation, if any, between the
two taxa.
Etymology: Trapelus agilis khuzistanensis is so
named as it is mainly restricted in distribution to the
lowlands of southwestern Iran, Khuzistan province.
Trapelus agilis pakistanensis ssp. nov.2
(Figs. 8-9)
Pakistan Ground Agama
Holotype and type locality: adult male, SMF 63258,
collected by M. G. Konieczny on 31 March 1957 from
Gaj-River, Kirthar Range, southeastern Pakistan.
Paratypes (7 specimens): SMF 63259, 63279, same
information as the holotype; SMF 63256, collected by
R. Mertens on 1st December 1952 from Sonda, Distr.
Thatta, southeastern Pakistan; SMF 63243-4, 63286-
7, collected by M. G. Konieczny on 26 April 1961
from Old Airport of Karachi, southeastern Pakistan.
Diagnosis: Trapelus agilis pakistanensis differs from
the other subspecies of T. agilis complex by having a
combination of distinctive characters; body and head
sometimes compressed (not depressed) in males;
males almost always with one row of callose preanals
(rarely a second undeveloped row may be present);
females without callose preanals: dorsal scales rela-
tively flat, subequal to homogeneous, distinctly keeled
throughout and mucronate, grading into small dorso-
laterals rather abruptly (especially in males), 67-83
around body; ventral scales also often distinctly
keeled in males; body and limbs often strongly slen-
der and head distinctly pointed (in adult males); tail
1999
Asiatic Herpetological Research
Vol. 8, p. 95
Figure 8. T. a. pakistanensis, holotype (SMF 63258); A-
dorsal region, B- ventral region. Note the presence of a
strongly compressed tail, and pointed and slender
body and head.
often strongly compressed in adult males, its length
more than 1.55 of body length; the mean number of
supra- and infralabials significantly lower than those
of the other subspecies; a rudimentary nuchal crest
often present.
Description of holotype: an adult male, preserved in
70% ethyl alcohol in good condition; head pointed
with a slightly convex forehead, its length 1.36 of its
width and 0.27 of body length and 0.15 of tail length;
canthus rostralis continued as a supraciliary ridge
which is rather strongly developed, composed of 7
scales on each side; nostril as a horizontal slit, slightly
above canthus rostralis, pierced in a triangle-shaped
scale, posteriorly directed; 4 internasals in a single
transverse row; upper head scales subequal. smooth,
or slightly rugose, imbricate and subimbricate; 14-14
upper- and 13-13 lower labials; tympanum horizon-
tally elliptical, smaller than orbit, partly covered
above by 6-8 spinose scales; no reversal imbrication
of scales on the posterior part of head and anterior
part of neck; a rudimentary nuchal crest composed of
6-7 spinose scales; gular sac moderately developed
and rather pointed posteriorly; gular region covered
by large and small, imbricate, and slightly keeled
scales intermixed: gular fold and a fold in front of
shoulder strongly developed; body slender and dis-
tinctly compressed laterally, a prominent vertebral
ridge throughout the dorsum; limbs distinctly slender;
dorsal scales subequal to homogeneous, rather large,
Figure 9. T. a. pakistanensis, holotype (SMF 63258);
posterior ventral region. Note the presence of only one
row of callose preanal scales and distinctly slender
hindlimbs.
imbricate, almost entire individual scale distinctly
keeled (unlike the eastern populations of T. a. agilis in
which only the proximal part of scales are keeled) and
mucronate; median dorsals larger, grading into dis-
tinctly smaller scales of dorso-lateral region which are
only slightly keeled and mucronate; 72-73 scales
round the widest part of body: ventral scales rather
distinctly keeled, imbricate, large, but slightly smaller
than median dorsals, 70-71 in a single longitudinal
row from gular fold to the anterior edge of anus;
scales of upper surface of limbs almost as large as
median dorsals, strongly keeled and mucronate; lower
surface of digits covered by bi- and tri-carinate keeled
lamellae, 24-25 under the fourth toe; preanal callose
scales only in one row, not exceptionally developed,
encompassing 8 scales; all caudal scales distinctly
keeled and larger than median dorsals, 33-35 around
base of tail, just behind the vent; tail long and strongly
compressed throughout, its length 1.81 times of body
length.
Coloration and color pattern: upper surface of head
yellowish-grey; dorsum uniformly sandy-grey with
numerous light scales scattered throughout; upper sur-
faces of limbs olive-brown; upper caudal region as
dorsum in coloration with barely distinct dark-brown
rings; gular region, chest, and flanks heavily suffused
by lavender-blue; other ventral surfaces yellowish-
white; no black patch on the shoulder fold.
Measurements (mm): Snout- vent length (SVL) =
101.6, Tail length (TL) = 184, Head length (HL) =
28.2, Head width (HW) = 20.7, Head depth (HD) =
13.5, Length of forelimb = 50, Length of hindlimb =
73.
Variation of the type series: all paratypes are similar
to the holotype both in morphology and meristics. In
all specimens nostril is almost above the canthus ros-
tralis and a rudimentary nuchal crest, more or less,
Vol. 8, p. 96
Asiatic Herpetological Research
1999
developed. The range of scale counts around body for
the whole series (n = 7) is 69-81 (mean 74.42). The
range of ventral scales from gular fold to the anterior
edge of anus (in a single longitudinal row) varies from
67-77 (mean 74.57). In all paratypes the number of
subdigital lamellae under the fourth toe varies from
22-26 (mean 23.85). The number of supra-and infra
labials varies from 13-16 (mean 14.55) and 12-16
(mean 14.25) respectively. Dorsal scales being homo-
geneous or subequal and, more or less, set off from
the small dorsolaterals.
However, there are some differences in morphology
between males and females:
- Male paratypes: all male paratypes (n =4) resemble
the holotype in almost all relevant details; the mean
SVL = 90.5 mm, TL = 155 mm; mean TL 1.71 times
as mean SVL; the preanal callose scales almost only
in one row (in the case of two, the second row rarely
developed), encompassing 10-11 scales (mean 10.4);
median dorsal scales enlarged, homogeneous, dis-
tinctly keeled throughout and mucronate, forming dis-
tinct ridges along dorsum, grading, rather abruptly,
into small dorsolaterals which are weakly keeled and
mucronate; all ventral scales, as in holotype, more or
less keeled, rather large, but smaller than median dor-
sals; tail strongly keeled in almost all specimens,
although body not as strongly compressed and
pointed as in the holotype; color pattern almost as in
holotype.
- Female paratypes: in females (n = 3), the body and
tail are normal (neither distinctly compressed nor
slender), the dorsal scales are moderately keeled and
mucronate and median dorsals are not clearly set off
from the small dorsolaterals; as well, ventrals are
slightly keeled and distinctly smaller than the median
dorsals; callose preanal scales absent; gular sac not as
well developed as in the holotype; in color pattern
some of them are rather different from the holotype in
the presence of, more or less pronounced, dark cross
bars and a series of vertebral light ocelli and in the
absence of ornamentation in the lower parts of body;
ventral surfaces being uniformly whitish.
Habitat: the habitat of this subspecies is character-
ised by flat alluvial plains as well as some high slopes.
The vegetation consists of some grass, herbs, and
stunted shrubs. Some populations occur on the low-
lands around Karachi, and the eastern part of the
range is a typical desert known as Thar Desert in east-
em Sind extending into adjacent northwestern India
(the great Indian Desert). This desert mainly consists
of sandy hills which vary from small dunes to hills
with 100-150 m elevation. In summer, dust storms are
the main feature of the area (Khan, 1980).
Distribution: Trapelus agilis pakistanensis, as the
southeasternmost subspecies of T. agilis complex, is
restricted in distribution to the lowland and semi-
desert regions of Sind province, southern Punjab, and
some regions of eastern Baluchistan (southern and
southeastern Pakistan), from around Hab River in the
west through Karachi and Thatta to the vicinity of
Hyderabad and Mirpur Khas eastward into the Indian
Desert (Fig. 7). Biswas and Sanyal (1977) recorded
this lizard inside the Indian territory (from Jaisalmir,
Kolayat, Pugal, Phalodi and some other localities in
Rajastan Desert, northwestern India); to the north, it is
distributed along the Kirthar Range up to the areas
south of Khuzdar (south-central Pakistan). Apparently
the Hab River serves as a barrier for further distribu-
tion of this taxon towards the west; however it is para-
patric with its T. a. agilis in the eastern regions of
Baluchistan province. In the east, it goes up to the
Nagaur District, Rajasthan, northwestern India.
Etymology: Trapelus agilis pakistanensis is so named
as it is restricted in distribution to the lowland and
semi-desert regions of southeastern Pakistan and adja-
cent northwestern India.
Taxonomic and biogeographic account
Detailed discussion concerning systematics and pat-
terns of geographic variation in Trapelus agilis com-
plex is presented elsewhere (Rastegar-Pouyani,
Manuscript a-b) and here is not dealt with in details.
As a brief account, however, it can be mentioned that I
classified all populations of Trapelus agilis complex
throughout the range into four distinctive taxonomic
entities (and as the most parsimonious definition=
subspecies): T. a. agilis (Olivier, 1804), T. a. san-
guinolentus (Pallas, 1814), T a. khuzistanensis
ssp.nov. 1 , and T. a. pakistanensis ssp.nov.2.
An ANOVA-based pairwise comparison showed
that in most metric and meristic characters these four
taxonomic entities are significantly different (P<0.05)
(Rastegar-Pouyani, Manuscript, a). Also employing
multivariate statistical techniques (principal compo-
nent analysis, canonical variate analysis, and cluster
analysis), to a great extent, showed the objectivity of
these four distinct groups within T agilis complex and
re -confirmed my previous taxonomic decisions (Ras-
tegar-Pouyani, Manuscript, b). Of the four subspecies
of T. agilis, the nominal form (T. a. agilis) occurs in a
wide range of habitats, shows higher degree of mor-
phological variability, occupies the central and south-
ern parts of the species range (these regions might
have served as a refugia during intervals of unfavor-
able and cold climatic conditions in the Tertiary and
Quaternary), and consists of two western and eastern
1999
Asiatic Herpetological Research
Vol. 8, p. 97
groups of populations (clines) (Rastcgar-Pouyani, in
press, unpublished manuseript). With regard to these
factors, it could be logical if we consider this form as
the central core of the complex and as the parental
population from which the other subspecies have been
derived. So, preliminarily, I propose the following
scenario for origination and subsequent evolution of
the three marginal subspecies which occur in the
periphery of the main range of the complex being
parapatric with the central continuum (=T. a. agilis):
It seems that T. a. sanguinolentus, in spite of being
distributed over a very wide area, is the most recently-
evolved group, originated from the parental popula-
tions in the southern parts of the range (apparently) in
the very Late Pliocene and Pleistocene (2-1.2 MYBP
=millions of years before present), invading towards
the northern and northeastern regions during intervals
of favorable climatic periods. The very low degree of
variability observed in this subspecies is indicative of
its recent history. Trapelus a. pakistanensis separated
from the central continuum in the southeastern parts
of the range (probably by dispersal or, less likely, due
to a vicariant event) distributed towards the east and
reached as far east as northwestern Indian desert. This
invasion might have taken place in the Pliocene (5-1.7
MYBP). In the southwestern part of the range, a dras-
tic vicariant event (the huge orogeny of the Zagros)
separated the southwesternmost populations from rest
of the complex and from the parental populations.
These isolated populations served as founders and,
with further divergence, gave rise to T. a. khusistanen-
sis. Apparently, this vicariant event has taken place in
the Late Miocene or early Pliocene (7-4.5 MYBP).
Therefore, we can say that both dispersal and vicari-
ance have been involved in radiation and subsequent
evolution of various subspecies of Trapelus agilis
complex though the role of dispersal in evolution of T.
a. sanguinolentus and T. a. pakistanensis, and vicari-
ance in evolution of T. a. khuzistanensis are more
prominent.
Trapelus agilis (Olivier, 1804) is the easternmost
representative of an essentially homogeneous and
similar group of about five species complexes which
also include T persicus (Blanford, 1881 ) in the Meso-
potamian Plain and lowland southwestern Iran, T. fla-
vimaculatus Riippell, 1835 in Saudi Arabia, T
savignii (Dumeril and Bibron, 1837) in Israel and
eastern Egypt, and T. tumevillei (Lataste, 1880) in
north Africa (north of Sahara). Although the mono-
phyly of Trapelus has been shown by Moody (1980)
with a morphological approach and by Joger (1991 )
using molecules (neither Moody nor Joger studied all
the species of Trapelus) but, so far, no comprehensive
revisionary study has been done on all species of this
genus and this is mainly because of political instabil-
ity of the region and difficulties in collecting proper
material throughout the range. Furthermore, even in a
few studies done on a limited number of Trapelus spe-
cies, the results obtained by morphological and the
other approaches (e.g., immunological) were contra-
dictory (e.g., Anderson, in press; Joger and Arano,
1987; Rastegar-Pouyani, in press, unpublished manu-
script).
Trapelus is mainly Saharo-Sindian in distribution,
often associated to the lowlands, desert, and semi-
desert regions with high annual temperature.
Key to the subspecies of Trapelus agilis com-
plex
la. Tail almost always round, two (or more) rows of
callose preanal scales 2
lb. Tail often compressed, often only one row of cal-
lose preanal scales, in the case of two, the second
undeveloped (preanals absent or weakly developed in
females) 3
2a. Body size variable; 65-91 scales around body;
dorsal scales subequal, weakly to moderately keeled,
often strongly mucronate; ventral scales smooth or
weakly keeled; usually 2, sometimes 3 (rarely 4-5)
rows of callose preanals; background coloration vari-
able; central Iranian Plateau, central and southern
Afghanistan, southwestern Pakistan. . Trapelus agilis
agilis (Olivier, 1804).
2b. Body stout; 52-73 scales around body; all dorsal,
ventral, and gular scales larger in size, homogeneous,
strongly keeled and mucronate; almost always 2
(rarely 3) rows of callose preanals; background color-
ation of males often dark sandy-grey; northeastern
Iran, northern Afghanistan, Central Asian Republics,
western coast of the Caspian Sea (Daghestan), west-
ern China. . . . Trapelus agilis sanguinolentus (Pallas,
1814).
3a. Body and limbs smaller than those of the other
subspecies and sometimes relatively slender, not com-
pressed; head and neck distinctly short; all body
scales smaller than those of the other subspecies; dor-
sal scales subequal to unequal (heterogeneous),
weakly to moderately keeled, weakly mucronate; 80-
97 scales around body; ventral scales slightly keeled;
scales of posterior part of head and anterior part of
neck reversally imbricated; upper head scales keeled
or rugose; often 14-19 upper- and lower labials; back-
ground coloration often yellowish grey-cream; low-
land southwestern Iran (0-900 m elevation)
Trapelus agilis khuzistanensis, ssp. nov. 1
Vol. 8, p. 98
Asiatic Herpetological Research
1999
3b. Body and limbs often distinctly slender, some-
times compressed in males; dorsal scales subequal to
homogeneous, distinctly keeled and mucronate, usu-
ally clearly set off from small dorsolaterals; 67-83
scales around body; ventrals distinctly keeled in adult
males; no reversal imbrication of head and neck
scales; upper head scales often smooth; 12-16 upper-
and lower labials; background coloration often sandy-
grey: southeastern Pakistan and adjoining northwest-
em India . . . Trapelus agilis pakistanensis, ssp. nov.2
Abbreviations
BMNH = British Museum (Natural History; (London,
UK), CAS = California Academy of Sciences (San
Francisco, USA), FMNH = Field Museum of Natural
History (Chicago, USA), GNHM = Goteborg Natural
History Museum (Goteborg. Sweden), MNHN =
Museum National d'Histoire Naturelle (Paris,
France), MZLS = Museo Zoologico de "La Specola"
(Firenze, Italy), NMW = Naturhistorisches Museum
Wien (Vienna, Austria). SMF = Museum und Fors-
chungsinstitut Senckenberg (Frankfurt, Germany),
SMNH = Swedish Museum of Natural History
(Stockholm, Sweden), ZFMK = Zoologisches Fors-
chungsinstitut und Museum Alexander Koenig (Bonn,
Germany); ZISP = Zoological Institute St. Petersburg
(St. Petersburg, Russia), ZMUC = Zoological
Museum University of Copenhagen (Copenhagen,
Denmark).
Acknowledgments
I would like to thank my supervisor. Dr. Goran Nil-
son, for all his help and cooperation as well as for crit-
ically reviewing this paper. I wish to thank the Razi
University authorities (Kermanshah-Iran) as well as
Eskandar Rastegar-Pouyani, Alireza Hashemi, Seyful-
lah Azadi, Masoud Abrishamian and Ali Rassuli for
their unsparing help during field work on the Iranian
Plateau. I am also grateful to Professor S. C. Ander-
son, Biological Science Department, University of the
Pacific, Stockton, California, for all his recommenda-
tions, encouragements, and for sending informative
literature, especially his unpublished Manuscript con-
cerning the Iranian agamids.
My special thanks also go to: Dr. Alan E. Leviton,
Department of Herpetology, California Academy of
Sciences; Dr. Colin McCarthy, Department of Zool-
ogy, British Museum (Natural History): Dr. Harold K.
Voris, Department of Herpetology, Field Museum of
Natural History; Dr. Jens B. Rasmussen, Zoological
Museum, University of Copenhagen: Dr. Franz Tiede-
mann, Naturhistorisches Museum Wien; Professor
Wolfgang Bohme, Zoologisches Forschungsinstitut
und Museum Alexander Koenig; Dr. Gunther Kohler,
Forschungsinstitut Senckenberg; Dr. Marta Poggesi,
Museu Zoologico de "La Specola"; Dr. Ivan Ineich,
Museum National d'Histoire Naturelle; and Dr. Olavi
Gronwall and S. O. Kullander, Swedish Museum of
Natural History, for loan of Trapelus specimens. Dr.
N. B. Ananjeva, Zoological Institute, Russian Acad-
emy of Sciences, St. Petersburg, who made it possible
for me to visit the herpetological collections of Zoo-
logical Institute and examine specimens of T. agilis.
This work was partly supported by grants from the
Royal Swedish Academy of Sciences ( Hiertza-Ret-
zius Fond), Anna Ahrenberg, and Wilhelm Martina
Foundations.
Literature Cited
Ananjeva, N. B. 1981. structural characteristics of
skull, dentition, and hyoid of lizards of the genus
Agama from the fauna of the USSR. Pages 3-20. In:
'The Fauna and Ecology of Amphibians and Reptiles
of the Palearctic Asia". Proc. Zool. Inst. USSR Acad.
Sci. 101.
Ananjeva, N. B., and O. J. Tsaruk. 1987. The taxo-
nomic status of the steppe agama, Trapelus sanguino-
lenta in the Praecaucasus. Proc. Zool. Inst. Leningrad.
158: 39-46.
Anderson, S. C. 1963. Amphibians and Reptiles from
Iran. Proc. Calif. Acad. Sci.. 31(16): 417-498.
Anderson, S. C. 1966a. The Turtles, Lizards, and
Amphisbaenians of Iran. Ph.D. thesis. Stanford Uni-
versity. 660 pp.
Anderson, S. C. 1974. Preliminary key to the Turtles,
Lizards, and Amphisbaenians of Iran. Fieldiana: Zool.
65: 27-44.
Anderson, S. C. (in press). The Lizards of Iran. Soci-
ety for the study of Amphibians and Reptiles, Oxford,
OH.
Biswas, S. and D. P. Sanyal. 1977. Fauna of Rajastan,
India. Part: Reptilia. Rec. Zool. Surv. India, pp. 254-
255.
Blanford, W. T 1881. On a collection of Persian rep-
tiles recently added to the British Museum. Proc.
Zool. Soc. London, pp.67 1-682.
Boulenger. G. A. 1885. Catalogue of the lizards in
British Museum. 1: 334-369.
Dumeril, A. M. C, and G. Bibron. (1834-1854). Erpe-
tologie generale ou histoire naturelle complete des
reptiles. Paris, 8 Vols.
Joger, U. 1991. A molecular phylogeny of agamid liz-
ards. Copeia 1991(3): 616-622.
1999
Asiatic Herpetological Research
Vol. 8, p. 99
Joger, U., and B. Arano. 1987. Biochemical phylog-
eny of the Agama genus group. In: Van Gelder, Strij-
hosch, and Berger (eds.). Proc. 4th Ord. Gen. Meet.
Soc. Europ. Herp., Nijmegen, 215-218.
Khan. M. S. 1980. Affinities and Zoogeography of
Herpetiles of Pakistan. BIOLOGIA, 26(1-2): 113-
171.
Lataste, F. 1880. Diagnoses des reptiles nouveaux
d'Algerie. Naturaliste 1, pp 299-325.
Moody, M. S. 1980. Phylogenetic and Historical Bio-
geographical Relationships of the Genera in the Fam-
ily Agamidae (Reptilia: Lacertilia). Ph.D. Thesis.
University of Michigan. Ann Arbor. 373 pp.
Nikolsky, A. M. 1915. Fauna of Russia and adjacent
countries (Translated from Russian by Israel program
for scientific translations. 1963). Vol. 1. Chelonia and
Sauria. 352 pp.
Olivier. G. A. 1804. Voyage dans l'Empire Ottoman,
l'Egypte et al Perse. Agasse, Paris. Vol. 4.
Pallas. P. S. 1814. Zoogeographia rosso-asiatica, sis-
tens omnium animalium extenso imperio rossico et
adjacentibus maribus observatorum recensionent. 3,
Petropoli, Acad. Scient. 428 pp.
Rastegar-Pouyani, N. 1998. Systematica and Distribu-
tion of the Iranian Species of Trapelus (Sauria: Aga-
midae): A Review. Russian Journal of Herpetology
5(2): 127-146.
Rastegar-Pouyani, N. (In press). Analysis of Geo-
graphic Variation in Trapelus agilis complex (Sauria:
Agamidae). Zoology in the Middle East.
Rastegar-Pouyani, N. (Unpublished) Taxonomic Re-
Evaluation of Trapelus agilis complex (Sauria: Aga-
midae): A Multivariate Approach.
Ruppell, E. 1835. Neue Wirbeltiere zu der Fauna von
Abyssinien gehorig. III. Amphibien. Siegmund
Schmerber, Frankfurt-am-Main. (2)+18p., 6 pis.
Welch, K. R. G. 1983. Herpetology of Europe and
Southwest Asia, a checklist and bibliography of the
orders Amphisbaenia, Sauria and Serpentes. Robert E.
Krieger publishing Co., Malabar, Florida, viii + 135
pp.
Wettstein, O. 1951. Ergebnisse der Osterreichischen
Iran- Expedition 1949 / 1950, Amphibien und Rep-
tilien. Sitzb. Akad. Wiss. Wien. 160: 427-448.
Zhao. E., and K. Adler. 1993. Herpetology of China.
Soc. Stud. Amph. Rep. pp. 186-187, 288-289, 304.
Appendix 1. Material examined
Trapelus agilis agilis (n =541 )
MNHN 5708 (2) = 1994. 1 178 (2) (Olivier's syntypes):
Iraq, vicinity of Baghdad. GNHM. Re. ex. 5213-17: Iran,
Tehran prov. 50 km NE Qum on road to Tehran. GNHM.
Re. ex. 5218-28: Iran, Tehran prov. 75 km NE Qum on road
to Tehran. GNHM. Re. ex. 5229-34: Iran, Tehran prov. 5 km
NE Saveh on road to Tehran. GNHM. Re. ex. 5235-62: Iran,
Tehran prov. (50-60 km W Tehran) between Eshtehard -
Saveh. GNHM. Re. ex. 5263: Iran, Tehran prov. 30 km SE
Tehran on road to Garmsar. GNHM. Re. ex. 5264-66: Iran,
Central prov. 25km Khomain on road to Mahalat. GNHM.
Re. ex. 5267-81: Iran, Central prov. between Komain-Deli-
jan and Mahalat-Delijan roads. GNHM. Re. ex. 5282-86:
Iran, Esfahan prov.near Naragh, 50km W kashan on road to
Naragh. GNHM. Re. ex. 5287-89: Iran, Esfahan prov. 20
km ES Kashan on road to Natanz on the margin of Dasht-e
Kavir.GNHM. Re. ex. 5290-92: Iran, Esfahan prov. 80km N
Esfahan on road to Natanz.GNHM. Re. ex. 5293-97: Iran,
Esfahan prov. 70km E Esfahan on road to Naein, near Kuh-
payeh city. GNHM. Re. ex. 5298-99: Iran, Esfahan prov.
15km N Shahreza on road to Esfahan. GNHM. Re. ex.
5300-07: Iran, Fars prov. 50 km N Abadeh on road to Shahr-
eza. GNHM. Re. ex. 5308-16: Iran, Fars prov. 50- 75km S
Abadeh on road to Shiraz. GNHM. Re. ex. 5317-31: Iran,
Markazi province, 45 km E Arak on the road to Qum.
GNHM. Re. ex. 5332-34: Iran.Tehran prov., 65 km NE
Saveh on road to Robat-Karim. GNHM. Re. ex. 5335: Iran,
Markazi prov.. 50 km N of Delijan on road to Salafchegan.
GNHM. Re. ex. 5336-44: Iran, Esfahan prov., 45 km E of
Golpaygan. GNHM. Re. ex. 5346-50: Iran, Esfahan prov., 7
km E of Tiran on road to Najaf-Abad. GNHM. Re. ex.
5351-57: Iran, Esfahan prov., 25 km SE of Esfahan on road
to Dastjerd. GNHM. Re. ex. 5358-68: Iran, Esfahan prov.,
about 1 10 km SE of Esfahan city, on road from Malvajerd to
Ramsheh. GNHM. Re. ex. 5369-70: Iran, Esfahan prov., 20
km W of Ramsheh on road to Shahreza. GNHM. Re. ex.
5371-78: Iran, Fars prov., 50 km N of Abadeh (15 km S of
Izad-Khast) on road to Esfahan. GNHM. Re. ex. 5379-91:
Iran. Fars prov., 65 km SE of Abadeh on road to Shiraz.
GNHM. Re. ex. 5399: Iran. Kerman prov., 28 km NE of Sir-
jan on road to Kerman. GNHM. RE. ex. 5400-1: Iran, Ker-
man prov., 70 km NE of Sirjan on road to Kerman. Khaneh-
Sorkh Pass, about 2800 m elevation. GNHM. Re. ex. 5402-
13: Iran, Semnan Prov., 5o km E of Semnan, North of
Dasht-e- Kavir, Northeastern Iran. GNHM. Re. ex. 5414-23:
Iran, Khorasan Prov., 1 10 km East of Shahrud, Northeastern
Iran. CAS 142230: Iran.Tehran prov. Lar-Damavand.
CAS142189, CAS 142190, CAS 142182, CAS 142192,
CAS 142191, CAS 142187, CAS 142188, CAS 142183,
CAS 142184, CAS 142186, CAS 142185: Iran, Zanjan
prov. Ghazwin. CAS 142231: Iran.Tehran prov. Karadj.
CAS 142093, CAS 142094, CAS 142098, CAS 142097,
CAS 142100. CAS 142092, CAS 142096, CAS 142095,
CAS 142101, CAS 142099: Iran.Tehran prov. Saveh. CAS
141293: Iran, Tehran prov.24km W of Saveh On road to
Hamadan. [35 07 N, 50 08 E]. CAS 142194, CAS 142197,
CAS 142195, CAS 142199, CAS 142198, CAS 142193:
Iran. Esfahan prov. Mahalat. CAS 141019: Iran, Esfahan
prov.6km by road NW Ardestan. [32 26 N, 52 20 E]. CAS
141 109: Iran, Esfahan prov. 8km S of Kashan and 6km W of
road between Yazd -Kashan. [33 54 N, 51 30 E]. FMNH
Vol. 8,
100
Asiatic Herpetological Research
1999
170987. FMNH 170988: Iran, Gilan prov. 4,2 mi N of Tuke-
stan (Zanjan prov. Takestan?). NMW 33 166-1, Iran: Fars
prov. 9 km N of Abadeh. NMW 33167, NMW 33085-2:
Iran, Hormozgan prov. 14km E Bandar-Abbas. NMW 7276-
I, NMW 7276-2: Iran: Kerman prov.? Sabzewaran. NMW
7276-3: Iran: Kerman prov.? Rigmati. 150 km SE of Sabze-
waran. NMW 7276-4: Iran, Esfahan prov. 135 km N of
Esfahan. NMW 33159-3, NMW 33159-4, NMW 33159-5,
NMW 33165-1: Iran, Esfahan prov. Murcheh-Khurt, N of
Esfahan. NMW 33165-2, NMW 33165-3, NMW 33085-1:
Iran: Esfahan prov. 4 km SE Robai-Tork ( 165 km NW of
Esfahan). NMW 33085-3: Iran. Zanjan prov. 26 km SE
Ghazwin. NMW 33083-1, NMW 33083-2, NMW 33083-3:
Iran, Zanjan prov. 41 km SE Ghazwin. Elev: 1380 m. NMW
33164: Iran/Tehran prov. 60 km S of Tehran. NMW 33084-
3: Iran, East Azarbaijan prov. 42 km SE Mianeh. Elev: 1200
m. NMW 33166-1: Iran. Kerman prov. 15 km SE Kerman.
SMNH 3139-1, SMNH 3139-2, SMNH 3139-3, SMNH
3139-4, SMNH 3139-5, BMNH 85. 5. 27. 14, BMNH 85. 5.
27. 15. BMNH 85. 5. 27. 16. BMNH 85. 5. 27. 17, BMNH
85. 5. 27. 18, BMNH 85. 5. 27. 19: Iran: Tehran (exact
locality?). GNHM. Re.ex. 4437, GNHM. Re.ex. 3324,
GNHM. Re.ex. 4395-1: Iran, Gilan prov. 65 km SSW of
Rasht. GNHM Re.ex. 4395-2: Iran, Tehran prov. 150 km S
of Tehran. Siah-Kuh. Shah- Abbas post. GNHM Re.ex.
4396-1, GNHM. Re.ex. 4396-2: Iran, Mazandaran prov. 150
km E of Gorgan, Golestan Park. La Specola 30584, La Spe-
cola 30585: Iran/Tehran prov. 50 km S Qum? BMNH 1920.
3. 20. 1: Iran, Hamadan prov. Hamadan. Jinjan? BMNH
1936. 10. 12. 1: Iran. Kerman prov. N. Of Kerman, Sekonj.
7000 ft. BMNH 1934. 12. 16. 3. BMNH 1936. 12. 16. 4:
Iran. Sheakuh, seat (Salt?) desert.
BMNH 1912. 3. 26. 13, BMNH 1912. 3. 26. 14, BMNH
1912. 3. 26. 15, BMNH 1906. 8. 10. 25, BMNH 1900. 5. 9.
9, BMNH 1900. 5. 9. 10, BMNH 1900. 5. 9. 11, BMNH
1900.5.9. 12, BMNH 74. 11.23. 104, BMNH 74. 11.23.
105, BMNH 74. 1 1. 23. 106. BMNH 74. 1 1. 23. 107,
BMNH 74. 1 1. 23. 108, BMNH 74. 1 1. 23. 109, BMNH 74.
11.23. 110.BMNH74. 11.23. 111.BMNH74. 11.23. 112,
BMNH 74. 1 1. 23. 1 13: Iran, Sistan-Baluchestan prov.
BMNH 1951. 1.6. 50, BMNH 1951. 1. 6. 51-2. BMNH 94.
II. 13. 4, BMNH 94. 11.13. 5: Iran, Hormozgan prov.
BMNH 87. 12. 20. 1: Iran, Hormozgan prov. Kishim
(=Gheshm?) Island, Persian Gulf. BMNH 79. 8. 15. 10-15:
Iran, Fars prov. Dehbid, north of Shiraz. BMNH 1903. 3.
14. 1: Iran, Bushehrprov. Bushehr. BMNH 1933.4. 1. 20-
22: Pakistan, Waziristan, N. W. F. P. BMNH 86. 9. 21. 17.
BMNH 86. 9. 21. 18, BMNH 86. 9. 21. 23, BMNH 86. 9.
21. 24.BMNH 86. 9. 21. 25: Afghanistan: Helmand. ZMUC
R36133, ZMUC R36149-54, ZMUC R36160, ZMUC
R36204-5: Afghanistan: Seistan prov. Faisabad (south of
Afghanistan). ZMUC R36155-9, ZMUC R36145-8,
Afghanistan, Seistan prov. Baqrabad. ZMUC R36161:
Afghanistan, Seistan prov. Faisabad-Farah. ZMUC R36206:
Afghanistan, Kandahar prov. Przadah, W of Kandahar.
ZMUC R36208-9: Afghanistan, Kabul prov. near Kabul?
ZISP 7361: Afghanistan: Harat. NMW 33170-12: IRAN.
East Azarbaijan, 42 km SE Mianeh. NMW 33173-1-2:
IRAN, Zanjan prov. 26 km SE Qazwin. NMW 33170-1:
IRAN.Tehran prov. 95 km S Tehran. NMW 33148-1-10:
IRAN: Tehran prov. Zaveyeh, 80 km SW Tehran. NMW
7276-5-6: IRAN, Kerman prov. Sabzewaran. NMW 33175-
5, NMW 33170-5, NMW 33170-6. NMW 33170-7: Iran.
Esfahan prov. NMW 33172-3-4: IRAN: Kerman prov. 138
km S Rafsanjan. NMW 33172-5: IRAN: Kerman prov. 29
km SE Sirjan. NMW 33 165-4: IRAN, Kerman prov. 1 10 km
SW Kerman. NMW 33172-2, NMW 33175-6, NMW
33175-7: Iran: Yazd prov. 200km SE Yazd. NMW 33174-1-
8: IRAN, Khorasan prov. 15-25 km S Qayen. NMW 33163:
Pakistan: Nepandgur (where?). NMW 33162: Pakistan:
Delbandin. NMW 33161-1-2: Iran, Shirgesht Beiteabas.
NMW 33161-3: Iran, eastern Iran, Ozbak-Kuh. NMW
33172-6: Pakistan. Baluchestan prov. 50 km W Nushki.
NMW 33150-9: Iran W Sangbast. NMW 24763-1 -3 :Iran, N
Persian. Kuh Daschteh (Taj-abad). NMW 24767: Iraq.Bagh-
dad? (Paris Museum). CAS 120280-1: Afghanistan, 10km
NE Darweshan (Central Afg.). CAS 84642-45: Afghanistan,
35 mil. down stream from Girishk. Dasht-e-Margo area,
Chah-e-Angir, (Central Afg.). CAS 120242-4 Afghanistan,
12 km S Lashkargah (near Girishk), 2700ft. CAS 97990:
Afghanistan. 20 mil. SE Kandahar, 31 23 N, 65 53 E, 3800
ft. CAS 90762-9: Afghanistan, Sharisafa. 60 km NE Kanda-
har. 1400m. CAS 90777: Afghanistan,Tarnak river, 75 km
NE Kandahar. 1405m. CAS 120276-9: Afghanistan, 30km S
Ghazni-Qalat 7100ft. FMNH 20987-1-10: Iran.Esfahan
prov. Yazd-e-Khast .FMNH 20985-90: Iran, Esfahan prov.
FMNH 20988-1-2: Iran,Daria-Masila. FMNH 245507-10:
Pakistan.Baluchistan prov. SMF 63226-37, SMF 63262,
SMF 63285, SMF 63255: W-Pakistan, Siah-Kuh, S Delban-
din. BMNH 1951.1.6.54: Iran, Bandar-e-Lengeh. BMNH
1919.5.2.2-3: Iran, Fars prov. Abadeh. BMNH
1936.10.12.3: Iran, Fars prov.between Quatru-Chah Salz to
Neiriz road. BMNH 1966-355-57: Iran, Kerman prov. 148
km E Neiriz on Zaidabad road to Sirjan. BMNH
1951.1.2.20-22: Iran, Kerman prov. 20 mil. S of Kerman.
Jupar. BMNH 1951.1.6.45-48: Iran, Sistan prov. Khash, SE
Iran. BMNH 1940.3.1.19-24: Afghanistan, Ghazni, (E
Afgh.l.CAS 141028: Iran, Kerman prov. 17km SSE Minab
on inland road to Jask. CAS 141020: Iran, Kerman prov. 13
km E of Eastern edge of city of Kerman. CAS 141051: Iran.
Kerman prov. 19km SE Shagu on road to Minab. CAS
141027: Iran, Kerman prov. 21 km N Rudan on road to
Jiroft. CAS 141097: Iran, Sistan prov. 10km SW Hirmand,
abandoned village, SE of road from Zabol to Dust-e-
Mohammad Khan. CAS 141065: Iran, Baluchistan
prov. 1 3km southerly of Zahedan on road to Khash. CAS
102484-90: Iran: Sistan prov. 15 mi SW Zabol. CAS
102491-2: Iran, Fars prov. Ahram. CAS 141 149: Iran, Fars
prov. 5km northerly from Dalaky on road to Shiraz where
foothills begin. CAS 96270: Iran. Khorasan prov. Tayebat.
about 10 mi from Afghanistan border. NMW 33150-1-6:
Iran. Khorasan pro. 5 km N Taybad. NMW 33166-1 : Iran:
Kerman prov. 15 km SE Kerman.
Trapelus agilis sanguinolentus (n =238)
GNHM Re.ex. 4396 ( l-2):Iran: Mazandaran prov. 150 km E
of Gorgan, Golestan Park. GFN 40: Turkmenistan, Lowland
steppe. East Kopet Dagh. GNHM. Re. ex. GFN 41: Turk-
1999
Asiatic Herpetological Research
Vol. 8. p. 101
mcnistan. Murgub River, 150 km S of Marv (Mary).
GNHM. Re. ex. GFN 42-50:Turkmenistan, Sahra-Bairum-
Ali. 45km NW of Marv, Kara kum desert. CAS 185 104-9.
CAS 185134-5: Turkmenistan, Ashgabad region [38 00 N,
58 00 E], CAS 184570-6: Turkmenistan: Krasnovodsk
region [39 45 N. 54 33 EJ.
GNHM. Re. ex. GFN 35: Turkmenistan. Archenjan village.
GNHM. Re. ex. GFN 36: Turkmenistan. Krasnovodsk
region [39 45 N, 54 33 E]. GNHM. Re. ex. GFN 43 (1-2):
Turkmenistan, Kaka. GNHM Re. Ex 10622-3: Kazakhstan,
at the lake (artificial ) at Illi River, near village Bokter [43 54
N, 77 16 E]. ZISP5109, 13701-15 Kazakhstan, E. Kazakh-
stan, Illi River, near border of China. ZISP 5796: Kazakh-
stan.Tardski, Dshungaria, between Kazakhstan-China. ZISP
20298 (7745-79): Kazakhstan, near Ilisk city, Illi River. E.
Kazakhstan. ZISP 15143, 17329, 13695, 1 168: Kazakhstan,
near Ilisk city, Illi River, E. Kazakhstan. ZISP 1 1070 ( 1 - 1 2 ):
Kazakhstan: , Illi River, E. Kazakhstan.close to lake
Balkhash. ZISP 19115 (7643-84): Uzbekistan, Vicinity of
Nucus city. Caracal, near Aral sea. ZISP 19398 (7428-48):
Uzbekistan-Tajikestan, Fergan Valley. ZISP 15803 (1-15):
Tajikistan, Fergan Valley. ZISP 20097(371-87), 10715 (3-
13): Tajikestan-Afghanistan border, Termez. ZISP 13588,
13590(1-12), 13592.6914(1-10): Kazakhstan-Uzbekistan,
between Aral Lake and Caspian Sea. ZISP 19392 (1-24):
Russia (west of Caspian Sea), Daghestan. ZISP 15753: Iran.
Astarabad (= Gorgan?). CAS 183032-39: Russia, Chechen-
Ingush Autonomous Republic, the lowland between Terek-
Kuma Rivers [43 21 N, 46 06 E], CAS 120249-50: Afghan-
istan, 30-70 km E of Herat 3700-5350 ft. CAS 1 15922-3:
Afghanistan, Maimana, 35 54 N, 64 43 E. 884m. CAS
1 20280- 1 : Afghanistan, 10km NE Darweshan (Central
Afg.). CAS 120275: Afghanistan, 25 km E Khanabad
(between Mazare-Sharif-Faizabad), 2400ft. CAS 115920:
Afghanistan, northeastern Afghanistan. 64 mi by road E
Faizabad, 37 05 N, 70 40 E. CAS 1 15921 : Afghanistan,
Paghman Vicinity, 34 36 N, 68 56 E. 2440m. CAS 120251:
Afghanistan. 25km NW Pul-e-Khumri, 2400ft. (near Mazar-
sharif?). CAS 120255: Afghanistan, 20 km E Mazar-e-
Sharif. CAS 120253: Afghanistan, 10 km W Tashkurgan,
Near Mazar-Sharif? CAS 120256-8: Afghanistan, 20-50 km
E Mazar-e-Sharif. CAS 120259-61: Afghanistan, 45 km W
Mazar-e-Sharif, 1500ft. CAS 120273: Afghanistan, 50 km
W Mazar-e-Sharif. FMNH 161 197-9: Afghanistan, Maim-
ana, 35 54 N, 64 43 E 884 m. FMNH 161 133: Afghanistan,
64mil E Faizabad. 35 05 N, 70 40 E. FMNH 161 191-2:
Afghanistan, Paghman vicinity, 34 36 N, 68 56 E. 244m.
FMNH 141399: Iran, Mazandaran prov. 1 mi N of Pahlavi
Dezh.
pros.. 38 km S of Masjid-e-Sulaiman, Golgir village. CAS
86403-6, 86418-19 (paratypes), : Iran, Khuzistan prov.
along road to lake east of Haft-Kel. CAS 86464 (paratype):
Iran, Khuzistan an prov. along road south of Shushtar. CAS
86556 (paratype): Iran. Khuzistan prov. Haft-Kel (on golf
course) [31 28 N. 49 30 E]. CAS 86342, 86346, 86390
(paratypes): Iran. Khuzistan prov. Tuli-Bazum road [31 55
N. 49 25 E], FMNH 170936 (paratype): Iran, Khuzistan
prov. 53 mi SE Ahwaz , Mashrageh. CAS 86341, 86343-72,
86374-89: Iran, Khuzistan prov. Tuli-Bazum road [31 55 N.
49 25 E]. CAS 86320. 86323-28: Iran, Khuzistan prov.
Masjid-Suleiman [31 57,N, 49 16,E]. CAS 86322: Iran,
Binak. near Persian Gulf at foot of Kuh-e-Bang [29 44,N,
50 19,E]. CAS 86338-51: Iran, Khuzistan prov. along old
Masjid-Suleiman and Ahvaz road [32 N, 49 1 l.E]. CAS
86251: Iran. Khuzistan prov. Masjid-i-Suleiman [31 57 N,
49 16 E], CAS 86373: Iran. Khuzistan prov. road south of
Shushtar. CAS 102491-2: Iran, Fars prov. Ahram. CAS
86625: Iran. Khuzistan an prov. Binak. on Persian Gulf at
foot of Kuh-i-Bang, north of Ganaweh. [29 44 N, 50 19 E].
CAS 86487: Iran, Fars prov. Agha Jari. [29 48 N, 49 46 E].
FMNH 141392-3, 141395-6, 141398: Iran, Fars prov.
Ahram. ZISP 10335: Iran, Kochrud, Irak-Adschemi (exact
locality?) (Nikolsky's Type of Agama kennanensis , var.
brevicauda ). ZISP 9321: Iran. Kochrud. Irak-Adschemi
(exact locality?) (Nikolsky's Type of Agama kennanensis ).
ZISP 9889: Iran (exact locality ?).
Trapelus agilis pakistanensis (n =32)
SMF 63258 (holotype), 63259, 63279 (paratypes): Pakistan,
Gaj-River, Kirthar Range. SMF 63256 (paratype): Pakistan,
Sonda Distr.Thatta. SMF 63236: Pakistan, Old Airport of
Karachi. 63243-4 and 63286-7 (paratypes): Pakistan, Old
Airport of Karachi. SMF 63239, 63264: Pakistan, Hab River
at Goth Mauladad. SMF 63263: Pakistan, Jati, Sind. SMF
63276: Pakistan, Karangee at Karachi. SMF 63265: Paki-
stan, Karachi. SMF 63267: Pakistan. Karachi area. FMNH
224946: Pakistan, Sind Prov. Dadu dist. Ranicot. FMNH
244977: Pakistan, Sind Prov. Karachi Dist. Malir. conton-
ment. FMNH 244948: Pakistan, Sind Prov. Karachi Dist.
Malir, contonment. BMNH 1933.7.8.23: Pakistan, Salt
Range. Punjab. BMNH 74. 4. 29. 1432, 80. 1 1. 10. 25: Paki-
stan, Sind area. BMNH 98. 12. 22. 7-8: Pakistan: Kurrachee
(karachi). BMNH 1964-271: Pakistan, Mirpur Khas.
BMNH 1933.12.7.1: Pakistan, Sind area.
Trapelus agilis khuzistanensis (n =97)
GNHM. Re. ex. 5424 (holotype): Iran, 5 km NW Haft-Gel
on the road to Shushtar. GNHM. Re. ex. 5425 (paratype):
Iran, Khuzistan prov., 5 km NW of Haft-Gel on road to
Shushtar. GNHM. Re. ex.5426 (paratype) : Iran, Khuzistan
1999
Asiatic Herpetological Research
Vol. 8, pp. 102-106
Rhacophorus leucomystax in Vietnam with Acoustic Analyses of
Courtship and Territorial Calls
Tanya L. Trepanier1- 2, Amy Lathrop1'2 and Robert W. Murphy1-2-3
1 Department of Zoology, University of Toronto, 25 Harbord Street, Toronto, Ontario, Canada M5S 3G5, e-mail:
[email protected]; 'Centre for Biodiversity and Consenation Biology, Royal Ontario Museum, 100 Queen's
Park, Toronto, Ontario, Canada M5S 2C6; Corresponding author: e-mail: [email protected]
Abstract.- Acoustic parameters of both courtship and territorial calls were analysed for two populations of
Vietnamese treefrogs, genus Rhacophorus. These treefrogs from Ba Be National Park and nearby Na Hang
Nature Reserve were identified as R. leucomystax as opposed to R. megacephalus, based on an acoustic analysis
of courtship calls. They represent the first confirmed record of this species outside of Borneo and suggest that the
species may also occur in China. The courtship call, composed of a long note of similar pulses and pitch, has a
mean dominant frequency of 1940 ± 154 Hz at Ba Be National Park and 1950 ± 70 Hz at Na Hang Nature
Reserve. The territorial call, a two to three note call, has a mean dominant frequency of 1940 ± 124 Hz at Ba Be
National Park and 2190 ± 256 at Na Hang Nature Reserve. No significant differences were found between the
call characters of these two populations of Vietnamese R. leucomystax. There was no significant association
between snout- vent length and dominant frequencies.
Key words.- Amphibia, Anura, call analysis, Rhacophoridae, Rhacophorus leucomystax, Vietnam, vocalizations.
Introduction
Until recently, the amphibian fauna of Vietnam has
been based on the works of Bourret (1942), and
accounts from neighbouring China (e.g., Yang, 1991;
Zhao and Adler, 1993: Zhao, 1995). The Chinese
occurrence of one species of treefrog, Rhacophorus
leucomystax, was recently placed into doubt by Mat-
sui et al. (1986) based on chromosomal, morphologi-
cal and acoustic evaluations. These authors reported
that R. leucomystax was restricted in distribution to
Borneo whereas a similar species, R. megacephalus.
occurred in Taiwan. They stated that mainland Chi-
nese populations of these frogs required further study,
but in the interim, mainland Chinese populations
should be referred to as R. megacephalus. Zhao and
Adler (1993) reported that R. leucomystax did not
occur in China, but rather that R. megacephalus
occurred throughout the country. Our recent field
work in northern Vietnam revealed the presence of
two apparent forms of treefrogs similar in appearance
to R. megacephalus and/or R. leucomystax. We suc-
cessfully recorded vocalizations of one form from two
allopatric populations. Herein, we report our analysis
of the acoustic parameters of both courtship and terri-
torial calls, including the dominant frequency, which
is species specific.
Amirans are capable of different types of vocaliza-
tions which serve different functions. The courtship
call, also known as the mating or breeding call, is
emitted by males and has two functions: the attraction
of conspecific females and the announcement of an
occupied territory to other males of the same or differ-
ent species. There are three types of courtship calls:
the courtship call produced by males in attempt to
attract a conspecific female, a territorial call produced
by a resident male in response to an courtship call
received above a critical threshold of intensity, and an
encounter call evoked during close range agnostic
interactions between males (Duellman and Trueb,
1994). The courtship call acts as a courtship isolating
mechanism (Duellman and Pyles, 1983). A second
type of call, the territorial call, is comprised of acous-
tic signals and is accompanied by corporal vibrations
produced by a male or an unreceptive female in
response to amplexus. Other types of calls include the
reciprocation call which is given by a receptive
female, and the distress call which is delivered in
response to an enemy or predator for defence.
Signals are found to vary between and within indi-
viduals and between geographically separated popula-
tions of a single species (Cocroft and Ryan, 1995).
Anurans use these differences in call characteristics to
identify individuals of the same or different species
and to signal intent. Frost and Platz ( 1983) proposed
that these interspecific and intraspecific differences in
fundamental call characteristics such as pulse rate,
duration of call, dominant frequency, or a combina-
1999
Asiatic Herpetological Research
Vol. 8, p. 103
tion of these parameters, permits females to reduce
the likelihood of error in mate choice. Anurans recog-
nize individuals of the same and different species by
their dominant frequencies.
Duellman and Pyles (1983) discovered that
smaller frogs tend to call at higher frequencies and
have a reduced auditory sensitivity compared with
larger frogs. They concluded that an upper limit of
approximately 5000 Hz is most common. Further-
more, the reception of acoustic signals is affected by
habitat and interference from synchronously calling
species. In rainforest habitats, which are complex
habitats, anurans were found to produce sounds at
lower frequencies because the dense vegetation atten-
uates sound waves, notably those at higher frequen-
cies. Therefore, transmission frequencies of less than
4(X)0 Hz would be most effective for anuran commu-
nication in such complex habitats. Partitioning of the
acoustic community can be affected by several factors
such as type of call produced, oviposition site, envi-
ronment and the onset of the breeding season (Duell-
man and Pyles. 1983). But within any given
community, the available acoustic environment is par-
titioned distinctly based on its particular ecological
and geographic assemblage of anurans. Although
selection may operate to maximize acoustic properties
for species recognition, acoustic interference from
factors of the physical habitat and from community
members also operates to minimize acoustic variabil-
ity. This implies that members of the same breeding
fauna have voices with common characteristics
(Duellman and Pyles, 1983).
Material and Methods
Frog calls were recorded and calling specimens col-
lected from two different localities in northern Viet-
nam. Approximately 24 frogs of the R. leucomystax
complex were recorded and collected in Ba Be
National Park (22°24'N 105°37'E) from 15 to 29 May
1995. Five R. leucomystax were recorded and col-
lected in the village of Pac Ban (22°21'N 105°23'E)
located in Na Hang Nature Reserve, from the 23 May
to 3 June, 1996. In both locations, frogs were selected
at random and a sufficient call sample was recorded
using a Realistic™ unidirectional microphone and a
Marantz™ PMD 201 portable cassette recorder. Air
temperatures were recorded in degrees Celsius at Ba
Be National Park at the time of capture, using a ther-
mometer; each specimen was collected during
evening hours from a concrete pool adjacent to the
Park's research centre. In Pac Ban, frogs were col-
lected from various locations, including in rice patties,
on trees, and in ponds. All specimens were eutha-
nised, preserved and deposited in the herpetology col-
lections of the Royal Ontario Museum, Toronto,
Canada. Calls were transferred from the cassette
recorder to a Macintosh computer using a Macrore-
corder™ digitizer. Sound Edit Pro™ version 2.0.5 for
Macintosh computer systems was used for call analy-
ses. Note duration, dominant frequency, fundamental
frequency, notes per call, pulses per note and time
between segments were measured. Descriptive analy-
ses were performed for all courtship and territorial
calls, using Excel™ 5.0 (Microsoft). Snout-vent
length (SVL) was measured for all specimens to the
nearest 0.1 mm using digital calipers.
Results
Of the 24 specimens recorded and digitized at Ba Be
National Park. 42 courtship calls were analysed from
22 individuals, and 33 territorial calls from 18 indi-
viduals. Table 1 summarizes measurements of call
parameters for all mating calls.
In most cases, the fundamental frequencies over-
lapped the dominant frequencies, rendering it impos-
sible to obtain exact measurements. However, in those
that were observed, the fundamental frequency
appeared to be approximately one half the value of the
dominant frequency (900-1000 Hz). Air temperatures
did not vary significantly, with a mean of 26.2°C for
territorial and courtship calls, thereby having little
effect on call characteristics. All courtship calls had
one note, and pulses ranged from 2 to 17 per note. In
contrast, all territorial calls were either 2 or 3 notes
per call, the most common being the former, with
variability in numbers of pulses in all three notes (Fig-
ure 1).
Of the 5 specimens recorded and digitized in Pac
Ban, 2 courtship calls were analysed from 2 individu-
als, and 21 territorial calls from 5 individuals. Call
parameters are summarized in Table 1. Fundamental
frequencies were obtained from the sonograms, where
values were noted as approximately one half the value
of the dominant frequency (800-900 Hz). All court-
ship calls had one note, and pulses ranged from 4 to
16 notes per call. In contrast, all territorial calls were
either 2 or 3 notes per call, the most common being
the former, with variability in numbers of pulses in all
three notes.
The courtship call resembled the sound of a trill,
or long sequence of pulses of similar pitch, whereas
the territorial calls were more similar to the sound of
clicks. Dominant frequencies were consistent within
all calls; mean dominant frequency in courtship calls
were 1940 Hz for the Ba Be population and 1950 Hz
Vol. 8. p. 104
Asiatic Herpetological Research
1999
Table 1 . Call measurement summary of note duration, notes/call, pulses/note and dominant frequencies for Rha-
cophorus leucomystax in Ba Be National Park and Pac Ban in Na Hang Nature Reserve.
Ba Be National Park
Courtship Territorial
Na Hang Nature Reserve
Courtship Territorial
for the Pac Ban population. For territorial calls, the
mean dominant frequency was also 1940 Hz in Ba Be
and 2190 Hz in Pac Ban. Therefore, R. leucomystax
has a species-specific dominant frequency of approxi-
mately 2000 Hz. A consistency between segments or
pulses was observed for the territorial calls. The mean
time between segments was 0.02 seconds (standard
deviation ±0.003).
Snout-vent length was measured for all specimens
and correlated with dominant frequency. Our regres-
sion analyses failed to confirm a significant associa-
tion (F= 1.948, p=0.176, r=0.08) between SVL and
dominant frequency.
Discussion
Call duration and pulse rate are temperature depen-
dent (Platz, 1989). Regression analysis of call charac-
teristics and temperatures achieve the highest
correlation, where a correction function is generated.
The correlation function is then used to correct data
for temperature differences revealing little variation.
For example, a few obvious differences were discov-
ered in the values of the call characteristics as shown
in the sonograms for the eastern and western samples
of Rana pipiens when differences in temperature
between the localities and variation within the locali-
ties were taken into account (Dunlap and Platz, 1981).
However, because temperatures were not significantly
variable, temperature values were not used to account
for variation in our data. Furthermore, our regression
analyses revealed that snout-vent length did not
account for variation in our acoustic data, as it does in
some other anuran species (Duellman and Pyles,
1983).
Because dominant frequency is characteristic of
species, we compared our data with those of Matsui et
al. (1986). The dominant frequency of Rhacophorus
leucomystax ranged from 2250-2550 Hz whereas it
ranged from 1040-1070 Hz in R. megacephalus. Fur-
ther, Matsui et al. (1986) found that R. leucomystax
had one note/call whereas in R. megacephalus it
ranged from 2-4 notes/call. Given that the mating
calls of our frogs from northern Vietnam had a domi-
nant frequency of 1.94-2.49 kHz (Table 1) and con-
sisted of a single note/call, we conclude that our
specimens are best identified as R. leucomystax pend-
ing additional morphological evaluations (in prepara-
tion). Our study sites at Ba Be National Park and Na
Hang Nature Reserve are located only 125 km south
of Yunnan Province, China. Consequently, given that
R. leucomystax ranges from at least Borneo to north-
ern Vietnam, the species likely also occurs in China
and elsewhere in Asia. Further, it seems likely that it
occurs sympatrically with R. megacephalus, at least in
Vietnam.
Disturbance to the environment may have negative
impact on anuran populations. As a result of
increased accessibility to Vietnam, tourists are begin-
ning to exploit the relatively primitive country. Such
exploitation will likely contribute to increased defor-
estation and wildlife loss. Human population growth
continues to rise in Vietnam at an alarming rate (ca.
2.3%/yr) and deforestation is increasing in quest for
construction materials and agriculture for both in-
country needs and cash-crop export, especially coffee.
Species mining is occurring for export of animals to
foreign countries, regardless of species type, number
or Vietnamese efforts to protect the species. Little-
john and Roberts (1975) remarked that the environ-
ment of north central Victoria, Australia, had been
greatly modified over the last 130 years by increased
land clearing for agriculture, timber cutting for build-
ing and mining, and by the establishment of extensive
irrigation and drainage systems. They suggested that
these alterations have influenced the position, extent,
and nature of the main zones of intergradation, which
may further increase dispersal due to global warming
1999
Asiatic Herpeiological Research
Vol. 8, p. 105
0 00
0 38
0 76
10000
8000
6000
5 4000
£ 2000
0.00
r
038
077
4*i-
,li |.
^ 10000
M
X 8000 •
>- 6000 ■
a> 4000 ■
++IHH
2000
2 00
B
0 00 0 50 1 00 I 50
Time (sec)
0.00
0 20 40 60
Energy (dB)
0.00 0 50 I 00 1 50
Time (sec)
_ 10000
N
X 8000
>" 6000
<u 4000
3
+^+-Hm
D
000
0 50
200
1 00
t-t
2000
0
-*-*-
_ 10000
N
X 8000
•w
>" 6000
<B 4000
uitlHH|H|
2000
-rH"
MHinij
0 00 0 50 100 150
Time (sec)
Energy (dB)
2 00
0 00
0 50 I 00 1 50
Time (sec)
i
0 20 40 60
— 'Energy (dB)
2 00
Figure 1 . Call characteristics for Rhacophorus leucomystax as illustrated through audiospectrograms (frequency
vs. energy) and sonograms (frequency vs. time). An expanded oscillogram (above) shows finer details of the call.
Territorial calls from A) Babe (ROM 19334); B) Pac Ban (ROM 6514), and courtship calls from C) Babe (ROM
19486); and D) Pac Ban (ROM 6514).
and the concomitant northward movement of anuran
populations. The possibility for divergence in mating
call structure could then result increasing the fre-
quency of mismatching and nonviable offspring. Like
Victoria, it is not known what the future beholds for
the relatively fragile, undiscovered and endemic spe-
cies of Vietnam. Therefore, identification of species
for many areas of study, such as behavioural, ecologi-
cal and evolutionary fields, will be critical in the next
few years so that as many species as possible can be
studied, identified and conserved.
Acknowledgments
Collecting and export permits were made available
through Vietnam's Institute of Ecology and Biological
Resources (IEBR), Hanoi. This study was supported
by the Natural Sciences and Research Council
(NSERC) of Canada grant A3 148, by the generous
assistance of the ROM Sciences Fieldwork Fund, the
ROM Future Fund, the ROM Foundation, the Depart-
ment of ROM Volunteers, the Department of Zoology,
University of Toronto, Dr. M. Richardson and K.
Beckley, and S. Bain to R. W. Murphy. For assistance
with field work, we are extremely grateful to B. Nup-
ponen for her encouragement and support during the
data collection and analyses of these calls, as well as
A. Cox, L. Ensor, M. Hanson. B. Kus, J. Rhydderch
and M. Theberge. G. Hochachka and K. Little
recorded the calls and captured the frogs at Ba Be
National Park during May of 1995. Phan Van Mach,
Pham Due Tien, and Cao Kim Thu of IEBR assisted
in many ways with on-site arrangements.
None of our efforts to document Vietnam's fantas-
tic fauna would be possible without the assistance,
constant encouragement, and guidance of Prof. Dr.
Cao Van Sung, Director of IEBR. Le Thi Quang,
Chairman of the Na Hang District Peoples' Commit-
tee, graciously approved the collaborative biodiversity
survey work. Le Hong Binh, Director of Na Hang
Nature Reserve, provided much guidance and exper-
tise about the resources of the Reserve, and the Tay
Minority peoples. Our heartfelt thanks go to the Tay
Vol. 8, p. 106
Asiatic Herpetological Research
1999
Minority families of Pac Ban who not only shared
their houses, but also their lives. For this we are
grateful to Luong Thi May and Le Van Duy ("the
kitchen"). Ma Van Tung and Dinh Thi Thang ("men's
room"), and Ma Thi Nguy ("womens' house") for
putting up with a bunch of, at times rowdy, Canadi-
ans.
Cathay Pacific Airlines significantly contributed to
our efforts by providing free excess baggage during
international travels. Magnalight, Coleman, Johnson
Wax, Tilley Endurables, and Benjamin Film contrib-
uted significantly to the success of our Vietnam biodi-
versity project. This is a contribution from the Centre
for Biodiversity and Conservation Biology, ROM.
Literature Cited
Bourret, R. 1942. Les batraciens de l'lndochine.
Memoires de l'lnstitut Oceanographique de l'lndoch-
ine 6:x+517.
Cocroft, R. B., and M. J. Ryan. 1995. Patterns of
advertisement call evolution in toads and chorus
frogs. Animal Behaviour 49: 283-303.
Duellman, W. E., and R. A. Pyles. 1983. Acoustic
resource partitioning in anuran communities. Copeia
1983: 639-649.
Duellman, W. E. and L. Trueb. 1994. Biology of
Amphibians. The John Hopkins University Press. Bal-
timore, Maryland
Dunlap. D. G., and J. E. Platz. 1981. Geographic
variation of proteins and call in Rana pipiens from the
north central United States. Copeia 1981: 876-879.
Frost. J. S., and J. E. Platz. 1983. Comparative
assessment of modes of reproductive isolation among
four species of leopard frogs (Rana pipiens complex).
Evolution 37: 66-78.
Littlejohn, M. J., and J. D. Roberts. 1975. Acoustic
analy is of an intergrade zone between two call races
of the Limnodynastes tasmaniensis complex (Anura:
Leptodactylidae) in south-eastern Australia. Austra-
lian Journal of Zoology 23: 1 13-122.
Matsui, M., T. Seto. and T. Utsunomiya. 1986.
Acoustic and karyotypic evidence for specific separa-
tion of Polypedates megacephalus from P. leucomys-
tax. Journal of Herpetology 20: 483-489.
Platz, J. E. 1989. Speciation within the chorus frog
Pseudacris triseriata: Morphometric and mating call
analyses of the boreal and western subspecies.
Copeia 1989: 704-714.
Yang, D. 1991. The Amphibia-Fauna of Yunnan.
China Forestry Publishing House [In Chinese].
Zhao, E.-M. (ed.) 1995. Amphibian Zoogeographic
Division of China. Sichuan Journal of Zoology, 1995
Supplement. [In Chinese].
Zhao, E.-M. and K. K. Adler. 1993. Herpetology of
China. SSAR in cooperation with CSSAR, Contribu-
tions to Herpetology 10, 522 pp.
1999
Asiatic Herpetological Research
Vol.8, pp. 107-110
Immuno-chemical Study of TSV-PA, a Specific Plasminogen Activator from the
Venom of Trimeresurus stejnegeri
Yun Zhang1. Wen-hui Lee, Yu-liang Xiong, and Wan-yu Wang
Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming 650223, Yunnan, China
Abstract.- Rabbit antibodies were prepared against purified TSV-PA, a specific plasminogen activator from the
venom of Trimeresurus stejnegeri. They strongly cross-reacted with Crotalinae snake venoms like Trimeresurus
stejnegeri, Trimeresurus mucrosquamatus, Agkistrodon halys and Agkistrodon acutus. In contrast,
immunological cross-reactions with Elapidae snake venoms, Ophiophagus Hannah, Naja naja atra were
relatively lower and no cross-reactions with Bungarus fasciatus, Bungarus multicinctus venoms. On the other
hand, enzymatic assays only revealed the existence of plasminogen activation activity in the venom of
Trimeresurus stejnegeri. Except trypsin, anti-TSV-PA sera and antibodies did not cross-react with other serine
proteases, such as physiological urokinase-type plasminogen activator (u-PA) and tissue-type plasminogen
activator (t-PA). Anti-TSV-PA antibodies inhibited both the amidolytic activity and plasminogen activation
activity of TSV-PA, but they did not inhibit the plasminogen activation activity of u-PA and t-PA.
Key words.- Snake venoms, antibodies, serine proteases
'To whom correspondence should be addressed: Dr. Yun Zhang, Kunming Institute of Zoology, Chinese Acad-
emy of Sciences, Kunming 650223, Yunnan, China. Tel: (86-871 ) 5194279; Fax: (86-871 ) 5191823.
Introduction
TSV-PA, a specific plasminogen activator from the
venom of Trimeresurus stejnegeri, is a serine protease
which specifically cuts the Arg560- Val56 1 bond of
plasminogen and forms plasmin (Zhang et al., 1995).
Sequence analysis indicates that TSV-PA is a typical
snake venom serine protease which show great
homology with other snake venom serine proteases,
such as thrombin-like enzymes (Itoh et al., 1987;
Shieh et al., 1988), protein C activator (McMullen et
al., 1989), and factor V activator (Tokunaga et al.,
1988). Serine proteases are widely distributed in
snake venoms especially in Crotalinae snake venoms
(Stocker, 1990). TSV-PA is the first specific plasmino-
gen activator found in snake venoms. In this investiga-
tion, we reported the immuno-chemical study of TSV-
PA.
Material and Methods
Snake Venoms were from the stock of Kunming Insti-
tute of Zoology, Chinese Academy of Sciences. TSV-
PA from Trimeresurus stejnegeri venom is purified as
described previously (Zhang et al., 1995). TSV-PA
was denatured by adding (3-mecaptoethanol to 1%
final concentration and boiled at 100 °C for 5 min.
Native TSV-PA and denatured TSV-PA were emulsi-
fied with 50% Freund adjuvant and were administered
s.c. at 2 week intervals. Boosts, which were per-
formed when the serum titers were decreasing, were
achieved by injecting s.c. the same components, in the
presence of incomplete Freund adjuvant. The immu-
nization protocol was performed by the dose of
administered antigen 100 (ig per rabbit.
Microtitration plates (96 wells) were coated in
phosphate-buffered saline (PBS) by over night incu-
bation of antigen (5 (ig/ml) and saturation was carried
out with 3% BSA in PBS. Plates were washed with
PBS containing 0.1% Tween-20. The solutions to be
tested (100 |il/well), diluted in PBS containing 3%
BSA, were incubated 1 hour at 37 °C, then washed.
Peroxidase-labelled goat antibodies anti-rabbit immu-
noglobulins (Biosys, Compiegne) were added at a
1:2000 dilutions, incubated 1 hour at 37 °C and
washed. Substrate for peroxidase (O-phenylenedi-
amine dihydrochloride in 10 mM sodium phosphate,
pH 7.3, 0.01% H2G*2) were added and the absorbance
was recorded at 405 nm with a Dynatech microplate
reader.
Antibodies (IgG) were purified from the sera by
double ammonium sulfate precipitations (35% final
concentration), and then dialyzed against PBS. Inhibi-
tion of enzymatic activity was carried out by preincu-
bating for 30 min at 37 °C a fixed concentration of the
enzyme (5 Ug/ml) with variable amounts of antibodies
Vol. 8, p. 108
Asiatic Herpetological Research
1999
>
o
CD
c
E
<i>
CE
Table 1 . The titers of the antibodies against TSV-PA (a
specific plasminogen activator from the venom of Trim-
eresurus stejnegen)
Ig G concentration (mg/ml)
Figure 1. Inhibition of plasminogen activation by IgG
against native and denatured TSV-PA. Fixed concen-
trations of TSV-PA, human two chains lower-molecular
weight urokinase (u-PA) or human two chains tissue
type plasminogen activator (t-PA) were incubated with
various concentrations of antibodies against TSV-PA
for 30 min in 37 °C. Then the remaining plasminogen
activation activity was determined and expressed as
the percentage of the original values. (O) TSV-PA test,
(•) TSV-PA control, (A) TSV-PA test with anti-dena-
tured TSV-PA antibodies, (♦) u-PA test, (<3>) u-PA con-
trol, (■) t-PA test, (□) t-PA control.
and by testing the residual enzymatic activity. Plasmi-
nogen activation activity and amidolytic activity of
the enzymes were assayed as described by Zhang et
al. (1995).
Results
We immunized rabbits with purified TSV-PA, both in
its native and denatured forms. Table 1 shows that the
antiserum directed against native TSV-PA has a much
higher ELISA titer than that directed against dena-
tured TSV-PA, showing that native TSV-PA is much
more antigenic than denatured TSV-PA. On the other
hand, antiserum directed against native TSV-PA has a
much lower ELISA titer when coating the plate with
denatured TSV-PA, indicating that large parts of the
antibodies raised against native TSV-PA are against
comformational epitopes of the protein.
In the first series of experiments, we examined the
immunological cross-reactions by ELISA. The anti-
TSV-PA antibodies (from here, if not specially noted,
anti-TSV-PA serum and antibodies means those raised
against native TSV-PA) cross-reacted with TSV-PA
and Trimeresurus stejnegen venom. In the mean time,
they cross-reacted with several other Crotalinae snake
venoms in which we did not find the activity of plas-
minogen activation. From the ELISA titers, we can
see, first, the immunological cross-reaction with ven-
oms from Crotalinae snakes are much higher than
with those from Elapidae snake venoms. Second,
ELISA titers were defined as the serum diluuon or lmmunoglubin concentrauon that
produced half of the maximal response. The indicated values are the means of three
independent experiments, standard deviations being 10%. (1) means immuno-cross
reactions with anti -denatured TSV-PA antibodies.
even though we did not find plasminogen activity in
other venoms, but in these venoms such as Trimeresu-
rus mucrosquamatus, Agkistrodon halys and Agkistro-
don acutus there are serine proteases which are very
similar with TSV-PA in structure. This observation is
also coincident with the sequence comparison of
TSV-PA with other snake venom serine proteases like
thrombin-like enzymes, protein C activator and factor
V activator (Zhang et al., 1995). The sequence of
TSV-PA shows 64% homology with thrombin-like
enzyme from Trimeresurus flavoviridius.
We further analyzed the immunological cross-
reactions of anti-TSV-PA antibodies with other serine
proteases. T: strongly cross-reacted with batrox-
obin, a thrombin-like enzyme from Bothrops atrox
venom. In addition, they only slightly cross-reacted
with trypsin (Table 1). Even TSV-PA shares the same
biological activity (plasminogen activation) with
physiological activators, u-PA and t-PA, there is no
immunological cross-reactions among them. These
results is in agreement with that the venom serine pro-
teases which have been well studied like thrombin-
like enzymes belong to trypsin-kallikrein subfamily
(Itoh et al., 1987; 1988, McMullen et al., 1989).
1999
Asiatic Herpetological Research
Vol. 8, p. 1()9
1 20 40
TSV-PA VFGGDECNINEHRSLWLFN SNG--FLCGGTLINQDWWTAAHC
batroxobin VIGGDECDINEHPFLAFMYY SPR — YFCGMTLINQEWVLTAAHC
trypsin I IVGGYTCPEHSVPYQVSL NSGYHFCGGSLINDQWWSAAHC
t-PA IKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFP
u-PA IIGGEFTTIENQPWFAAIYRRHR-GGSVTYVCGGSLISPCWVISATHCFID-YP
60 80
TSV-PA DSNNFQLLFGVHSKKILNEDEQTRDPKEKFFCPNRKKDDEV — DKDIMLIKLDS
batroxobin NRRFMRIHLGKHAGSVANYDEWRYPKEKFICPNKKKNVIT — DKDIMLIRLDR
trypsin I YKSRIQVRLGEHNINVLEGDEQF-INAAKIIKHPNYSSWTL--NNDIMLIKLSS
t-PA P-HHLTVILG-RTYRWPGEEEQKFEVEKYIVHKEFDDDT--YDNDIALLQLKS
u-PA KKEDYIVYLG-RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRS
100 120 140
TSV-PA SVSNSEH IAPLSLPSSP PSVGSVCRIMGWGKTIPTKEIYPDVPHCAN
batroxobin PVKNSEH IAPLSLPSNP PSVGSVCRIMGWGAITTSEDTYPDVPHCAN
trypsin I PVKLNAR VAPVALPSAC APAGTQCLISGWGNTLSNGVNNPDLLQCVD
t-PA DSSRCAQESSWRTVCLPPADLQLPDW-TECELSGYGKHEALSPFYSERLKEAH
u-PA KEGRCAQPSRTIQTICLPSM-YNDPQFGTSCEITGFGKENSTDYLYPEQLKMTV
160 180
TSV-PA INILDHAVCRTA-YSWRQVANTTLCAGILQGG RDTCHFDSGGPLICNG
batroxobin INLFNNTVCREA-Y--NGLPAKTLCAGVLQGG IDTCGGDSGGPLICNG
trypsin I APVLSQADCEAA-YP-GEITSSMICVGFLEGG KDSCQGDSGGPWCNG
t-PA VRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLN
u-PA VKLISHRECQQPHYYGSEVTTKMLCAADPQWKT DSCQGDSGGPLVCSL
200 220 234
TSV-PA I FQGIVSWGGHPCGQPGEPGVYTKVFDYLDWIKSIIAGNKDATCPP
batroxobin Q FQGILSWGSDPCAEPRKPAFYTKVFDYLPWIQSIIAGNKTATCP
trypsin I Q LQGIVSWG-YGCALPDNPGVYTKVCNFVGWIQDTIAAN
t-PA DGRMTLVGIISWG-LGCGQKDVPGVYTKVTNYLDWIRDNMRP
u-PA QGRMTLTGIVSWG-RGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Figure 2. Amino acid sequence comparison of TSV-PA with batroxobin, rat trypsin, human t-PA and u-PA.
The sequence comparison was performed with a Clustal V software package in a computer. Sequences were from
the following sources: TSV-PA, Zhang et al. ( 1995); batroxobin, Itoh et al. ( 1987); rat trypsin, MacDonald et al.
( 1982); human t-PA and u-PA protease domains, Pennica et al. (1983) and Steffens et al. (1982).
In second series of experiments, we tested the
inhibitory effect of antibodies directed against TSV-
PA on the enzymatic activities of TSV-PA, u-PA, t-PA
and other proteases. Figure 1 shows the plasminogen
activation inhibition by antibodies against both native
and denatured TSV-PA. In agreement with the results
above, anti-TSV-PA antibodies did not inhibit the
plasminogen activation activity of u-PA and t-PA. On
the contrast, both anti-native-TSV-PA and anti-dena-
tured-TSV-PA antibodies inhibited plasminogen acti-
vation by TSV-PA. Further experiments expressed
that only anti-native-TSV-PA antibodies inhibited the
amidolytic activity of TSV-PA, but anti-denatured-
TSV-PA antibodies did not. Combining the results of
figure 1 and the inhibition of amidolytic activity of
TSV-PA, we could find that anti-native-TSV-PA anti-
bodies inhibited both amidolytic and plasminogen
activation activities of TSV-PA, on the other hand,
anti-denatured-TSV-PA antibodies did not inhibit
amidolytic activity of TSV-PA, but inhibited plasmi-
nogen activation by TSV-PA. These results indicate
that the inhibition of plasminogen activation by anti-
denatured-TSV-PA antibodies is not caused by the
block of catalytic centre but by the block of the sub-
strate binding site. Probably, this is caused by a piece
of peptide in the enzyme which involves in the bind-
ing of the substrate, especially for large protein sub-
strate binding, and which appears as a sequential
Vol. 8, p. 110
Asiatic Herpetological Research
1999
epitope. Both anti-native and anti-denatured TSV-PA
antibodies did not inhibit the thrombin-like activity of
Trimeresunts stejnegeri and Agkistrodon acutus ven-
oms.
Figure 2 shoes the sequence comparison among
TSV-PA, batroxobin, rat trypsin, human t-PA and u-
PA. TSV-PA shares 63% sequence identity with
batroxobin (a thrombin-like enzyme), 42% with rat
trypsin, but only 23% with human u-PA and 21% with
human t-PA. The sequence comparison results are in
agreement with the immuno-chemical studies above.
Discussion
Snake venoms contain numerous different proteases
which act on blood cascade (Stocker, 1990). Bio-
chemically, two main classes of these protease are
recognized: serine proteases and mealloproteinases.
For one group of venom serine proteases, they share a
trypsin homologous catalytic domain and the molecu-
lar weights are usually around 25 kDa-35 kDa
depending on the carbohydrate content of the enzyme.
Even the sequence similarity among them are around
65-70%, for example thrombin-like enzymes (Itoh et
al.. 1987; Shieh et al., 1988), protein C activator
(McMullen et al., 1989), factor V activator (Tokunaga
et al., 1988), kallikrein-like enzyme (Komori et al.,
1988) and newly determined plasminogen activator
(Zhang et al., 1995), this group of venom serine pro-
tease is characterized by their highly divergent sub-
strate specificity. Unlike their trypsin homologous,
they are usually highly specific. The explanation of
their highly homology primary sequence verse their
highly divergent substrate specificity (for protein sub-
strate) and the determination of their substrate binding
site is extremely significant in our understanding of
protein structure-function relationship and further the
protein reconstruction for medical purpose in future.
Acknowledgments
The study was supported in part by the national 863
plan, the Director fund of Chinese Academy of Sci-
ences, and in part by the fund of Yunnan Science and
Technology Commission C0085M.
Literature Cited
Itoh, N., N. Tanaka, S. Mihashi and I. Yamashina.
1987. Molecular cloning and sequence analysis of
cDNA for batroxobin, a thrombin-like snake venom
enzyme. Journal of Biological Chemistry 262: 3132-
3135.
Itoh, N., N. Tanaka, I. Funakoshi, T. Kawasaki, S.
Mihashi and I. Yamashina. 1988. Organization of the
gene for batroxobin, a thrombin-like snake venom
enzyme. Journal of Biological Chemistry 263: 7628-
7632.
Komori, Y, T. Nikai and H. Sugihara. 1988. Biochem-
ical and physiological studies on a kallikrein-like
enzyme from the venom of Crotalus viridis viridis
(Prairie rattlesnake). Biochimica et Biophysica Acta
967:92-102.
MacDonald, R. J., S. J. Stary and G. H. Swift. 1982.
The primary sequence of rat trypsin I, as deduced
from its cDNA. Journal of Biological Chemistry 257:
9724-9732.
McMullen, B. A., K. Fujikawa and W. Kisiel. 1989.
Primary structure of a protein C activator from Agki-
strodon contortrix contortrix venom. Biochemistry
28: 674-679.
Pennica, D., W. E. Holmes, W. J. Kohr, R. N. Harkins,
G. A. Vehar, C. A. Ward, W. F. Bennett, E. Yelverton,
P. H. Seeburg, H. L. Heyneker, D. V Goeddel and D.
Collen. 1983. Cloning and expression of human tis-
sue-type plasminogen activator cDNA in E. coli.
Nature 301: 214-221.
Shieh, T. G., S. I. Kawabata, H. Kihara. M. Ohno and
S. Iwanaga. 1988. Amino acid sequence of a coagu-
lant enzyme, flavoxobin, from Trimeresurus flavoviri-
dius venom. Journal of Biochemistry 103: 596-605.
Steffens, G. J., W. A. Gunler, F. Otting, E. Frankus
and L. Flohe. 1982. The complete amino acid
sequence of low molecular mass urokinase from
human urine. Hoppe-Seyler Zeitschrift fur Physiolo-
gische Chemie 363: 1043-1058.
Stocker, K. 1990. Snake venom proteins affecting
hemostasis and fibrinolysis. Pp97-130. In K. Stocker
(ed), Medical Use of Snake Venom Proteins. CRC
Press, Inc., New York.
Tokunaga, F, K. Nagasawa, S. Tamura, T. Miyata, S.
Iwanaga and W. Kisiel. 1988. The factor V-activating
enzyme (RVV-V) from Russell's viper venom. Identi-
fication of isoproteins RVV-Va, -Vb and Vr and their
complete amino acid sequence. Journal of Biological
Chemistry 263: 17471-17481.
Zhang, Y, A. Wisner, Y L. Xiong and C. Bon. 1995. A
novel plasminogen activator from Trimeresurus stej-
negeri snake venom. Journal of Biological Chemistry
270: 10246-10255.
Asiatic Herpetological Resean /.
Vol. S, pp. 111-113
A New Locality for Cuora pani Song 1984 with Comments on its Known Range
James Ford Parham1 and Dong Li2
Department of Integrative Biology, University of California, Berkeley, CA 94720-3140 USA, email:
[email protected]. 'Southwest Electric Power Design Institute, Dong Feng Road, Chengdu,
Sichuan. 610061, China
Abstract.- The discovery of Cuora pani Song 1984 in northern Sichuan Province. China lends credence to the
type locality in southern Shaanxi Province. The localities reported from southern Yunnan Province (the type
region of C. ''chriskarannarum " I require verification.
Key words.- Replilia, Chelonia, Bataguridae, Cuora pani, C. chriskarannarum, C. yunnanensis, C. zhoui, China
Sichuan. Yunnan, distribution, biogeography
Cuora pani Song. 1984 is the first of many new Chi-
nese chelonians to he described over the past fifteen
years. The original description was based on two
specimens from the Qin Ling Mountains (Pingli
County, southern Shaanxi Province). Later. C. pani
was inadvertently redescribed from southern Yunnan
Province as C. chriskarannarum by Ernst and
McCord (1987) based on pet-trade specimens. De
Bruin (1988) first suggested the synonymy of C.
chriskarannarum with C. pani. Subsequently, other
authors (e.g., Phillipen pers. comm. in Stubbs, 1989;
Pritchard, 1990; Zhao, 1990; McCord and Iverson,
1991) have either independently come to the same
conclusion or at least agree with it. McCord and Iver-
son ( 1991 ) recognize that this synonymy requires that
C. pani is reported from two areas which are sepa-
rated by nearly 1200 km (Fig. 1). Given this unlikely
distribution, they raise the possibility that one of the
localities (if not both) are erroneous, but withhold fur-
ther speculation since the distributions of all Cuora
are very poorly understood. In this paper we report a
new locality for C. pani which may shed some light
on this issue.
In April of 1994 one of us (DL) heard reports of a
turtle with a moveable plastron from people living in
northern Sichuan. Due to the scarcity of these turtles,
it took five years to acquire the first specimens. Three
individuals were purchased in Guangyuan City by DL
and were reportedly captured in the nearby tributaries
of the Jialing River (105°. 40' E, 32° 30' N; Fig. 1).
Two of the turtles are females; the largest is 180 mm
in straight-line carapace length and weighs 625
grams. The smaller female is 110 mm in carapace
length and 130g . The only male is a juvenile (Fig. 2),
98 mm in carapace length and weighing 95g. All three
turtles match descriptions of Cuora pani (Song, 1984;
McCord and Iverson, 1991). Diagnostic characters
include an olive head, olive-brown carapace, and.
most importantly, a plastron with dark pigment asso-
ciated with the seams in the form of rectangular bars.
The presence of these turtles in northern Sichuan
Province lends credence to the type locality of Cuora
pani in southern Shaanxi Province. The new locality
also closes the distributional gap between the southern
Shaanxi locality and the type region of C.
"chriskarannarum" from nearly 1200 km to about
1050 km. Nevertheless, we feel that the Sichuan local-
ity, by verifying the presence of C pani in the north-
ern tributaries of the Yangtze, casts doubt on the
validity of the C. "chriskarannarum" localities. The
latter localities become even more suspicious when
the distribution of other species of Cuora are taken
into account. For example, the type locality of Cuora
aurocapitata (Luo and Zong, 1988) is in the eastern
Yangtze drainage. Cuora aurocapitata is a close rela-
tive of C. pani, and may prove to be conspecific
(McCord and Iverson, 1991 ). The close relation of C.
pani and C. aurocapitata is reflected by their biogeo
graphical distribution since both taxa inhabit the
Yangtze River or its northern tributaries.
The type region of C. "chriskarannarum" is in tr.e
drainage of the Red River. Two divides separate these
localities from the type region of C. pani (in souths a
Yunnan the Pearl River drainage lies between the R<-d
River and the southwestern tributaries of the Yangtze !
We can not rule out a corridor between the Red River
and the Yangtze in northern Yunnan, but note that, in
addition to a mountainous divide, other species of
Cuora historically inhabited this area. Cuora zhoui
1 This specimen has been accessioned into the Chengdu
Institute of Biology herpetological collection as CIB-
9910544
Vol. 8, p. 112
Asiatic Herpetological Research
1999
Figure 1 . Map of China showing known localities of select aquatic Cuora species. A= C. aurocapitata, P= C. pani,
Y= C. yunnanensis, Z= C. zhoui. Localities were taken from original descriptions, McCord and Iverson (1991 ), and
Iverson (1992).
Zhao, 1990 (= Cuora pallidicephala McCord and
Iverson, 1991) and Cuora yunnanensis (Boulenger,
1906) are both reported from tributaries of the
Yangtze in northern Yunnan (Fig. 1). Like C.
"chriskarannarum" , the Yunnan records for C. zhoui
(the type series of C. "pallidicephala") are derived
from the pet trade (McCord and Iverson, 1991) and
are from a different province than the type description
(Zhao, 1990). Unfortunately, the type series of C.
zhoui itself was purchased from a market so the exact
provenience of this species remains uncertain. The
localities for C. yunnanensis, however, are probably
valid since they predate the increased turtle trade
associated with recent economic reforms in China.
The presence of at least one, and possibly two, conge-
ners within the reported range of C. pani is strange
since aquatic Cuora are generally allopatric.
A historic lowland connection between the south-
ern Yunnan and northern Yangtze Cuora pani locali-
ties would require even greater geographical
separation. Furthermore, this hypothetical connection
would pass through the known distribution of C. tri-
fasciata (McCord and Iverson, 1991), a close relative
of C. pani and C. aurocapitata (de Bruin, 1988; Bus-
kirk, 1989). In short, if the Yunnan Province C. pani
localities are real, the biogeographical history of these
turtles is very complex.
It is important to note that many of the localities
for Chinese turtles, including the one reported here,
are based upon market-bought or else pet trade ani-
mals. Pet trade localities, such as the southern Yunnan
Cuora pani localities, should be treated with caution.
The demand for rare species by turtle fanciers greatly
increases their value and, therefore, there is incentive
to hide the true locality as a "trade secret". Direct
cooperation with people from turtle-bearing prov-
inces, however, can help determine the distributions
of these rare turtles.
1999
Asiatic Herpetological Research
Vol. 8, p. 113
Figure 2. A) Ventral view of Cuora pani (male) from
northern Sichuan Province (photo by Ermi Zhao). B)
Lateral view of same individual (Photo by JFP).
Acknowledgments
We would like to thank Ermi Zhao for introducing the
authors and facilitating their collaboration. Yuezhao
Wang and Zhijun Liu provided critical assistance
regarding the acquisition and accession of CIB-
9910544. Ron de Bruin and Arie van der Meijden sup-
plied useful information on the synonymy of Cuora
pani and C. chriskarannarum. Karen Klitz created the
map for Fig. 1 and Ted Papenfuss gave editorial assis-
tance. We thank Jim Buskirk for his help and advice
along the way. Funding was provided by the Vice
Chancellor's Fellowship of the University of Califor-
nia and Grant # STZ-1-02 of the Chinese Academy of
Sciences.
Literature Cited
Boulenger, G. A. 1906. Descriptions of new reptiles
from Yunnan. The Annals and Magazine of Natural
History 7(17):567-568.
Buskirk, J. R. 1989. New locality records for Chinese
non-marine chelonians. Chinese Herpetological
Research 2:65-68.
de Bruin R. 1988 Twee nieuwe Cuora-soorten uit
China. Lacerta 47:4-6
Ernst C. H. and W. P. McCord. 1987. Two new turtles
from southeast Asia. Proceedings of the Biological
Society of Washington 100(3):62 4-628.
Iverson, J. B. 1992. A revised checklist with distribu-
tion maps of the turtles of the world. Green Nature
Books, Homestead, FL. 363 pp.
Luo B. and Y Zong. 1988. A new species of Cuora-
Cuora aurocapitata. Acta Herpetologica Sinica 3:13-
15. (In Chinese with English abstract)
McCord, W. P. and J. B. Iverson. 1991. A new box tur-
tle of the genus Cuora (Testudines: Emydidae) with
taxonomic notes and a key to the species. Herpetolog-
ica 47(4):407-420.
Stubbs, D. 1989. Tortoises and freshwater turtles: an
action plan for their conservation. IUCN/SSC Tortoise
and Freshwater Turtle Specialist Group, Canterbury,
England. 48 pp.
Pritchard, P. C. H. 1990. Review of: Turtles of the
World, by Carl H. Ernst and R. W. Barbour. Copeia
1990:602-607.
Song, M. T 1984. A new species of the turtle genus
Cuora (testudoformes: Testudinidae) Acta Zootaxc-
nomica Sinica 9(3):330-332. (In Chinese with English
abstract)
Zhao, E., T Zhou, and P. Ye. 1990. A new Chinese
box turtle (Testudinata: Emydidae )--Cuora zlioui. Pp.
213-216. In E. Zhao (ed.), From Water Onto Land.
Chinese Society for the Study of Amphibians and
Reptiles, Beijing. (In Chinese with English abstract)
1999 Asiatic Herpetological Rl Vol. 8, pp. 1 14-1 18
Guidelines for Manuscript Preparation and Submission
Summary
Manuscripts must:
1) be written in English.
2) be of letter quality (laser printed or typewritten on bond paper).
3) include camera ready figures (if any).
4) include complete and accurate literature citations.
5) include complete and accurate localities with latitude and longitude.
6) include a camera ready map illustrating regions discussed (when applicable).
Tips for electronic submission
Do not use multiple tabs or spaces to separate columns in tables.
• Do not type authors names in all capitals in literature cited.
• Do not use two spaces following a period, or for any other purpose.
• Do not attempt to recreate the format of the journal in your manuscript.
Please use only simple formatting limited to italics, boldface, and underline.
Manuscripts failing to meet these criteria will be returned without review for correction.
Purpose and Content
Asiatic Herpetological Research publishes articles concerning but not limited to Asian herpetology. The editors
encourage publications from all countries in an attempt to create an open forum for the discussion of Asian her-
petological research.
Articles should be in standard scientific format and style. The following sections should be included:
Title
The title should reflect the general content of the article in as few words as possible. The editors encourage titles
that summarize the main findings of the article.
Names and Addresses
The names and addresses of all authors must be complete enough to allow postal correspondence. Please include
email and World Wide Web addresses if applicable.
Abstract
The abstract should briefly summarize the nature of the research, its results, and the main conclusions. Abstracts
should be less than 300 words.
1999 Asiatic Herpetological Research Vol. 8, p. 115
Key Words
Key words provide an index for the filing of articles. Key words provide the following information (when appli-
cable): 1 ) Taxonomy (e.g. Reptilia, Squamata, Gekkonidae, Gekko gecko). 2) Geography (e.g. China, Thailand).
3) Subject (e.g. taxonomic validity, ecology, biogeography). The order of taxonomy, geography, and subject
should be observed.
Text
Manuscripts must be in English and spelling must be correct and consistent. Use Webster's New International
Dictionary for reference. For clarity, use active voice whenever possible. For example, the following sentences in
active voice are preferable to those in passive voice.
Active voice: "Lizards were extremely common on the site." and "I examined three female snakes."
Passive voice: "Lizards were observed to be extremely common on the site." and "Three female snakes were
examined."
Abbreviation
Do not abbreviate unless the full phrase has already appeared. Scientific names may be abbreviated only if they
have appeared fully in the same paragraph. Never begin a sentence with an abbreviation of a scientific name.
Statistics
Statistics must be accompanied by sample sizes, significance levels, and the names of any tests. Investigators
should pay careful attention to independence and applicability of tests, and randomness of samples. One of the
most frequent examples of nonindependence is the use of multiple, paired t-tests instead of analysis of variance
(anova). In general, multiple tests on the same data set are not valid. Descriptive statistics are in many cases more
appropriate than inferential statistics.
Standard Format
Manuscripts following standard format should include introduction, methods, results, and discussion sections.
While other formats are acceptable, the editors encourage the use of standard format. Please do not type in all
capital letters.
Introduction
The introduction typically states the significance of the topic and reviews prior research.
Material and Methods
This section should clearly state where, when, and how research was carried out. Include sample sizes. Protocols
designed by other investigators must be properly cited. Research materials and their manufacturers should be
listed. The reader must be able to replicate the methods of the author(s).
Results
This section states the results and their significance to the investigation. Figures and tables may be used to clarify,
but not to replace, results statements in the text. Statistics should be used when applicable. Large amounts of data
should be avoided, or included as an appendix at the end of the article.
Discussion
The discussion is a synthesis of the introduction and the results. No new information should be discussed unless
it was presented in the results section. New findings should be discussed in relation to prior research. The
author! s) should feel free to present several possible interpretations of the results. The editors particularly
encourage suggestions of future research in Asian herpetology.
Vol. 8, p. 116 Asiatic Herpetological Research 1999
Manuscript Preparation
Overview
Please do not attempt to replicate the formatting style of AHR in your manuscript. All formatting except italics
will be removed in the production process. Bold and underlined text should be used only to identify section head-
ing levels (see below). Extraneous formatting is counterproductive and increases the production costs of the jour-
nal. There are a few simple guidelines that authors must follow.
Section Headings
Articles will be published using three section heading styles. All heading levels must be on their own line, and
left justified. For the purposes of manuscript submission. Level 1 heading is bold, and generally reserved for
Introduction, Material and Methods, Results, and Discussion: Level 2 is italic, and Level 3 is underlined.
Figures
Figures must be referenced in order in the text. Each figure illustration (line art or photograph) submitted must
be "camera ready" for publication with no modifications necessary other than reduction. AHR does not publish
"plates"; please refer to these as figures numbered sequentially. Do not write on figure; do not mount more than
one figure to a sheet. AHR cannot be responsible for redrawing, touching up, or otherwise modifying figure illus-
trations for authors. In addition, figure illustrations submitted must:
1 ) be of publication quality with typeset text.
2) be mounted on a separate 21.5 x 28 cm (8.5 x 11 inch) sheet with figure number on back.
3 ) be on a separate sheet from figure legend.
4) not have poor type or handwriting on the face of the figure.
5) The TIFF file format is preferable for electronic versions of figures, but Photoshop, JPEG, or PICT formats are
acceptable. Resolution of electronic versions of figures must be at least 600 dpi for line art, or 300 dpi for gray-
scale and color images.
6) Figures will be reduced to either 1 column (3.25") or two columns (6.5").
Times Roman typeface is preferred. In order to avoid wasted effort, please follow the above instructions care-
fully. Please note: AHR will not alter or lay out figures for publication. Any figure requiring modification will be
returned, and may cause significant delay in publication.
Figure Legends. Figure legends should be typed on a separate sheet. Legends should explain the figure without
reference to the text. A figure and legend should make sense if separated from the rest of the article. For example:
Figure 2. Lateral view of live Psammodynastes pulvendentus holding a prey lizard (Anolis car-
olinensis). Note buccal tissue surrounding the enlarged anterior maxillary and dentary teeth of
the snake.
Color Figures. AHR may publish color figures at the discretion of the editors. AHR is now published both on
paper and electronically. Printing costs of color figures may be required for the paper version of AHR. Color fig-
ures will be published free of charge in the electronic version. If you submit color figures, please indicate if you
wish them to be considered for publication in color in the paper version. Otherwise, they will be converted to
black and white in the paper version.
Tables
Tables must be referenced in order in the text. Each table should be typewritten, double spaced on a separate
sheet. For electronic submission, prepare tables as columns separated by one tab only. Do not use spaces to sepa-
rate columns. End rows with a single carriage return.
Typeface
Twelve point type is preferred. Supply a detailed list of special characters (greek letters, male or female symbols,
etc.) that are not part of a standard font.
1999 Asiatic Herpetological Research Vol. 8, p. 117
Literature Cited
Accurate and standard references are a crucial part of any article. This is especially important when dealing with
publications from many different countries. The reader must be able to precisely identify any literature cited.
References in the text must be checked for consistency with references in the literature cited section. All refer-
ences cited in the text must be in the literature cited section. The literature cited section may not contain any ref-
erences not mentioned in the text. Articles containing inaccurate or inconsistent literature citations will be
returned for correction.
References in Text. 1 ) References to articles by one or two authors must include both surnames in the order they
appear in the original publication. References to articles by more than two authors must include the first author's
surname, followed by "et al." 2) The year of article follows the authors, separated only by a space. 3) References
with the same author and year are distinguished by the lower case characters "a, b, c, . . ." 4) References cited in
text are listed in alphabetical order by first author.
For example, "My results also incorporate literature records (Marx et al., 1982; Marx and Rabb, 1972;
Mertens, 1930; Pope. 1929; Wall, 1909, 1910a, 1910b, 1910c)."
References in Literature Cited. 1 ) References must include all authors, in the order that they appear in the orig-
inal publication; "et al." is never used in a literature cited section. 2) The first author is listed surname first, ini-
tial(s) last. All other authors are listed initial(s) first, surname last. 3) References with the same author and year
are distinguished by the lower case characters, "a, b, c, . . ." 4) References cited are listed in alphabetical order by
first author. 5) Names of journals are not abbreviated. See below for examples:
Journal article
Dial, B. E. 1987. Energetics and performance during nest emergence and the hatchling frenzy in loggerhead sea
turtles (Caretta caretta). Herpetologica 43(3):307-315.
Journal article from a journal that uses year instead of volume
Gatten, R. E. Jr. 1974. Effect of nutritional state on the preferred body temperatures of turtles. Copeia
1974(4):912-917.
Journal article, title translated, article not in English
Ananjeva, N. B. 1986. [On the validity of Megalochilus mystaceus (Pallas, 1776)]. Proceedings of the Zoological
Institute, Leningrad 157:4-13. (In Russian).
Note that for Acta Herpetologica Sinica, the year must precede the volume number. This is to distinguish
between the old and new series, and between 1982-1987, Vols. 1-6 (new series) and 1988 with no volume number,
numbers 1 and 2 (new series).
Cai, M., J. Zhang, and D. Lin. 1985. [Preliminary observation on the embryonic development of Hynobius chin-
ensis Guenther]. Acta Herpetologica Sinica 1985, 4(2): 1 77- 180. (In Chinese).
Book
Pratt, A. E. 1892. To the snows of Tibet through China. Longmans, Green, and Co., London. 268 pp.
Article in book
Huey, R. B. 1982. Temperature, physiology, and the ecology of reptiles. Pp. 25-91. In C. Gans and F. H. Pough
(eds.), Biology of the Reptilia, Vol. 12, Physiological Ecology. Academic Press, New York.
Government publication
United States Environmental Data Service. 1968. Climatic Atlas of the United States. Environmental Data Ser-
vice, Washington, D. C.
Abstract of oral presentation
Arnold, S. J. 1982. Are scale counts used in snake systematics heritable? SSAR/HL Annual Meeting. Raleigh,
North Carolina. [Abstr].
Vol. 8, p. 118 Asiatic Herpetological Research 1999
Thesis or dissertation
Moody, S. 1980. Phylogenetic and historical biogeographical relationships of the genera in the Agamidae (Rep-
tilia: Lacertilia). Ph.D. Thesis. University of Michigan. 373 pp.
Anonymous, undated
Anonymous. Undated. Turpan brochure. Promotion Department of the National Tourism Administration of the
People's Republic of China, China Travel and Tourism Press, Turpan. Xinjiang Uygur Autonomous Region,
China.
Copyright
Asiatic Herpetological Research reserves the copyrights to all material published therein, except that excluded
by permission of the editors. Any material under a prior copyright submitted to Asiatic Herpetological Research
must be accompanied by the written consent of the copyright holder.
Submission of Manuscripts
Authors should submit letter quality, double spaced, single-sided manuscripts both in English and in the original
language on 21.5 x 28 cm (8.5 x 1 1 inch) white bond paper. If possible, include a computer diskette containing
the manuscript. Macintosh diskettes, Zip disks, or 3.5" magneto-optical (MO), containing Adobe FrameMaker,
Word Perfect, Microsoft Word, Claris Works, Macwrite, Write Now, or text files, or 3.5" MS/PC DOS diskettes.
Zip disks, or 3.5" MO with Adobe FrameMaker, Word Perfect, Microsoft Word, RTF, or ASCII files are prefera-
ble. Please indicate author, computer, file format, and rile name in writing on the disk. The TIFF file format is
preferable for electronic versions of figures, but Photoshop, JPEG, or PICT formats are acceptable. Resolution of
electronic versions of figures must be at least 600 dpi for line art, or 300 dpi for grayscale and color images. Fig-
ures will be reduced to either 1 column (3.25") or two columns (6.5").
Manuscripts will be reviewed. The editors will attempt to choose reviewers whose research knowledge most
closely matches the content of the manuscript.
Asiatic Herpetological Research requests $25 US per printed page from authors with funds available. Please
indicate if funds are available.
Send manuscripts by postal mail to Editors, Asiatic Herpetological Research, Museum of Vertebrate Zoology,
3101 Valley Life Sciences Building, University of California, Berkeley CA 94720-3160 USA.
Send manuscripts by Internet email to [email protected] as a MIME attachment with binhex or
uuencode encoding. If you use email to submit, an editor will acknowledge receipt of your manuscript. Please
note that it is possible for your email message to disappear on the Internet without being delivered. If your mes-
sage is returned, or not acknowledged, you may want to try again or to send your manuscript by postal mail.
Rastegar-Pouyani, Nasrullah. Two New Subspecies of Trapelus agilis Complex (Sauna:
Agamidae) From Lowland Southwestern Iran and Southeastern Pakistan 90
Trepanier, Tanya L., Amy Lathrop, and Robert W. Murphy. Rhacophorus leucomystax in
Vietnam with Acoustic Analyses of Courtship and Territorial Calls 102
Zhang, Yun, Wen-hui Lee, Yu-liang Xiong, and Wan-yu Wang. Immuno-chemical Study of
TSV-PA, a Specific Plasminogen Activator from the Venom of Trimeresurus stejnegeri 107
Parham, James Ford, and Dong Li. A New Locality for Cuorapani Song 1984 with Comments
on its Known Range Ill
Guidelines for Manuscript Preparation and Submission 114
Colophon. Asiatic Herpetological Research is created using FrameMaker 5.5, Acrobat 4, and
Canvas 6 on Power Macintosh computers. The body text is set in Times Roman and the head-
ings in Helvetica. Using digital technology, we consumed less than 200 sheets of paper in the
prepress production of this issue.
ISSN 1051-3825
Al-Johany, Awadh M. The Activity and Thermal Biology of the Fossorial Reptile.
Diplometopon zarudnyi (Amphisbaenia: Trogonophiidae) in Central Saudi Arabia 1
Brown, Rafe M., Alan E. Leviton, and Rogelio V. Sison. Description of a New Species of
Pseudorabdion (Serpentes: Colubridae) from Panay Island, Philippines with a Revised Key to
the Genus 7
Das, Indraneil. Anguis melanostictus Schneider, 1801, a Valid Species of Barkudia
(Sauria: Scincidae) from Southeastern India 13
Das. Indraneil. The Dates of Publication of Amphibian and Reptile Names by Blanford and
Stoliczka in the Journal and Proceedings of the Asiatic Society of Bengal 18
Diong, C.H. and S.Y.T. Soon. Size and Shape Description of Oviductal Eggs of Draco
obscums formusus (Squamata: Agamidae) 25
Dolmen, Dag. Rudolf A. Kubykin and Jo V. Arnekleiv. Diel Activity of Ranodon sibiricus
(Amphibia: Hynobiidae) in Relationship to Environment and Threats 29
Guo, Peng, Fu-ji Zhang, and Yue-ying Chen. The Hemipenes of Chinese Species of
Deinagkistrodon and Gloydius (Serpentes: Crotalinae) 38
Guo. Peng. Fu-ji Zhang, and Yue-ying Chen. Catalogue of Type Specimens of Reptiles in the
Herpetological Collections of Chengdu Institute of Biology, the Chinese Academy of Sciences
43
Jaafar, Ibrahim H., Ahmad Ismail, and Abd-rahman Kurais. Correlations of Reproductive
Parameters of Two Tropical Frogs from Malaysia 48
Jil, Xiang, Ping-yue Sun, Shui-yu Fu, and Hua-Song Zhang. Utilization of Energy and
Material in Eggs and Post-hatching Yolk in an Oviparous Snake, Elaphe taeniura 53
Khan, Muhammad S. and Herbert Rosier. Redescription and Generic Redesignation of the
Ladakhian Gecko Gymnodactylus stoliczkai Steindachner, 1969 60
Kolbintzev, Vladimir. Larissa Miroschnichenko. and Tatjana Dujsebayeva. Distribution and
Natural History of the Lidless Skinks, Asymblepharus alaicus and Ablepharus deserti (Sauria:
Scincidae) in the Aksu-Djabagly Nature Reserve (Western Tian-Shan Mountains), Kazakstan
69
Mao, Wei-ping and Zhao-xian Wang. Seasonal Variations of Testicular and Epididymal
Structure and Plasma Levels of Testosterone in the Soft-shelled Turtle (Pelodiscus sinensis)
75
Niu, Cuijuan, Tingjun Zhang and Ruyong Sun. Food Consumption and Growth of Juvenile
Chinese Soft-shelled Turtles {Pelodiscus sinensis) in Relation to Body Weight and Water
Temperature 81
Rastegar-Pouyani. Nasrullah. First Record of the Lacertid Acanthodactylus boskianus (Sauria:
Lacertidae) for Iran 85
(Continued on inside of back cover)
Rastegar-Pouyani, Nasrullah. Two New Subspecies of Trapelus agilis Complex (Sauna:
Aeamidae) From Lowland Southwestern Iran and Southeastern Pakistan 90
*&*•
Tre'panier, Tanya L., Amy Lathrop, and Robert W. Murphy. Rhacophorus leucomystax in
Vietnam with Acoustic Analyses of Courtship and Territorial Calls 102
Zhang, Yun, Wen-hui Lee, Yu-liang Xiong, and Wan-yu Wang. Immuno-chemical Study of
TSV-PA, a Specific Plasminogen Activator from the Venom of Trimeresurus stejnegeri 107
Parham, James Ford, and Dong Li. A New Locality for Cuorapani Song 1984 with Comments
on its Known Range Ill
Guidelines for Manuscript Preparation and Submission 114
Colophon. Asiatic Herpetological Research is created using FrameMaker 5.5, Acrobat 4, and
Canvas 6 on Power Macintosh computers. The body text is set in Times Roman and the head-
ings in Helvetica. Using digital technology, we consumed less than 200 sheets of paper in the
prepress production of this issue.
ISSN 1051-3825
Al-Johany, Awadh M. The Activity and Thermal Biology of the Fossorial Reptile,
Diplometopon zarudnyi (Amphisbaenia: Trogonophiidae) in Central Saudi Arabia 1
Brown, Rate M, Alan E. Leviton, and Rogelio V. Sison. Description of a New Species of
Pseudorabdion (Serpentes: Colubridae) from Panay Island. Philippines with a Revised Key to
the Genus 7
Das, Indraneil. Anguis melanostictus Schneider, 1 801 , a Valid Species of Barkudia
(Sauna: Scincidae) from Southeastern India 13
Das, Indraneil. The Dates of Publication of Amphibian and Reptile Names by Blanford and
Stoliczka in the Journal and Proceedings of the Asiatic Society of Bengal 18
Diong, C.H. and S.Y.T. Soon. Size and Shape Description of Oviductal Eggs of Draco
obscurus formosus (Squamata: Agamidae) 25
Dolmen, Dag, Rudolf A. Kubykin and Jo V. Arnekleiv. Diel Activity of Ranodon sibiricus
(Amphibia: Hynobiidae) in Relationship to Environment and Threats 29
Guo, Peng, Fu-ji Zhang, and Yue-ying Chen. The Hemipenes of Chinese Species of
Deinagkistrodon and Gloydius (Serpentes: Crotalinae) 38
Guo, Peng, Fu-ji Zhang, and Yue-ying Chen. Catalogue of Type Specimens of Reptiles in the
Herpetological Collections of Chengdu Institute of Biology, the Chinese Academy of Sciences
43
Jaafar, Ibrahim H., Ahmad Ismail, and Abd-rahman Kurais. Correlations of Reproductive
Parameters of Two Tropical Frogs from Malaysia 48
Jil, Xiang, Ping-yue Sun, Shui-yu Fu, and Hua-Song /hang. Utilization of Energy and
Material in Eggs and Post-hatching Yolk in an Oviparous Snake. Elaphe taeniura 53
Khan, Muhammad S. and Herbert Rosier. Redescription and Generic Redesignation of the
Ladakhian Gecko Gymnodactylus stoliczkai Steindachner. 1969 60
Kolbintzev, Vladimir, Larissa Miroschnichenko. and Tatjana Dujsebayeva. Distribution and
Natural History of the Lidless Skinks, Asymblepharus alaicus and Ablepharus deserti (Sauna:
Scincidae) in the Aksu-Djabagly Nature Reserve (Western Tian-Shan Mountains), Kazakstan
69
Mao, Wei-ping and Zhao-xian Wang. Seasonal Variations of Testicular and Epididymal
Structure and Plasma Levels of Testosterone in the Soft-shelled Turtle (Pelodiscus sinensis)
75
Niu, Cuijuan, Tingjun Zhang and Ruyong Sun. Food Consumption and Growth of Juvenile
Chinese Soft-shelled Turtles (Pelodiscus sinensis) in Relation to Body Weight and Water
Temperature 81
Rastegar-Pouyani, Nasrullah. First Record of the Lacertid Acanthodactylus boskianus (Sauria:
Lacertidae) for Iran 85
(Continued on inside of back cover)
Harvard MCZ Library
3 2044 066 300 427