HARVARD UNIVERSITY
Ernst Mayr Library
of the Museum of
Comparative Zoology
*«0*ae
ISSN 1051-3825
Hiaz, R. E., M. T. Leong, L. L. Grismer, and N. S. Yaakob. A New Species of Dibamus
(Squamata: Dibamidae) from West Malaysia
Grismer, L. L., J. L. Grismer, and T. M. Youmans. A New Species of Leptolalax( Anura: Megophryidae)
FROM PULAU TlOMAN, WEST MALAYSIA * *
Leong, T. M. and L. L. Grismer. A New Species of Kukri Snake, Oligodon (Colubridae), from Pulau
Tioman, West Malaysia 12-16
Stuart, B. L. and H. Heatwole. A New Philautus (Amphibia: Rhacophoridae) from Northern Laos 17-21
Diesmos, A. C., G. V. A. Gee, M. L. Diesmos, R. M. Brown, P. J. Widmann, and J. C. Dimalibot.
Rediscovery of the Philippine Forest Turtle, Heosemys leytensis (Chelonia; Bataguridae), from
Palawan Island, Philippines 22-27
Feldman, C. R. and J. F. Parham. Molecular Systematics of Old World Stripe-Necked Turtles
(Testudines: Mauremys ) 28-37
Hutchison, J. H„ P. A. Holroyd, and R. L. Ciochon. A Preliminary Report on Southeast Asia’s Oldest
Cenozoic Turtle Fauna from the Late Middle Eocene Pondaung Formation, Myanmar 38-52
Joyce, W. G. and C. J. Bell. A Review of the Comparative Morphology of Extant Testudinoid Turtles
(Reptilies: Testudines) 53-109
Le, Minh, T. Hoang, and D. Le. Trade Data and Some Comments On the Distribution of Mauremys
ANNAMENSIS (SlEBENROCK, 1 903) 110-113
Perala, J. and R. Bour. Neotype of Testudo terrestris ForsskAl, 1775 (Testudines, Testudinidae) 114-119
Schilde, M., D. Barth, and U. Fritz. An Ocadia sinensis x Cyclemys shanensis hybrid (Testudines:
Geomydidae) 120-125
Shi, H„ Z. Fan, F. Yin, and Z. Yuan. New Data on the Trade and Captive Breeding of Turtles in
Guangxi Province, South China 126-128
Stuart, B. L. and S. G. Platt. Recent Records of Turtles and Tortoises from Laos, Cambodia, and
Vietnam 129-150
Auffenberg, K., K. L. Krysko, and W. Auffenberg. Studies on Pakistan Lizards: Cyrtopodion stoliczkai
(Steindachner, 1867) (Gekkonidae: Gekkoninae) 151-160
Dulger, B., j. H. Ugurta§, and M. Sevinq:. Antimicrobial Activity in the Skin Secretion of Bufo viridis
(Laurenti, 1768) 161-163
Du§en, S., M. Oz, and M. R. Tunq:. Analysis of the Stomach Contents of the Lycian Salamander
Mertensiella luschani (Steindachner, 1891) (Urodela: Salamandridae), Collected from Southwest
Turkey 164-167
Ebrahimi, M., H. G. Kami, and M. Stock. First Description of Egg Sacs and Early Larval Development
in Hynobiid Salamanders (Urodela, Hynobiidae, Batrachuperus ) from North-Eastern Iran 168-175
Jarrar, B. M., and N. T. Taib. Histochemical Characterization of the Lingual Salivary Glands of the
House Gecko, Ptyodactylus hasselquistii (Squamata: Gekkonidae) 176-181
Kami, H. G. The Biology of the Persian Mountain Salamander, Batrachuperus persicus (Amphibia,
Caudata Hynobiidae) in Golestan Province, Iran 182-190
Khan, M. S. Annotated Checklist of Amphibians and Reptiles of Pakistan 191-201
(Continued on inside back cover)
1 IU
Asiatic
Herpetological
Research
Volume 11 • 2008
Chengdu Institute of Biology of the Chinese Academy of Sciences
Asiatic Herpetological Research Society at the Museum of Vertebrate Zoology,
University of California
Honorary Editor-in-Chief
Er-mi Zhao
Chengdu Institute of Biology, Chinese Academy of Sciences, Chengdu, Sichuan, China
Editor-in-Chief
Yue-zhao Wang
Chengdu Institute of Biology, Chinese Academy of Sciences, Chengdu, Sichuan, China
Associate and Managing Editor Associate Editor
Raul E. Diaz Theodore J. Papenfuss
University of Kansas Medical Center; University of Museum of Vertebrate Zoology, University of
Kansas Museum of Natural History, Kansas, USA California Berkeley, California, USA
Consulting Editor
James F. Parham
California Academy of Sciences
Editorial Board
Kraig Adler
Cornell University, Ithaca, New York, USA
Natalia B. Ananjeva
Zoological Institute, St. Petersburg, Russia
Steven C. Anderson
University of the Pacific, Stockton, California, USA
Aaron Bauer
Villanova University, Villanova Pennsylvania, USA
Christopher Bell
University of Texas, Austin, Texas, USA
Leo Borkin
Zoological Institute, St. Petersburg, Russia
I-Jiunn Cheng
Institute of Marine Biology, National Taiwan Ocean University,
Keelung, Taiwan, China
Wen-hao Chou
National Museum of Natural Science, Taichung, Taiwan, China
Ilya Darevsky
Zoological Institute, St. Petersburg, Russia
Indraneil Das
Madras Crocodile Bank, Vadanemmeli Perur, Madras, India
William E. Duellman
University of Kansas, Lawrence, Kansas, USA
Jinzhong Fu
Department of Integrative Biology, University of Guelph, Guelph,
Ontario, Canada
Robert F. Inger
Department of Zoology, Field Museum of Natural History, Chicago,
Illinois, USA
Xiang Ji
Hangzhou Normal College, Hangzhou, Zhejiang, China; Nanjing
Normal University, Nanjing, Jiangsu, China
Pi-peng Li
Shenyang Normal University, Shenyang, Liaoning, China
Robert W. Murphy
Royal Ontario Museum, Toronto, Ontario, Canada
Goren Nilson
University of Goteborg, Goteborg, Sweden
Nikolai Orlov
Zoological Institute, St. Petersburg, Russia
Hidetoshi Ota
Department of Biology, University of the Ryukyus, Nishihara,
Okinawa, Japan
Soheila Shafii
University of Shahid Bahonar, Kerman, Iran
Hai-tao Shi
Hainan Normal University, Haikou, Hainan, China
Xiao-ming Wang
Department of Zoology, East China Nonnal University, Shanghai,
China
Yehudah Werner
Hebrew University, Jerusalem, Israel
Xiao-mao Zeng
Chengdu Institute of Biology. Chinese Academy of Sciences,
Chengdu, Sichuan, China
Asiatic Herpetological Research (AHR) Volume 1 1 is published by the Chengdu Institute of Biology of the Chinese Academy of Sciences (CIB)
and the Asiatic Herpetological Research Society (AHRS) at the Museum of Vertebrate Zoology, University of California. The editors encourage
authors from all countries to submit articles concerning, but not limited to, Asian herpetology. All correspondence should be sent via email to the
editorial office at [email protected]. Authors should consult Guidelines for Manuscript Preparation and Submission at the end of this issue and on
the web. Website For more information with regards to subscription, manuscript submission, contacts, back issues and general questions visit
AHR’s website at http://www.Asiatic-Herpetological.org.
Asiatic Herpetological Research Previous volumes were published by the Asiatic Herpetological Research Society (AHRS) and the Chinese
Society for the Study of Amphibians and Reptiles (CSSAR) as follows: Vol. 10 (2004), Vol. 9 (2001), Vol. 8 (published in 1999), Vol. 7 (1997).
Vol. 6 (1995), Vol. 5 (1993), Vol. 4 (1992), Vol. 3 (1990), and Chinese Herpetological Research Vol. 2, which was published at the Museum of
Vertebrate Zoology, 1988-1989, as the journal for the Chinese Society for the Study of Amphibians and Reptiles. Volume 2 succceeded Chinese
Herpetological Research 1987, published for the Chengdu Institute of Biology by the Chongqing Branch Scientific and Technological Literature
Press, Chongqing, Sichuan, China. Acta Herpetologica Sinica ceased publication in June, 1988.
2008
Asiatic Herpetological Research, Vol. 1 1
pp.
1-9
A Preliminary Study of the Lizard Fauna and Their
Habitats in Northwestern Iran
F. Ahmadzadeh1’*, B. H. Kiabi2, H. G. Kami3 and V. Hojjati4
MCZ
LIBRARY
1 Department of Biodiversity and Ecosystem Management, Environmental Sciences Research
Institute, Shahid Beheshti University, Evin, Tehran, Iran,
2 Department of Biology, Faculty of Sciences, Shahid Beheshti University, Tehran, Iran,
3 Department of Biology, Faculty of Sciences, Agricultural Sciences and Natural
Resources University, Gorgan, Iran,
4Damghan Islamic Azad University, Damghan, Iran.
* Corresponding author E-mail: [email protected]
MAY 07 2008
HARVARC
UNIVERSIT
Abstract.- Northwestern Iran has unique geographical and climatic conditions that support a rich flora and fauna. In
view of the lack of in-depth studies on the lizards of the region, an investigation was started in the northern part of
Ardabil Province for an inventory of this component of the fauna and their habitats. Collections were made from
October 2003 to June 2005 and 165 specimens were collected and identified. Five families, 12 genera and 15 species
are represented, including Agamidae: Laudakia caucasia, Phrynocephalus persicus, Trapelus ruderatus; Lacertidae:
Lacerta media media, Lacerta strigata, Lacerta brandtii, Darevskia raddei raddei, Eremias strauchi strauchi,
Eremias arguta, Ophisops elegans; Scincidae: Mabuya aurata transcaucasica, Eumeces schneiderii princeps,
Abelepharus bivittatus\ Anguidae: Pseudopus apodus and Gekkonidae: Cyrtopodion caspium caspium. Comparing
this list to the data provided by Anderson (1999), it seems that most of the lizards are being reported for the Province
for the first time. The families Gekkonidae and Anguidae are newly recorded, and the gecko Cyrtopodion caspium is
first recorded from the west and northwest of Iran. With seven species represented in the area, lacertids have the high-
est species diversity among the lizard families and need further study. Habitat features also have been given for all
species.
Keywords.- Iran, Ardabil, fauna, lizard, Lacerta.
Introduction
General information about the herpetofauna of Iran has
been provided by Mertens (1957), Anderson (1966),
Tuck (1971, 1974), Latifi (1984, 1991), Balouch and
Kami (1995) and Kami and Vakilipoure (1996a, 1996b).
Furthermore, a handbook of amphibians and reptiles of
the Middle East has been published by Leviton et al.
(1992), a book on the Lizards of Iran was recently pub-
lished by Anderson (1999) and an updated checklist to
the lizards of Iran was provided by Firouz (2000).
Despite these publications, the lizards of Iran are still
poorly-known and infrequently collected, with many
new species still being discovered (Rastegar-Pouyani,
1996; Rastegar-Pouyani and Nilson, 1998). Studies on
the lizards of Ardabil Province are also very limited
(Ahmadzadeh, 2004).
The aim of this study is to determine in detail the
lizard fauna and their habitat features in the northern
part of Ardabil Province, which is of particular signifi-
cance considering the unique geography and vegetation
of the region. Moreover, this study will collect baseline
population data for future management.
Materials and Methods
The area of study is in the Northwest part of Iran, specif-
ically, the northern part of Ardabil Province (38° 15' E,
to 39° 40' E, 47° 30' N to 48° 00' N). The region is sur-
rounded by the Alborz Mountains and the Caspian Sea
to the east, Aras village is to the north. Arasbaran pro-
tected area and Gare-Dagh Mountain to the west and the
Sabalan Mountain chains to the south (Fig. 1). Altitude
ranges between 20 m in the Moghan steppe to 4,888 m
on the Sabalan Mountain. The study was carried out
between October 2003 and June 2005. All of the samples
were caught by hand and some lizards which are active
and difficult to catch, such as green lizards (e.g., Lacerta
m. media and L. strigata ), were captured by dust shot.
Locality data and their habitat features were recorded for
all species encountered during the study. However, all
have been preserved in accordance to standard methods
(Formalin 1 0%) and voucher specimens are stored in the
Biodiversity and Ecosystem Management Department
Collection (BEMD) at Shahid Beheshti University of
Iran. Specimens were identified with Leviton et al.
(1992) and Anderson (1999) using morphometric meas-
© 2008 by Asiatic Herpetological Research
2
Asiatic Herpetological Research, Vol. 1 1
2008
Figure 1. The study area, the northern part of Ardabil Province of Iran.
urements, coloration and pholidosis features (including
the number, structure and range of plates).
Results
A total of 165 samples were collected in the study area,
comprising 15 species in 12 genera and 5 families. The
species composition is given in Table 1. Distribution of
species are presented in Figure 2.
Family: Agamidae
Laudakia caucasia caucasia (Eichwald, 1831)
Laudakia c. caucasia is widely distributed in the study
area, preferring montainous habitats and eroded sand
canyons in flooded plains adjacent to mountains, rock
cliffs, old houses and stony walls near roads. At 6 km2,
210 specimens were recorded on 10 June 2004 in
Meshkinshar. This species was also collected on 24
November and 3 March in the Meshkinshahr and
Arshagh areas at elevations between 500-2,800 m.
Specimens were light olive to dark gray in ground color
with adult snout- vent length of 152 mm in males and
155 mm in females.
Phrynocephalus persicus persicus De Filippi, 1863
This species was rarely encountered in the study area.
Four specimens were captured in Arshagh, Alma village
- a semi-arid area with ephemeral plants in spring and
loamy soil. Xerophyte vegetation, both plants and bush-
es, grow in these areas. Dorsal coloration was light
brown with three dark transverse marks, within which
on the hind limbs were enlarged tubercular scales. The
largest female was 40 and 48 mm snout-vent and tail
length, respectively. During the study period, no males
were found.
Trapelus ruderatus ruderatus (Olivier, 1 804)
The small agamid lizard Trapelus r. ruderatus was found
on open stony ground and in cultivated fields with
sparse weed vegetation in autumn. On sunny summer
days, it hides under weeds such as Euphorbia spp.,
Chenopodium spp. and Chrozophora tinctoria. Its activ-
ity appears to begin in early June and extends to late
September. In total, 10 specimens were collected on the
harvested wheat and barley fields in Gooshe area at
approximately at 10:30 AM. Ground color was typically
grayish-brown with five dark transverse bars on the
trunk which were interrupted by a series of light ovoid
vertebral spots (Fig. 3). The largest male examined with
distinct callous preanal scales, had a 65 mm snout-vent
and 74 mm tail length. The largest female had measure-
ments of 63 mm and 75 mm, respectively.
Family: Anguidae
Pseudopus apodus (Pallas, 1775)
Pseudopus apodus occurs throughout the Hyrcanian for-
est of northern Iran. It has recently been collected from
the Arasbaran protected area, but there are no records for
Ardabil Province. This species was found in grassland
and shrubby vegetation near streams. On a sunny day,
four P. apodus were observed in a pond. The ground
color of the dorsum was gray with zig-zagging blackish-
brown stripes in the juvenile. The head was light yellow-
ish-brown in adults with the remainder of the body dark
brown. The longest adult had a 520 mm snout-vent
length and a 670 mm tail.
Family: Gekkonidae
Cyrtopodion caspium caspium (Eichwald, 1831)
An isolated population of Cyrtopodion caspium was
found in the Moghan Steppe for the first time, represent-
ing a new family record for northwestern Iran. One spec-
2008
Asiatic Herpetological Research, Vol. 11
3
Table 1. Lizard species collected from the sfudy area.
imen was collected at night on walls of an old house at
20 m elevation. After sunset they fed on various noctur-
nal insects around lights. Dorsal scales are strongly
keeled. Dorsal body coloration was light gray with five
dark transverse bars on the body and 11-12 on the tail
(Fig. 4). In Pars-Abad, one male specimen with a snout-
vent length of 75 mm and a tail length of 70 mm was
measured.
Family: Lacertidae
Darevskia raddei raddei (Boettger, 1892)
Darevskia r. raddei is common in rocky areas where
Laudakia caucasia is also frequently found. In March,
this species was seen on vertical surfaces of rocks in the
Kapas Mountains near Meshkin-Shahr. Darevskia r. rad-
dei is various shades of light brown dorsally and more
common in the rocky habitats than other lacertids.
Specimens were found below altitudes of 900 m in
Meshkinshar, but in the Salavat and Arshag Mountains,
it was collected at altitude up to 2,400 m. The relation-
ship of this subspecies to D. r. vanensis in northwestern
Iran requires further study. The largest male had a snout-
vent of 71 mm and tail length of 131 mm. One adult
female had a 70 mm snout-vent length and 130 mm tail
length (Fig. 5).
Lacerta brandtii De Filippi, 1863
Lacerta brandtii was collected under stones, on foothills
and in the burrows of other animals in open arid bushy
and stony habitats in the Razeye area. Large numbers of
this lizard were also found in Samian District, 100 km
from the study area on a foothill surrounded by cultivat-
ed land. The relationship between the two Iranian popu-
lations of this species in Esfahan Province and east
Azarbijan Province remains problematic. This species is
less active in comparison to other lacertid lizards such as
Darevskia raddei. The dorsal surface was olive-gray
with small black spots (Fig. 6) and the ventral surface
had 8 longitudinal rows of plate. The longest male spec-
imen had total length of 192 mm. The tail of this species
displays autotomy (approximately 60% of total speci-
mens).
Eremias arguta (Pallas, 1773)
Eremias arguta has a limited distribution in the study
area: one adult specimen was collected in a harvested
barley field on a sunny day near to the Ardabil-Meshkin
road and two juvenile specimens were captured in the
Ardabil Airport area in August 2004. This lizard had a
white belly and a dorsum with white spots edged with
black on a grayish background (Fig. 7) that sometimes
formed transverse bands in the adults. Our adult speci-
mens had a 95 mm snout-vent length and a 1 10 mm tail.
Eremias strauchi strauchi Kessler, 1 878
There are two subspecies of this lizard in Iran - Eremias
s. strauchi and E. s. kopetdaghica , of which only the
first was found in the study area. The specimen was col-
lected in the eastern part of the study area in the Arshag
plain under wheat straw in a dry, stony harvested field.
Eremias s. strauchi is active and hides in shrubby vege-
tation. Five eggs of this lizard were found under an
Artemisia sp. shrub on 14 June 2004 in Amir-Abad vil-
lage. In the study area one male specimen was measured
4
Asiatic Herpetological Research, Vol. 1 1
2008
Figure 2. Distribution of species in the study area: (a) L. caucasia, (b) Ph. persicus, (c) T. ruderatus , (d) P. apodus , (e)
C. caspium, (f) D. raddei.
2008
Asiatic Herpetological Research, Vol. 11
5
Figure 2. (continued) (g) E. arguta, (h) E. strauchi, (i) L. brandtii, 0) L. media, (k) L. strigata, (I) O. elegans.
6
Asiatic Herpetological Research, Vol. 1 1
2008
Figure 2. (continued) (m) A. bivitattus, (n) E. schneiderii, (o) M. aurata.
with a 71 mm snout-vent length and had a 128 mm tail.
It’s olive-gray color pattern does not vary greatly among
populations (Fig. 8).
Lacerta media media (Lantz and Cyren, 1 902)
Lacerta m. media was very common in the grassy and
shrubby areas along the Khyave Chaye and Garesoo
river banks. One male specimen was captured under a
stone near a bean field. Specimens were observed at an
altitude of 2,100 m and males were seen on stony walls
near the roads at the end of the winter. The dorsal sur-
face of the adult male, unlike juveniles, was green with-
out any light lines or spots. Females were dark olive-
brown with large lateral spots that disappeared with age.
The largest lacertid collected during the study was one
male specimen with a snout-vent of 117 mm and a tail
length of 272 mm. This species exists in two differently-
spotted morphs, with specimens from cultivated fields
being larger than those from other habitats.
Lacerta strigata Eichwald, 1831
Lacerta strigata was most frequently found in the
Hyrcanian Forest in northern Iran and in some bushy
and wooded streams banks associated with this forest,
such as the Arax River in the northern part of the study
area. Large numbers of this species were seen in Pars-
Abad, Bilasovar and Germi near streams with dense
Tamarix and Rubus vegetation. One specimen was cap-
tured far from the Hyrcanian Forest in an open harvested
wheat field on 25 August 2004. Most collection sites
represent new locality records. The general color of the
dorsum was light green in males and dark-olive to
brown in females; it was more strongly spotted than
Lacerta m. media. Females were also smaller with more
numerous dark spots. The largest male had a snout-vent
length of 160 mm and a tail length of 100 mm, while the
2008
Asiatic Herpetological Research, Vol. 11
7
Figure 5. Darevskia raddei raddei. Figure 6. Lacerta brandtii.
Figure 7. Eremias arguta.
Figure 9. Eumeces schneiderii princeps.
Figure 8. Eremias strauchi.
Figure 10. Mabuya aruata transcaucasica.
8
Asiatic Herpetological Research, Vol. 1 1
2008
largest temale had measurements of 97 mm and 187
mm.
Ophisops elegans Menetries, 1832
Ophisops elegans is widely distributed, but is most com-
mon on the Moghan Steppe. A large isolated population
was found in Amir-Abad village. Specimens were active
and encountered almost everywhere, particularly in dry
stony habitats. Males and females both showed different
color patterns during the reproductive period. Dorsal
coloration was generally olive-green to brownish with
two light dorsolateral stripes that disappear in the adult.
An adult female from the Moghan Steppe had a snout-
vent length of 64 mm and a tail length of 1 10 mm, and a
male from Amir-Abad village had a snout-vent of 70
mm and a tail length of 120 mm.
Family: Scincidae
Ablepharus bivittatus (Menetries, 1832)
The Two-streaked Snake-eyed Skink, Ablepharus bivit-
tatus, has only been found in Amir-Abad village on
Ardabil-Germi Road on a slope with large spiny cushion
vegetation where it was sympatric with Ophisops ele-
gans and Eremias strauchi. This active lizard has a high
population density in the Neur Lake area in southern
part of Ardabil Province reaches. Body coloration on the
dorsum and tail is bronze-brown. The largest adult
female specimen reached 60 mm in snout-vent length.
Eumeces schneiderii princeps (Eichwald, 1839)
This species lives on sand dunes, stony hills and dry
river beds. We captured one male on a foothill in
Meshkinshahr on 16 June 2004 at 08:00 AM, where
Mabuya aruata transcaucasica was also found. This
lizard is very active, hides in burrows and can jump
approximately 2 m. In comparison to other scincid
lizards, Eumeces schneiderii occurs in relatively few
localities - overgrazing and destruction of habitat is
threatening extirpation of this species in the study area.
The dorsum was brownish with a narrow creamy-white
lateral line from the posterior labial through the ear
along the sides to the groin (Fig. 9). Total length (snout-
vent + tail length) of the captured male was 240 mm.
Mabuya aurata transcaucasica (Chernov, 1 926)
Mabuya aurata transcaucasica lives in sandy areas and
small hills that are covered with Astragalus and
Acantolimon vegetation. This lizard often jumps from
stone to stone for hunting insects especially grasshop-
pers. The sympatric occurrence of Mabuya aurata tran-
scaucasica, Darevskia raddei raddei and Laudakia cau-
casia caucasia has been documented on Salvat
Mountain in a rocky habitat. On the Arshagh Mountains,
juveniles with blue tails were found in cliffs, but we
could not find adult specimens at this locality. Dorsal
coloration is olive-brown with dark spots in longitudinal
rows. These spots disappear on the tail and head (Fig.
10). In the study area a specimen with a 1 15 mm snout-
vent length and a 125 mm tail was collected.
Literature Cited
Ahmadzaheh, F. 2004. Preliminary studies of the lizard's
fauna and their habitats in Meshkinshahr district.
Enviromental Sciences 1(2): 39-44.
Anderson, S. C. 1999. The lizards of Iran. Society for
the study of Amphibians and Reptiles, 442 pp.
Anderson, S. C. 1996. The turtles, lizards, and amphib-
ians of Iran. Ph.D. Thesis. Stanford University. 660
pp.
Baloutch, M. and H. G. kami. 1995. Amphibians of Iran.
Tehran University Publication, Tehran. 177 pp.
Firouz, E. 2000. A Guide to the Fauna of Iran (In Per-
sian). Iran University Press, Tehran. 491 pp.
Kami, H. G. and A. Vakilipoure. 1996a. Geographic dis-
tribution: Bufo bufo. Herpetological Review 27(3):
148.
Kami H. G. and A. Vakilipoure. 1996b. Geographic dis-
tribution: Rana camerani. Herpetological Review
27(3): 150.
Latifi, M. 1984. The snakes of Iran. Iran Department of
the Environment, Tehran. 221pp.
Latifi, M. 1991. The snakes of Iran. Society for the
Study of Amphibians and Reptiles. Contributions to
Herpetology 7.viii + 159 pp.
Leviton, A. E., S. C. Anderson, K. A. Adler and S. A.
Minton 1992. Hand book to Middle East
Amphibians and Reptiles. Oxford, Ohio. Vii + 252
pp.
Mertens, R. F. W. 1957. Weitere Unterlagen zur
Herpetofauna von Iran 1956. Jahreshefte des
Vereins fur vaterlandische Naturkunde in
Wurtemberg 112(1): 118-128.
Rastegar-Pouyani, N. 1996. A new species of Asaccus
(Sauria: Gekkonide) from the Zagros Mountain,
Kermanshahan Province, western Iran. Russian
Journal of Herpetology 3(1): 11-17.
2008
Asiatic Herpetological Research, Vol. 11
9
Rastegar-Pouyani, N. and G. Nilson 1998. A new
species of Lacerta (Sauria: Lacertidae) from the
Zagros Mountain, Esfahan Province, west-central
Iran. Proceeding of the California Academy of
Science, ser. 4 50(10): 267-277.
Tuck, R. G. 1971. Amphibians and reptiles from Iran in
the United State National Museum Collection.
Bulletin of the Maryland Herpetological Society
7(3): 48-36.
Tuck, R. G. 1974. Some amphibians and reptiles from
Iran. Bulletin of the Maryland Herpetological
Society 10: 59-65.
Submitted: 07 August 2006
Accepted: 24 August 2007
pp. 10-12
Asiatic Herpetological Research, Vol. 11
2008
A Second Record of Ptyctolaemus gularis (Peters, 1864)
from Bangladesh
M. Farid Ahsan*, Ghazi S. M. Asm at and S. Chakma
Department of Zoology, University of Chittagong, Chittagong 4331, Bangladesh.
* Corresponding author E-mail: [email protected]
Abstract.- Ptyctolaemus gularis (Peters, 1864), the blue-throated lizard, was collected from a hilly stream in
Rangamat District in Bangladesh in July 2003 and November 2004, representing the second recorded occurrence of
this species in Bangladesh.
Keywords.- Ptyctolaemus gularis , blue-throated lizard, occurrence, habitat, ecology, morphology, Bangladesh.
Introduction
The blue-throated lizard, Ptyctolaemus gularis (Peter,
1864), has been previously described from Meghalaya,
Assam, the Chittagong Hill Tracts, Tibet and China
(Boulenger, 1890; Hora, 1926; Smith, 1935; Zhao and
Adler, 1993). Boulenger (1890), who developed the
lizard taxonomy of the Indian Subcontinent, examined
two specimens of P. gularis, the type specimen from
Calcutta, preserved in the Berlin Museum, and a speci-
men from Sadiya, Assam, in the British Museum.
Following Boulenger (op. cit.), Hora (1926) reported ten
specimens from Assam and Nainimukh (correctly
spelled Mainimukh), Chittagong Hill Tracts, which are
presently deposited in the Zoological Survey of India.
The single specimen from Nainimukh represented the
first record of this species in Bangladesh. This record
has been subsequently overlooked by other authors,
including Ahsan, 1998; Khan, 1982; Sarker and Sarker,
1988.
Observations and Discussion
During a herpetological survey of Bangladesh, one spec-
imen of Ptyctolaemus gularis was collected from
Rangamati District (part of the Chittagong Hill Tracts)
on 18 July 2003 (Fig. 1). Two other specimens were
later collected from Rampahar about 50 km east of
Chittagong City in Kaptai National Park (22.30.425' N,
092.10.446' E), Rangamati District, on 25 November
2004 (Fig. 1). The first specimen was collected from
Rupkari Chara (23.12.126' N, 092.10.628' E), a hilly
stream of the Rupkari Union Parishad under Baghaichari
Upazila. The collection site is approximately 7 km
northwest from the Baghaichari Upazila headquarter. At
the time of collection, approximately 1300 h, the speci-
men was observed on a large stone hunting insects. This
specimen has been deposited in the departmental muse-
um of Zoology, University of Chittagong, Chittagong,
Bangladesh (Fig. 2A, B). The other two specimens, cur-
rently in the collection of S. Chakma, were collected
approximately 150 m apart between 1300 and 1400 h.
These animals were also collected while they were hunt-
ing for insects. One of us (MFA) also observed this
species in Chittagong at the Chunati Wildlife Sanctuary
in 1990.
With these new records, it is likely that
Ptyctolaemus gularis also occurs in the hills of Sherpur,
Jamalpur, Hobiganj, Moulvibazar, Sylhet (i.e., British-
Indian Assam), Khagrachari, Bandarbans (part of
Chittagong Hill Tracts) and Cox’s Bazar Districts in
Bangladesh, which share similar habitats.
Habitat and Ecology
Ptyctolaemus gularis is a terrestrial, diurnal species that
is frequently found south of the Brahmaputra River in
India (Smith, 1935; Daniel, 2002) and uncommonly
encountered in the southeastern hilly forests of
Bangladesh. It is most often observed in search of food
on land, stones and logs near streams and water-logs.
The first collection locality visited in 2003 was a narrow
stony stream, with the hills on both sides covered with
bamboo brakes (muli [Melocanna bambusoides ]),
gameri ( Gmelina arborea) and teak ( Tectona grandis)
trees. Ferns and some natural herbs grew between the
stones. The second and third specimens collected in
2004 were found on the slopes of a hilly, stony stream
close to a waterfall. The upper canopy was dominated by
garjan (Diptero carpus spp.) and gutgutia (P rotium ser-
ratum) trees, and the lower canopy and forest floor were
densely covered by shrubs and herbs.
© 2008 by Asiatic Herpetological Research
2008
Asiatic Herpetological Research, Vol. 1 1
11
84'
28
"7~
t.
bb
V ~. ,-V
V- -O
v.
•'t
26°
24
22
NEPAL
LEGEND
1= Sherpur
2= Jamalpur
3= Sylhet
4= Hobiganj
5= Moulovibazar
6= Khagrachari
7= Rangamati
8= Kaptai \
9= Chittagong (Chunoti)
10= Cox's Bazar
?= Not Confirmed
#= Confirmed
84l 86 88
Figure 1. Map showing collection localities.
SCALE
40 80 Mi
lt r1
0 40 80 120 Km
Identification
The collected specimens can be most readily separated
from congeners by having three parallel longitudinal
folds on each side of the throat that converge posteriorly
(cf. Boulenger, 1890; Smith, 1935) (Fig. 2C). Other use-
ful characters include an olive-brown dorsum with dark
transverse bars and/or spots, two curved dark brown
cross-bars between the eyes separated by a central light
bar, a dark stripe below the eye to the angle of the
mouth, dark blue throat folds, and limbs and a tail with
dark cross-bars above and yellowish-white cross-bars
below (cf. Boulenger, 1890; Smith, 1935).
The head is also rather long and narrow with
unequally-sized upper scales that are strongly keeled.
The dorsal body scales are also unequally-sized, with
large, strongly-keeled scales and smaller feeble ones.
Several mid-dorsal rows also point backwards and
upwards and the ventral scales are strongly keeled and
mucronate. The limbs are moderate in size; the third and
fourth fingers are equal while the fourth toe is much
longer than the third. The tail is rounded, slender and
covered with sub-equal keeled scales (cf. Boulenger,
1890; Smith, 1935). Table 1 compares the lengths of the
present specimens with those collected previously.
Acknowledgments
We wish to thank Dr. M. A. G. Khan and an anonymous
reviewer(s), who kindly reviewed an earlier version of
this manuscript. Mr. M. S. Islam and Mr. M. A. W.
Chowdhury kindly helped in drawing the map.
Table 1. Comparison of recently collected specimens with those from earlier collections.
* Mean and raw data within brackets
12
Asiatic Herpetological Research, Vol. 1 1
2008
Figure 2. Dorsal (A) and ventral (B) aspects of
Ptyctolaemus gularis collected. Inset (C) shows the
gular region folds converging posteriorly, diagnostic of
this species.
Literature Cited
Ahsan, M. F. 1998. Country report for Bangladesh-
Herpetofauna of Bangladesh: present status, distri-
bution and conservation. Pp. 9-17. In: A. de Silva
(ed.), Biology and Conservation of Amphibians,
Reptiles and Their Habitats in South Asia
(Proceedings of the International Conference in
Biology and Conservation of the Amphibians and
Reptiles of South Asia, held at the Institute of
Fundamental Studies, Kandy and University of
Peradniya, Sri Lanka, August 1-5, 1996). Amphibia
and Reptile Research Organization of Sri Lanka
(ARROS).
Boulenger, G. A. 1890. The fauna of British India
including Ceylon and Burma: Reptilia and
Batrachia. Taylor and Francis, London. 541 pp.
Daniel, J. C. 2002. The book of Indian reptiles and
amphibians. Oxford University Press, Oxford. 238
pp.
Hora, S. L. 1926. Notes on lizards in the Indian
Museum: II. On the unnamed collection of lizards
of the Family Agamidae. Records of the Indian
Museum 28: 415-420 + 1 plate.
Khan, M. A. R. 1982. Wildlife of Bangladesh: a check-
list. The University of Dhaka, Dhaka. 173 pp.
Sarker, M. S. U. and N. J. Sarker. 1988. Wildlife of
Bangladesh (a systematic list with status, distribu-
tion and habitat). The Rico Printers, Dhaka. 59 pp.
Smith, M. S. 1935. Fauna of British India including
Ceylon and Burma: Reptilia and Amphibia, Vol. II-
Sauria. Taylor and Francis Ltd., London. 441 pp. +
1 map + 1 plate.
Zhao, E-M. and K. Adler. 1993. Herpetology of China.
Society for the Study of Amphibians and Reptiles,
Oxford, Ohio. 522 pp.
Submitted: 11 November 2006
Accepted: 22 September 2007
2008
Asiatic Herpetological Research, Vol. 11
pp. 13-16
Observations on the Ovipositional Behavior of the Crest-less
Lizard Calotes liocephalus (Reptilia: Agamidae) in the
Knuckles Forest Region of Sri Lanka
A. A. Thasun Amarasinghe1’2 and D. M. S. Suranjan Karunarathna1’3
[The Young Zoologists' Association of Sri Lanka, National Zoological
Gardens, Dehiwala, Sri Lanka.
Corresponding authors E-mails: 2 [email protected]; 3 [email protected]
Abstract.- A mature female Calotes liocephalus lying on the ground in Pitawala in the Knuckles Forest Region of Sri
Lanka. This is the first described observation of the ovipositing of Calotes liocephalus. The ovipositional behavior
consisted of digging a hole to lay eggs, laying the eggs, scraping soil to bury the eggs, filling of the spaces between
the eggs, the tight compression of the soil and camouflaging the nest.
Keywords.- Agamidae, Calotes, egg-laying behavior, Knuckles, Sri Lanka, conservation.
Introduction
There are eighteen species of agamid lizards in Sri
Lanka, fifteen of them are endemic to the island (Bahir
and Surasinghe, 2005; Manamendra-Arachchi et al.,
2006; Samarawickrama et al., 2006). Seven species
belong to the genus Calotes. Five of them (C. ceylonen-
sis Muller, 1887; C. liocephalus Gunther, 1872; C.
liolepis Boulenger, 1885; C. nigrilabris Peters, 1860; C.
desilvai Bahir and Maduwage, 2005) are endemic. The
remaining two Calotes (C. calotes [Linnaeus, 1758); C.
versicolor (Daudin, 1802]) are probably widespread
species throughout South East Asia. According to the
published literature, Calotes liocephalus is a largely
arboreal species found only in parts of the Knuckles
Forest Region in Sri Lanka (Manamendra-Arachchi and
Liyanage, 1994). Its conservation status is Rare and
Endangered (Bahir and Surasinghe, 2005). It can be dis-
tinguished from its congeners by the presence of an
oblique fold in front of the shoulder, a lower jaw that is
rather short, a head without spines (or rarely a rudimen-
tary spine above the ear), enlarged supraocular scales
and poorly-developed dorsinuchal crests on the head and
lower neck (Manamendra-Arachchi, 1 990). Adults have
a snout to vent length of 9 1 mm, a head length of 37 mm,
a tail length of 261 mm and an axilla to groin length of
43 mm (Deraniyagala, 1953).
Location of observation.- Observations were made
approximately 1 km from Matale-Pallegama Road in
Pitawala in the Knuckles Forest Region (altitude: 783
m) in Matale District, Central Province. The habitat con-
sisted mainly of disturbed home gardens (Ekanayake
and Bambaradeniya, 2001). The ground was covered
with small amounts of wet leaf litter and the soil was
soft. There was approximately 10% canopy cover and
the undergrowth consisted primarily of grasses.
Observations of the lizard was made by the unaided eye
from 2 m away between the hours of 1420 and 1600 hrs.
The animal was not disturbed during observation. All
measurements were taken to the nearest 0.1 mm using
dial calipers.
Observations
A mature female Calotes liocephalus (snout to vent
length: 54.0 mm, head length: 19.4 mm, head width:
11.9 mm, tail length: 156.0 mm, axilla to groin length:
26.5 mm) lying on the ground, approximately 50 cm
from the road, was observed on 21 June 2006 at about
1420 hr. The temperature was 23.6°C and the humidity
93%. The weather was gloomy and the cloud cover was
8/8.
Digging the nest hole.- First, the lizard lifted the anteri-
or part of its body using its forelimbs. It then looked
around for ~10 min. During this period it repeatedly
turned its head 1 80° five times, without moving its body
(Fig. 1). The female then began digging into the ground
while scraping the soil with its forelimbs, which was
thrown backward under its body through its raised hind
limbs. This continued for approximately 5 minutes (Fig.
2). After that it stopped digging and looked around for
approximately 5 min. while repeatedly turning its head
180° three times, without moving its body (Fig. 3).
Again, it continued digging and this time the female dug
the hole continuously for approximately 10 min. It
stopped and looked around for about 5 min. while turn-
ing its head 1 80° around three times, without moving its
body as in Figure 3. After that, it continued to dig the
© 2008 by Asiatic Herpetological Research
14
Asiatic Herpetological Research, Vol. 11
2008
Figure 1. Figure 2.
Figure 3.
Figure 4.
Figure 5.
Figure 6.
Figure 7.
Figure 8.
2008
Asiatic Herpetological Research, Vol. 1 1
15
Figure 9a.
Figure 9b.
Figure 10.
Figure 12.
hole for another half an hour, stopping three more times
for 5 min. each, to rest. The hole was dug into the ground
at a 45° angle. The final hole was 92.6 mm deep and
79.1 mm in diameter (Fig. 4). During the rest intervals
the body was coiled inside the hole with the anterior half
bent at an angle of 90° to looking around (Fig. 5). There
was a drizzle for ~15 minutes, but the female continued
digging.
Laying the eggs. - After half an hour of digging, the
female turned its body 180° clockwise, placing the pos-
terior part of its body inside the hole. It then looked
around again (Fig. 6). The significance of this egg laying
Figure 13.
behavior was that the female removed herself slowly
from the hole without lifting her limbs while it was lay-
ing its eggs (Figs. 7-8). Eight eggs were laid at a rate of
one per minute. The eggs were pure white and elliptical,
with a mean length of 14.8 mm and a mean width 8.6
mm. After the eggs were laid, the female came out of the
hole completely and started looking around (Fig. 9a, b).
Then the female crept back into the hole for 1 5 min. to
pack and place the eggs below ground level using the
anterior part of its lower jaw (Fig. 10).
Buiying the eggs and camouflaging the nest.- After
coming out of the hole, the female turned 180° clock-
16
Asiatic Herpetological Research, Vol. 1 1
2008
wise and began to drag the soil towards the hole using its
lorelimbs. The dragged soil was thrown backwards
under its body while it lifted its hind limbs (Fig. 11).
After dragging the soil for about 5 min., it turned 180°
counter-clockwise and began pressing the soil with the
anterior half of its lower jaw for half an hour. The hole
was filled up to 18.4 mm below ground level (Fig. 12).
After looking around, it dragged the surrounding Albizia
saman (Family: Fabaceae) leaves over the nest site for
camouflage (Fig. 13). It remained motionless for 2 min.
and then ran towards the forest, during which time it was
caught for measurement and then released.
Discussion
The oviposition behavior of this species varies from the
oviposition behavior of Calotes versicolor. According to
Amarasinghe and Karunarathna (2007), C. versicolor
places its cloacal aperture over the opening of the hole
while laying its eggs, but C. liocephalus places the pos-
terior part of the body inside the hole while laying eggs.
C. versicolor also lifts the anterior part of the body with
its forelimbs while turning its head to look around, but
C. liocephalus coils its entire body inside the hole while
bending the anterior part of its body to look around. C.
versicolor makes a knocking noise while packing and
placing the eggs in the hole using its lower jaw while the
C. liocephalus places them softly without making any
noise. After the observation the eggs were removed from
the hole and the hole was subsequently examined. The
bottom was conical and the soil was soft, dark and wet.
Finally the eggs were buried in a home garden to hatch.
After approximately two and half months we observed
five small holes where the hatchlings had come out.
Unfortunately we could not observe the hatchlings.
A Few diagrams, brief descriptions and notes of
Calotes liocephalus are available in popular journals,
books and magazines but almost nothing exists on the
pre and post mating behavior, egg laying behavior, cap-
tive breeding and their hatchlings. In addition Calotes
liocephalus is an endemic, rare and threatened species
and therefore it may become extinct if their population
does not increase. For such a situation to be achieved,
captive breeding methods may be needed for ex-situ
conservation of this species. In addition further observa-
tions are also needed for the conservation of Calotes lio-
cephalus.
Acknowledgments
We wish to thank Mr. Kelum Manamendra-Arachchi
(WHT - Wildlife Heritage Trust) for reviewing the man-
uscript and Mrs. Zeenia Nissam of the Department of
Zoology, Faculty of Natural Sciences of the Open
University, Sri Lanka, for her generous support for the
field visit. We also thank Mr. Niranjan Karunarathna and
Mr. Gayan Wijeytunga (YZA - The Young Zoologists’
Association) for assisting the fieldwork. Finally, Ms.
Debbie McCormick and Mr. F. S. Abeywickrama are
acknowledged for their help in preparing this paper.
Literature Cited
Amarasinghe, A. A. T. and D. M. S. S. Karunarathna.
2007. Beobachtungen zum Eiablageverhalten der
Indischen Schonechse Calotes versicolor
(Daudin, 1802) (Reptilia: Agamidae) in einem
anthropogenen Biotop in Sri Lanka. Sauria,
Berlin, 29(3): 27-30.
Bahir, M. M. and T. D. Surasinghe. 2005. A conservation
assessment of the agamid lizards of Sri Lanka. The
Raffles Bulletin of Zoology, Suppl. 12: 381-392.
Deraniyagala, R E. P. 1953. A colored atlas of some ver-
tebrates from Ceylon, Tetrapod Reptilia. National
museums of Sri Lanka.
Ekanayake, S. and C. N. B. Bambaradeniya. 2001.
Trekking in the Knuckles forest - A trekking guide
to Alugallena, Dekinda and Nitre cave nature trails.
IUCN Sri Lanka.
Manamendra-Arachchi, K. 1990. A guide to the
Agamids in Sri Lanka. Occ. Papers of the Young
Zoologist Association of Sri Lanka. 5: 1-8.
Manamendra-Arachchi, K. and S. Liyanage. 1994.
Conservation and distributions of the agamid
lizards of Sri Lanka with illustrations of the extant
species. Journal of South Asian Natural History
1(1): 77-96.
Manamendra-Arachchi, K., A. de Silva and T.
Amarasinghe. 2006. Description of a second
species of Cophotis (Reptilia:Agamidae) from the
highlands of Sri Lanka. Lyriocephalus 6(1): 1-8.
Samarawickrama, V. A. M. P. K., K. B. Ranawana, D. R.
N. S. Rajapaksha, N. B. Ananjeva, N. L. Orlov, J.
M. A. S. Ranasinghe and V. A. P. Samarawickrama.
2006. A new species of the Genus Cophotis
(Squamata: Agamidae) from Sri Lanka. Russian
Journal of Herpetology 13(3): 207-214.
Submitted: 10 October 2006
Accepted: 23 September 2007
2008
Asiatic Herpetological Research, Vol. 11
pp.
17-23
On the Status of the Chinese Pitviper Ceratrimeresurus shenlii Liang and
Liu in Liang, 2003 (Serpentes, Viperidae), with the Addition of
Protobothrops cornutus (Smith, 1930) to the Chinese Snake Fauna
Patrick David1’*, Haiyan Tong2, Gernot Vogel3 and Mingyi Tian4
1 Departement Systematique et Evolution, USM 602 Taxonomie-collection - Reptiles et Amphibiens,
CP 30, Museum National d’Histoire Naturelle, 57 rue Cuvier, F-7523J Paris Cedex 05, France,
2 16, cour du Liegat, F -7 5013 Paris, France,
dm Sand 3, D-6911 5 Fleidelberg, Germany,
4 College of Natural Resources & Environment, South China Agricultural University, Wushan,
Guangzhou 510640, People’s Republic of China.
* Corresponding author E-mail: [email protected]
Abstract.- Ceratrimeresurus shenlii Liang and Liu in Liang, 2003 was described as a new genus and a new species
on the basis of the first “homed” specimen of pitviper recorded from the People’s Republic of China. This taxon has
been overlooked in the literature. The original description is here translated verbatim into English. The holotype is
compared with other homed pitvipers known from Asia. On the basis of its scalation and pattern, Ceratrimeresurus
shenlii is synonymized with Protobothrops cornutus (Smith, 1930). The range of this latter species, previously
endemic to Vietnam, is expanded northeastwards by approximately 780 airline km. A brief comment on the zoogeog-
raphy of South China is given.
Keywords.- Serpentes, Ceratrimeresurus, Ceratrimeresurus shenlii, Protobothrops cornutus, China, Vietnam, taxon-
omy, zoogeography.
Introduction
A new Chinese genus and new species of Asian pitviper,
Ceratrimeresurus shenlii Liang and Liu in Liang, 2003
has remained overlooked in the literature.
Ceratrimeresurus shenlii was not included in the latest
checklist of the Trimeresurus complex (Gumprecht et
al., 2004), nor announced in Wolfgang Wiister’s invalu-
able website “Venomous Snakes Systematic Alert”
(http://biology.bangor.ac.uk/~bssl66/update.htm).
Lastly, this taxon was not considered by Malhotra and
Thorpe (2004, 2005) in their revision on the pitvipers of
the Trimeresurus complex.
The description of Ceratrimeresurus shenlii Liang
and Liu in Liang (2003: 411; Plate 8: Fig. 13. Type local-
ity: “Working site 02 at Wuzhishan forest, Ruyuan
Xian”, Guangdong Province) appeared in a chapter of a
book on the natural history of Nanling Nature Reserve,
located in Nanling Mountains, in the north of
Guangdong Province (Pang, 2003), a fact that may
explain that the new taxon remained overlooked by the
herpetological community. However, this new species
was merely mentioned in September 2004 in the forum
of a website dedicated to venomous snakes
(http://www.venomdoc.com/fomms - last viewed on
May 30th, 2005), where this species was regarded, with-
out explanations, as a synonym of Protobothrops cornu-
tus. It was also tentatively regarded as a synonym of
Protobothrops cornutus by Vogel (2006).
Only three other taxa of Asian pitvipers with more
or less raised supraoculars were previously known from
the mainland: Trimeresurus wiroti (see David et al.,
2006), Protobothrops cornutus and Triceratolepidophis
sieversorum. In this paper, we provide a translation of
the original description. The new taxon is, according to
the re-examination of the holotype, compared with the
currently known homed species of mainland Asia and its
status is discussed.
Materials and Methods
Body and tail lengths were measured to the nearest mm.
The number of ventral scales is counted according to
Dowling (1951). The terminal scute is not included in
the number of subcaudals. The numbers of dorsal scale
rows are given at one head length behind head, at mid-
body (i.e. at the level of the ventral plate corresponding
to a half of the total number of ventrals), and at one head
length before vent, respectively. Values for symmetric
head characters are given in left/right order.
© 2008 by Asiatic Fferpetological Research
18
Asiatic Herpetological Research, Vol. 1 1
2008
Abbreviations of measurements and other meristic
characters.-
Measurements and ratios: HL: head
length; SVL: snout-vent length; TaL: tail
length; TL: total length; TaL/TL: ratio tail length /total
length.
Meristic characters: DSR: formula of dorsal scale
rows; MSR: number of dorsal scale rows at midbody;
IL: infralabials; SC: subcaudals; SL: supralabials; VEN:
ventrals.
Museum abbreviations.- BMNH: Natural History
Museum, London, UK. - FMNH: Field Museum of
Natural History, Chicago, USA. - MNHN: Museum
National d’Histoire Naturelle, Paris, France. -
ZFMK: Zoologisches Forschungsmuseum Alexander
Koenig, Bonn, Germany.
Results
Translation of the original description of
Ceratrimeresurus shenlii.- The original description
appeared in Liang (2003: 411), but is credited to Liang
and Liu. It was published in Chinese with a short
English summary. A poor quality, small color photo-
graph of the holotype appears on Plate 8, Figure 13 of
the book. A verbatim translation of the original descrip-
tion should read as follows (numbers placed in square
brackets refer to our comments placed after this transla-
tion):
Jiao laotietou Ceratrimeresurus shenlii Liana
|2| °
and Liu, gen. and sp. nov. (See colour plate 13 )
The upper eyelid forms on each side a raised triangle
covered with small scales, the base of the triangle being
slightly like a three-sided pyramid; the length of the tri-
angular horn is 1 .5 times the diameter of the eye, and the
height from the tip of the triangle to the edge of the
upper eyelid is equal to the eye diameter. The tip of the
snout is blunt, the upper snout surface is broad and flat-
tened, with the lateral edge slightly upturned. The length
of the snout is about a 1/4 of head length and 1/3 of head
width. The nostril is placed near the tip of the snout,
slightly directed sideward and almost rounded in shape,
the opening being in the middle of a divided nasal scale;
there is one upper nasal scale. There are 5 small scales
between the two nostrils . The upper head surface is
covered with granular scales, which become progres-
sively larger and more keeled from the front to the back
of the head. The cephalic surface is slightly convex and
becomes progressively flat and broader backwards.
There are 7 small interorbital scales . There are 11
small scales surrounding the base of the triangular horn.
The tip of the triangular horn is one rather large scale, to
which is adjacent a smaller scale which makes the horn
looking as bifurcated. The eye is rather large and the
third of its volume is out of the head. The iris is a verti-
cally elongated oval. There is a row of small scales
around the orbit and many scales between the snout side
and temporal region. The forward sunken part of the
occiput is roughly equal to the length of the snout, with
the end of the neck plunged in it. The neck is slender, its
diameter being less than half of the head width. There
are 14 supralabial scales , among which the first and
second ones are separated from the nasal scales by a row
of 3 small scales, and the third to fifth ones do not enter
the loreal pit161, but are separated from it by a row of
small scales; the edge of the upper jaw is convex down-
wards; 14 infralabials, the fourth being the largest, the
first to the fourth ones in contact with the anterior chin
shields, and the posterior chin shields being rather large.
One large fang is located on the anterior part of the
upper jaw, followed by 2 smaller teeth. No teeth on the
palatine and pterygoid . Five small teeth are present on
the lower jaw. The loreal pit is placed antero-inferiorly
to the eye.
The head is peach-shaped and slightly flattened,
with a narrow and elongated neck; the body is rather
wide but slender and long, with a long, pointed tail. The
dorsal scales are strongly keeled, 23-23-21-17 rows, the
rows of cervical scales are more oblique than those of
the body scales. There are 187 ventral scales +77 pairs
of subcaudals. The anal scale is single. The vertebral
scales are normal.
The back of the body is of a grey color, which
becomes light grey on the sides. On the head upper sur-
face, there is a ‘X’ shaped pattern, made of a blotch
extending from the nasal scale to the front of the oppo-
site triangular, and of a blackish brown elongated blotch
extending from the posterior of the horn through the
rearward supraorbital scale (behind the horn) backwards
up to the posterior of the head. A white streak extends
from the posterior margin of the eye through the tempo-
ral up to the posterior of the head, followed by a blackish
brown stripe from the comer of the mouth to the sides of
the throat. The upper and lower lips are marked with
blackish brown square shaped spots. Diffuse and irregu-
lar spots cover the rest of the body throughout. The dor-
sal side of the head and the body is brown in color.
Dorsal blotches extend on each side from the middle of
the body to the vent, the right and the left rows being off-
set and these blotches being linked together by their
inner comer; they are merged together in the middle of
the body and linked each other again by the inner comer
on the posterior part of the body, then merged together
again from the vent to the end of the tail. Light grey-
brown spots on the lower part on the sides of the body,
roughly square in shape or almost rounded, oval or
2008
Asiatic Herpetological Research, Vol. 1 1
19
reduced to short crossbars. The venter is pale grayish-
brown, without other spot in the middle, so that the ven-
tral side of the body is light grey-brown color through-
out. There is a pointed scale on the tip of the tail. The
total length of the specimen: 362 + 78 = 440 mm, length
of the tail/total length = 0.564, weight = 24 g.
The specimen was collected in the thatch on the top
ot a house near a forest, coiled with the head in the mid-
dle ot its body. Not very active. It was knocked down
with a little stick on the ground and captured. The local-
ity is^the “Working site 02” at Wuzhishan forest, Ruyuan
Xian , July 1996. The specimen is deposited in the
Laboratory of Zoology of the Faculty of Biotechnology,
Jinan University'91.
Comments on the original description. - In this original
description, no mention of the sex of the specimen is
given, although it is a female according to the shape of
the base of the tail. Other comments are:
[1] : Translation: “Homed iron-head [snake]”. The ver-
nacular name “ Laotietou ” is given in China to
Protobothrops mucrosquamatus, due to the shape
of its head, looking like an ancient iron.
[2] : It should rather appear as Plate 8: fig. 13.
[3] : This value includes the two supranasals plus the
scales separating these latter ones.
[4] : If one counts the cephalic scales on a line connect-
ing the middle of the supraoculars, the value is 14
(see below).
[5] : This value is obviously erroneous; we counted 8 SL.
[6] : This is obviously a lapsus for the orbit.
[7] : this lack of teeth on the palatine bones is surprising
and may be an artifact. Teeth are very commonly
miscounted, as they are masked by the tissues and
one usually needs to peel back the gum tissues to
count the sockets. All the tooth counts in this
description may be unreliable (A. Malhotra, pers.
comm, January 2006).
[8] : Ruyuan County, in northern Guangdong Province,
close to the Guangdong-Hunan border. The
Nanling National Nature Reserve is located in the
centre of Nanling Mountains, which extend from
northeast Guangxi to southwest Fujian.
[9] : Guangzhou, Guangdong Province.
Redescription of the holotype of Ceratrimeresurus
shenlii (Figs. 1-3).- The original description includes
some imprecision or mistakes. In combining data of the
original description and our own data, the morphology is
as follows:
Body moderately stout; head subtriangular, wide at its
base, clearly distinct from the neck, thick and swollen
when seen from the side, depressed between the uplifted
areas of the supraoculars. Snout average in relative
length, about one quarter of HL, bluntly rounded when
seen from above, depressed in its center, obliquely trun-
cated when seen from the side, with a distinct canthus
rostralis. Eye relatively large. Tail long and tapering.
The holotype is now in average condition and somewhat
dessicated:
SVL: 362 mm; TaL: 78 mm; TL: 440 mm; ratio
TaL/TL: 0.177.
VEN: 187; SC: 77, paired, plus one terminal scale; anal
shield entire.
DSR: 23-21-17 scales, rhomboid, distinctly keeled.
Rostral visible from above, broader than high, trian-
gular; nasals subrectangular, divided, with a round nos-
tril opening near the tip of the snout, directed slightly
sideward and almost rounded in shape; 2 intemasals on
each side, separated by 2 small scales; 4/4 canthal
scales, slightly larger than adjacent snout scales, border-
ing the canthus rostralis ; 2 elongate upper preoculars
above the loreal pit; lower preocular forming the lower
margin of loreal pit; 3/3 small postoculars; 5/5 supraoc-
ulars on an uplifted triangular area, of which the two
central supraocular scales are strongly enlarged, triangu-
lar and strongly obliquely erected (“horn like”) and
extending out of the head margin, 1.5 times the diameter
of the eye, convergent and originating from the same
base covered with small scales; 8 or 9 slightly enlarged
scales on upper snout surface on a line between the
scales separating the intemasals and a line connecting
the anterior margins of eyes, smooth, juxtaposed, irreg-
ular in shape; 14 cephalic scales on a line between the
base of the supraoculars (including the scales covering
the uplifted basal area), smooth, flat and juxtaposed;
occipital scales larger than cephalic scales, distinctly
keeled; temporal scales small, obtusely keeled: 9 SL. 1st
SL separated from nasal; 2nd SL bordering the anterior
margin of the loreal pit, 3rd SL largest, separated from
the subocular by 1 scale; 4th SL much smaller than 3rd
SL, separated from the subocular by 1 scale; 5th and pos-
terior SL much smaller; 14 IL. first four pairs in contact
with anterior chin shields.
The coloration and pattern agree with that of the
original description. The light postocular streak is quite
conspicuous, but the overall pattern of the body is rather
faded.
Discussion
Nomenclatural considerations.- The combined descrip-
tion of the genus and species was brief and may raise
some questions about its validity. Two points need to be
discussed. The first one relates to the combined descrip-
tion of the genus Ceratrimeresurus and of its sole
20
Asiatic Herpetological Research, Vol. 1 1
2008
Figure 1. Ceratrimeresurus shenlii, holotype. General
view of body. Photograph by Tian Mingyi.
Figure 3. Ceratrimeresurus shenlii, holotype. Lateral
view of the head. Photograph by Tian Mingyi.
included species, shenlii. According to Art. 13.4 of the
International Code of Zoological Nomenclature (1999),
in the present case, such a “description of a new nominal
genus and a single included new nominal species is
deemed to confer availability on each name under
Article 13.1.1.” Art. 13.1.1 requires that every new name
published be accompanied by a description purported to
differentiate the taxon. This combined description is
hence considered to be complying with the requirements
of the Code.
The second point relates to the identification of the
holotype. No number was cited in the description, and
this specimen was still deposited in Prof. Liang Qishen’s
private collection in December 2005. Nevertheless, as
the name of the collection into which the specimen will
be eventually deposited was clearly indicated in the
original description, and as it was confirmed to us that
the specimen will eventually be deposited in this collec-
tion, we consider that this point complies with Art.
16.4.2 of the Code and makes valid the description of
Figure 2. Ceratrimeresurus shenlii, holotype. General
view of body. Photograph by Tian Mingyi.
Figure 4. Head of the second Chinese specimen of
Protobothrops cornutus. Photograph by Fu Jie.
the specific nomen.
A comparison of Ceratrimeresurus shenlii with other
horned species.- In the Asian mainland, only
Protobothrops cornutus and Triceratolepidophis siever-
sorum have erected supraoculars. Trimeresurus wiroti
has only slightly raised supraoculars (see David et al.,
2006). Another species occurring in western Indonesia,
Trimeresurus brongersmai, has erected hom-like
supraoculars. However, this latter species, related to
Trimeresurus wiroti, differs from the other homed
species by several characters, including the shape of its
snout (David et al., 2006). On the basis of Ziegler et al.
(2001), Herrmann et al. (2002), Herrmann and Ziegler
(2002), Herrmann et al. (2004) and of specimens exam-
ined by ourselves, a comparison between horned species
and Ceratrimeresurus shenlii is given in Table 1 .
Triceratolepidophis sieversorum differs by its
greater number of ventral scales and a different structure
of horns, free and strongly divergent. This species also
2008
Asiatic Herpetological Research, Vol. 1 1
21
*'*38
... MUli ASO
VII KAM
RA-wucmufXA
' mm*. •**„
' *!!«►! -
mm hx-im >,
Figure 5. Distribution map of of Protobothrops cornutus.
shows a peculiar structure of keels of dorsal scales,
which is not found in other homed pitvipers (Ziegler et
al., 2001). The dorsal keels of Ceratrimeresurus shenlii
are narrow and made of a single ridge.
In contrast, Ceratrimeresurus shenlii cannot be dis-
tinguished from Protobothrops cornutus otherwise than
by minor characters. In both species, the horns stem
from the same base and are free only in their outermost
part. All scalation characters are similar, including the
keeling of the dorsal scales (see Table 1). Other charac-
ters include the keeled occipital scales, the large 3rd SL
separated from the subocular by 1 scale row, 4th and 5th
separated from the subocular by 1 or 2 scales, the num-
ber of intemasals and of supraoculars. The sole differ-
ence bears on the numbers of pairs of infralabials in con-
tact with the anterior chin shield, first 3 pairs in P. cor-
nutus vs. first 4 pairs in Ceratrimeresurus shenlii. The
pattern is also similar, especially the dorsal blotches, the
upper head dark pattern and the postocular streak.
On the basis of the similarities in morphological
characters, we synonymize Ceratrimeresurus shenlii
Liang and Liu in Liang (2003) with Trimeresurus cornu-
tus Smith, 1930, now Protobothrops cornutus (see
Herrmann et al. [2004] for the generic position of this
species).
At the generic level, the point to be now discussed
is if the homed species Trimeresurus cornutus Smith,
1930 should be referred to a genus distinct from
Protobothrops, in which all other included species are
hornless. In this case, the generic nomen
Ceratrimeresurus is available. Pending molecular analy-
ses that should clarify the relationships between the
Chinese and the Vietnamese populations, we have to
rely only on morphology. Only two currently recognized
genera of mainland Asia include species with truly erect-
ed supraoculars (“horns”), namely Protobothrops (only
for P cornutus ) and Triceratolepidophis (T. sieverso-
nim). On the basis of the similarities between P. cornu-
tus and C. shenlii, we adopt a conservative approach in
considering that erected supraoculars have been conver-
gently evolved in several lineages. Consequently, we
synonymize the genus Ceratrimeresurus Liang and Liu
in Liang (2003) with Protobothrops Hoge and Romano
Hoge, 1983.
A second Chinese specimen of Protobothrops cor-
nutus has appeared on Internet in summer 2005 (Fig. 4),
from Shimentai Nature Reserve (24° 22'-24° 3 1 ' N, 113°
05'- 113° 31' E), Nanling Mountains, Yingde County,
Guangdong Province (see Jim and Xu [2002] for a
description of the area). The characters visible on this
picture of a freshly killed specimen are identical with
Table 1. A comparison between known specimens of Asian horned pitvipers.
List of cited specimens. Protobothrops cornutus. (1) ZFMK 75067, Phong Nha-Ke Bang National Park, Quang Binh Province, Vietnam (not seen; after
Herrmann et al., 2004); (2) BMNH 1946.1 .19.25, “Fan-si-pan Mts., Tonking", now Mt. Phang Si Pang, Lai Chau Province, Vietnam; (3) MNHN 1937.35,
“Tonkin”, northern Vietnam. - Triceratolepidophis sieversorum. (4) ZFMK 71262 (holotype), Phong Nha village, Phong Nha-Ke Bang Nature Reserve,
Quang Binh Province, Vietnam; (5) ZFMK 75066, Phong Nha-Ke Bang Nature Reserve, Quang Binh Province, Vietnam; (6) FMNH 255258, Hin Nammo
NBCA, Boualapha District, Khammouan Province, Laos (specimens (5) and (6) not seen; after Herrmann et at, 2002).
22
Asiatic Herpetological Research, Vol. 1 1
2008
those ot Ceratrimeresurus shenlii. The pattern is much
similar to that of Protobothrops cornutus depicted in
Herrmann et al. (2004). According to the data kindly
communicated to us by Mr. Fu Jie, the author of the pho-
tograph, this second specimen was seen in May 2005. It
was held in alcohol in the home of a member of the Yao
minority, to be most likely used as a medicinal beverage.
The locality of this second specimen lies in a hilly area
at approximately 7 5 airline km southeastwards from the
type locality of Ceratrimeresurus shenlii in Nanling
Nature Reserve. According to the Yao owner of this
specimen, this snake was caught by himself while he
was acting as a guide to a scientific survey of the local
herpetological fauna. Several specimens were collected,
but all died in captivity within some days. This species
is there considered very rare.
Conclusions
The occurrence of Protobothrops cornutus in China
makes a considerable northeastward range extension for
this latter species, previously considered endemic to
Vietnam (Nguyen et al., 2005) (see map on Fig. 5).
Ziegler et al. (2006) recorded a specimen of
Protobothrops cornutus from Ha Giang Province, in
extreme northern Vietnam, close to the border with
Yunnan and Guangxi Zhuang Autonomous Provinces.
The previously northernmost known locality, Mt. Phang
Si Pang (formerly Mt. Fan Si Pan) and Nanling
Mountains are separated by about 980 airline kilome-
ters. Chinese specimens are separated from the new
locality cited in Ziegler et al. (2006) by about 760 airline
km.
We also consider that the wide gap between the
Chinese population and its Vietnamese relatives may
most likely reflect a lack of appropriate collecting effort
in elevated areas of Guangxi Zhuang Autonomous and
Guangdong Provinces than a real geographical gap.
Protobothrops cornutus should be searched for in forests
of mountain or hill ranges such as Darning Shan and
Dayao Shan (Guangxi Zhuang Autonomous Province)
and in various hills of northern Guangdong located
between the Nanling Mountains and the mountain
ranges of Guangxi Autonomous Region. The herpeto-
fauna of this latter province is still quite poorly known.
Besides the provinces of Guangxi and Guangdong, this
species should be searched for in forested areas of south-
ern Yunnan (see Herrmann et al., 2004). Herrmann et al.
(2004) also showed that, in Central Vietnam, P. cornutus
also occurs in the lowlands. However, lowland areas of
southern China are quite dry (Anonymous, 1998). These
lowlands separate the hill or mountain ranges of south-
ern China which share a subtropical humid climate with
high annual amounts of rainfall (above 2000 mm), a sit-
uation which leads to the isolation of the populations of
P. cornutus in this region.
A discussion on the zoogeographical affinities
between North Vietnam and various regions of South
China are outside the scope of this paper, but a mere
comparison between the snake faunas of northern
Vietnam and the hills of Guangxi and Guangdong sug-
gests strong similarities. The occurrence of
Protobothrops cornutus in northern Guangdong, as well
as of Shinisaurus crocodilurus and Amphiesma bitaenia-
tum in northern Vietnam (David et al., 2005; respective-
ly Le and Ziegler, 2003) reinforces the zoogeographical
relationships of these areas connected by more or less
contiguous hill or mountain ranges receiving high annu-
al amounts of rainfall.
Acknowledgments
We are indebted to Q. Liang (Guangzhou, China), who
was instrumental in letting TM re-examine the holotype
of Ceratrimeresurus shenlii. We are grateful to A.
Malhotra (Bangor, United Kingdom), M. W. Lau (Hong
Kong, China) and T. Ziegler (Koln, Germany) for their
comments on the draft of this paper; we especially thank
T. Ziegler who made available and permitted us to cite
his paper in press. Lastly, we thank J. Fu (Guangzhou,
China) and N. Wu (Beijing, China) for their kind permis-
sion to use in our paper the picture of the second Chinese
specimen of Protobothrops cornutus.
Literature Cited
Anonymous (1998) Physiogeographical Atlas of China.
2nd Edition. China Cartographic Publishing House,
Beijing. 51 + 112 pp.
David, P., G. Vogel and O. S. G. Pauwels. 2005. On the
occurrence of Amphiesma bitaeniatum (Wall,
1925) in Vietnam, with preliminary remarks on the
group of Amphiesma parallelum (Boulenger, 1890)
(Serpentes, Colubridae, Natricinae). Salamandra
41(4): 167-178.
David, P., G. Vogel, S. P. Vijayakumar and N. Vidal.
2006. A revision of the Trimeresurus puniceus-
complex (Serpentes: Viperidae: Crotalinae) based
on morphological and molecular data. Zootaxa
1293:1-80.
Dowling, H. G. 1951. A proposed standard system of
counting ventrals in snakes. British Journal of
2008
Asiatic Herpetological Research, Vol. 1 1
23
Herpetology 1(5): 97-99.
Gumprecht, A., F. Tillack, N. Orlov, A. Captain and S.
Ryabov. 2004. Asian Pitvipers. Geitje Books,
Berlin. 368 pp.
Herrmann, H.-W., T. Ziegler, B. L. Stuart and N. L.
Orlov. 2002. New findings on the distribution, mor-
phology, and natural history of Triceratolepidophis
sieversorum (Serpentes: Viperidae). Herpetological
Natural History 9(1): 89-94.
Herrmann, H.-W., T. Ziegler, A. Malhotra, R. S. Thorpe
and C. L. Parkinson. 2004. Redescription and sys-
tematics of Trimeresurus cornutus (Serpentes:
Viperidae) based on morphology and molecular
data. Herpetologica 60(2): 211-221.
International Commission on Zoological Nomenclature.
1999. International Code of Zoological
Nomenclature. Fourth Edition. International Trust
of Zoological Nomenclature, London, xxix +306
pp.
Jim, C. Y. and S. S. W. Xu. 2002. Perception of local
inhabitants towards nature reserve establishment in
a remote mountain area in South China.
Proceedings of IUCN/WCPA-EA-4 Taipei
Conference, March 18-23, 2002, Taipei, Taiwan:
459^167.
Le, K. Q. and T. Ziegler. 2003. First record of the
Chinese crocodile lizard from outside of China:
Report on a population of Shinisaurus crocodilurus
Ahl, 1930 from north-eastern Vietnam. Hamadryad
27: 193-199.
Liang, Q. 2003. Reptiles of Guangdong Nanling Nature
Reserve. In: Pang, X. (Ed.), Studies on Biodiversity
of the Guangdong Nanling National Nature
Reserve. Guangdong Science and Technology
Press, Guangzhou: 408^117, PI. 8. (In Chinese).
Malhotra, A. and R. S. Thorpe. 2004. A phylogeny of
four mitochondrial gene regions suggests a revised
taxonomy for Asian pitvipers ( Trimeresurus and
Ovophis). Molecular Phylogenetics and Evolution
32: 83-100.
Malhotra, A. and R. S. Thorpe. 2005. Erratum to “A
phylogeny of four mitochondrial gene regions sug-
gests a revised taxonomy for Asian pit vipers
(; Trimeresurus and Ovophis)". [Mol. Phylogen.
Evol., 32 (2004) 83-100], Molecular Phylogenetics
and Evolution 34: 680-681.
Nguyen, V. S, T. C. Ho and Q. T. Nguyen. 2005. Danh
luc ech nhai va bo sat Viet Nam. A checklist list of
Amphibians and Reptiles of Vietnam. Nha xuat ban
Nong Nghiep, Hanoi. 180 pp. (In Vietnamese).
Pang, X. (Ed.). 2003. Studies on Biodiversity of the
Guangdong Nanling National Nature Reserve.
Guangdong Science and Technology Press,
Guangzhou. 474 pp., 8 pis. (In Chinese).
Vogel, G. 2006. Terralog. Venomous snakes of Asia -
Giftschlangen Asiens. Edition Chimaira, Frankfurt
am Main & Aqualog Verlag ACS, Rodgau. 148 pp.
Zhao, E. M., M. H. Huang, Y. Zong, J. Zheng, Z. J.
Huang, D. T. Yang and D. J. Li (Eds.). 1998. Fauna
Sinica. Reptilia Vol. 3. Squamata Serpentes.
Science Press, Beijing, xvii + 522 pp., 8 pis., 4 col.
Pis. (In Chinese).
Ziegler, T., H.-W. Herrmann, P. David, N. Orlov and O.
S. G. Pauwels. 2001 [2000], Triceratolepidophis
sieversorum, a new genus and species of pitviper
(Reptilia: Serpentes: Viperidae: Crotalinae) from
Vietnam. Russian Journal of Herpetology 7(3):
199-214.
Ziegler, T. and H.-W. Herrmann. 2002.
Wiederentdeckung zweier gehornter
Grubenotterarten in Vietnam. Mitteilungen
Zoologische Gesellschaft fur Arten- und
Populationsschutze e.V. 18(2): 24—26.
Ziegler, T., N. T. Vu, K. Q. Le, Q. T. Nguyen, J.
Hallermann, V. K. Le & M. H. Thach. 2006. Neue
Verbreitungsnachweise einiger vennig bekannter
Vietnamesischer Amphibien und Reptilien. Sauria
28(2): 29-40.
Submitted 13 June 2006
Accepted: 04 April 2007
pp. 24-30
Asiatic Herpetological Research, Vol. 1 1
20081
The Effects of Incubation Temperature On Hatching Success,
Embryonic Use of Energy and Hatchling Morphology in
the Stripe-tailed Ratsnake Elaphe taeniura
Wei Guo Du1’* and Xiang Ji1’2
1 Hangzhou Key Laboratory for Animal Sciences and Technology, Hangzhou Normal
University, 310036, Hangzhou, Zhejiang, R R. China
2 Jiangsu Key Laboratory for Biodiversity and Biotechnology, College of Life Sciences,
Nanjing Normal University, Nanjing 210097, Jiangsu, P R. China
* Corresponding author E-mail: [email protected]
Abstract .- We incubated eggs of Elaphe taeniura at 22, 24, 27, 30 and 32°C to examine the effects of incubation tem-
perature on hatching success, embryonic use of energy and hatchling morphology. Incubation temperature affected
incubation length and most hatchling traits examined in this study. Incubation length increased nonlinearly as tem-
perature decreased, with the mean incubation length being 101.7 d at 22°C, 86.0 d at 24°C, 66.3 d at 27°C, 53.9 d at
30°C, and 50.5 d at 32°C. Hatching successes were lower at the two extreme temperatures (41.2% at 32°C, and
50.0% at 22°C) than at the other three moderate temperatures (78.1-79.3%). Hatchlings from the extreme high incu-
bation temperature (32°C) were smaller in body size and wet body mass. High incubation temperatures resulted in
production of less developed hatchlings that characteristically had less developed carcasses but contained more unuti-
lized yolks. The proportion of energy transferred from the egg contents to the hatchling was 71.1% at 22°C, 80.2%
at 24°C, 81 .5% at 27°C, 82.6% at 30°C and 83.9% at 32°C. Taking the lowest hatching success at 32°C and the sub-
stantially prolonged incubation lengths at 22°C into account, we conclude that these temperatures are not suitable for
embryonic development in E. taeniura. Our data confirm the prediction that there are some thresholds over which
incubation temperatures can affect hatching success, embryonic use of energy and hatchling morphology.
Keywords.- Reptilia, Colubridae, Elaphe taeniura, egg, incubation, temperature, hatchling phenotype.
Introduction
As in other vertebrate and invertebrate taxa, temperature
may profoundly influence embryonic development in
reptiles. Compared to avian embryos, reptilian embryos
can develop under a relatively wide range of tempera-
tures (Birchard, 2004, Booth, 2004). Low temperatures
slow embryogenesis but usually have little lethal effect
on embryos; high temperatures result in faster embryon-
ic development (and thus, shortened incubation or gesta-
tion length) but often increase embryonic abnormality or
mortality (e.g. Andrews and Rose, 1994; Andrews et al.,
1997; Deeming and Ferguson, 1991; Sexton and
Marion, 1974; Shine and Harlow, 1996). Apart from the
effects on the rate of embryonic development and
embryonic abnormality or mortality, thermal environ-
ments experienced by developing embryos also affect a
number of phenotypic attributes of the hatchling, includ-
ing morphology (Du and Ji, 2002; Ji and Du, 2001a, b;
Overall, 1994), energy reserves (Du and Ji, 2001),
behavior (Burger, 1991; 1998), post-hatching growth
(Brana and Ji, 2000; Du and Ji, 2003; Rhen and Lang,
1995), and gender in species with temperature-depen-
dent sex determination (Janzen and Paukstis, 1991). It
has been repeatedly reported for oviparous reptiles that
eggs incubated at optimal temperatures not only exhibit
high hatching success but also produce good-quality
hatchlings.
The range of optimal temperatures for reptilian
embryos is often narrow and varies not only among but
also within species. For example, the optimal incubation
temperatures fall within the range from 24°C to 26°C in
Xenochrophis piscator (checkered keelback; Ji et al.,
2001) and Deinagkistrodon acutus (five-paced pit-viper;
Lin et al., 2005) but, in Elaphe carinata (king ratsnake;
Ji and Du, 2001b), Naja atra (Chinese cobra; Ji and Du,
2001a), Rhabdophis tigrinus lateralis (red-necked keel-
back; Chen and Ji, 2002), Dinodon rufozonatum (red-
banded wolf snake; Ji et al., 1999b; Zhang and Ji, 2002),
Ptyas korros (gray ratsnake; Du and Ji, 2002) and P.
mucosus (mucous ratsnake; Lin and Ji, 2004), generally
within the range from 26°C to 30°C. Pelodiscus sinensis
(Chinese soft-shelled turtle), however, has a wider range
of optimal incubation temperatures, because tempera-
tures exert no important effects on hatching success and
hatchling phenotypes within the range from 24°C to
34°C (Du and Ji, 2003; Ji et al., 2003). In Eumeces chi-
nensis (Chinese skink), eggs from a lower latitudinal
population have a narrower range of optimal incubation
© 2008 by Asiatic Herpetological Research
2008
Asiatic Herpetological Research, Vol. 1 1
25
temperatures than do those from a higher latitudinal
population, primarily because of more stable thermal
environments in the former population (Ji et ah, 2002).
Overall, previous studies suggest that optimal tempera-
tures for developing embryos differ among reptiles dif-
fering in habitat use and/or distributional range.
The stripe-tailed ratsnake Elaphe taeniura is a large
sized (to 1800 mm SVL [snout-vent length]) oviparous
colubrid snake that ranges from the central and southern
provinces of China to Korea, Burma, Laos, Vietnam and
India (Zhao, 1993). Wild population of this snake have
declined dramatically due to habitat loss and over-har-
vesting over the past two decades (Zhao, 1998).
Fecundity, reproductive output and embryonic mobiliza-
tion of energy and material during incubation have been
reported for snakes from Zhoushan Islands (Ji et al.,
1999a; 2000). Because eggs were never incubated at
multiple temperatures, the range of incubation tempera-
tures optimal for developing embryos of E. taeniura
remains unknown. To fill this gap, we incubated eggs
produced by females from a southern population
(Guangxi, China) at five constant temperatures ranging
from 22°C to 32°C. Specifically, our aims are to (1)
examine the effects of incubation temperatures on hatch-
ing success, embryonic use of energy and hatchling mor-
phology, and (2) determine the range of optimal temper-
atures for embryos of E. taeniura.
Materials and Methods
We obtained 13 gravid E. taeniura (SVL: 1220-1690
mm; postoviposition body mass: 277.9-755.0 g) in June
1998 from a private hatchery in Guilin (Guangxi, south-
ern China), and brought them to our laboratory in
Hangzhou, where they were maintained in a 2000 x 800
X 800 (length X width X height) mm wire cage placed in
a room inside which air temperatures were never higher
than 30°C. Food (eggs of Coturnix coturnix) and water
were provided ad libitum. The snakes laid eggs between
23 June and 3 July (clutch size: 8.8±0.4, range: 7-11).
We collected the eggs within a few hours after being
laid. Each egg was measured (to the nearest 0.01 mm)
for length and width with a Mitutoyo digital caliper and
weighed (to the nearest 1 mg) on a Mettler balance. One
freshly laid egg from each clutch was dissected to deter-
mine the composition of eggs. Egg contents (yolk plus
embryo) were placed in pre-weighed glass dishes, and
weighed. Shells were briefly rinsed, dried by blotting
with paper towels and weighed. Egg contents and shells
were weighed again after oven drying to constant mass
at 65°C. The remaining eggs were incubated systemati-
cally at five constant temperatures (22, 24, 27, 30, and
32 [± 0.3]°C); such that eggs from single clutches were
distributed almost equally among the five temperature
treatments.
Eggs were individually incubated in covered plastic
jars containing known amounts of vermiculite and dis-
tilled water at approximately -12 kPa water potential
(vermiculite: water = 1:2). One-third of the egg was
buried lengthwise in the incubating substrate, with the
surface near the embryo exposed to air inside the jar.
Jars were equally assigned to five incubators (Guanzhou
medical instrument, China), with incubation tempera-
tures set at 22, 24, 27, 30, and 32 (± 0.3)°C, respectively.
We moved jars among the shelves in the incubator daily
according to a predetermined schedule to minimize any
effects of thermal gradients inside the incubator. Jars
were weighed on alternate days, and distilled water was
added evenly into substrates when necessary to compen-
sate for evaporative losses and water absorbed by eggs,
thereby maintaining the substrate water potential con-
stant.
The duration of incubation, measured as the number
of days to pipping, was recorded for each egg.
Hatchlings were collected, measured (for SVL and tail
length), and weighed a few hours after hatching, and
then euthanized by freezing to -15°C for determination
of composition and sex. The killed hatchlings were sep-
arated into carcass, residual yolk and fat bodies. The
Table 1. The effect of temperature on incubation duration, hatching success, and sex ratio in Elaphe taeniura. Data on
incubation duration are expressed as mean±1 SE.
26
Asiatic Herpetological Research, Vol. 1 1
2008
Figure 1. Adjusted means (±1 standard error) for body
mass, SVL and tail length of hatchlings from different
incubation temperatures, with initial egg mass being set
at 23.5 g. Adjusted means with different letters differ sig-
nificantly. Numbers under the error bars in the upper plot
are sample sizes, and are applicable to the other two
plots.
three components of the hatchling were dried in an oven
(65°C) to constant mass, weighed and preserved frozen
for later analyses. We determined the sex of hatchlings
by pressing on both sides of the ventral tail base with
forceps to record the presence or absence of hemipenes;
hatchlings with everted hemipenes were recorded as
males.
We extracted non-polar lipids from dried samples of
egg contents and hatchlings in a Soxhlet apparatus for a
minimum of 5.5 h using absolute ether as solvent. The
amount of lipids in each sample was determined by sub-
Temperature (°C)
Figure 2. Carcass, yolk sac and fat bodies of hatchling
Elaphe taeniura incubated at different temperatures.
Graphs show adjusted mean (± standard error), with ini-
tial egg mass as the covariate. Adjusted means with dif-
ferent letters above the error bars differ significantly.
Numbers under the error bars in the upper graph are
sample sizes, and apply to all graphs within this figure.
tracting the lipid-free dry mass from the total sample dry
mass. We determined energy density of each dried sam-
ple using a GR-3500 adiabatic bomb calorimeter
(Changsha Instruments, China).
All data were tested for normality using
Kolmogorov-Smimov test and for homogeneity of vari-
ance using Bartlett’s test. Parametric analyses were used
to analyze data when the assumptions for these analyses
were met; otherwise, nonparametric analyses were used.
Values are presented as mean ± 1 standard error, and the
significance level is set at a = 0.05.
2008
Asiatic Herpetological Research, Vol. 1 1
27
Table 2. Lipids and energy in egg contents and shell dry mass of hatched eggs and freshly laid eggs in Elaphe taeniura
Data are expressed as adjusted mean ±1 SE, with initial egg mass as the covariate.
Results
The mean values for incubation length varied consider-
ably among the five temperature treatments (ANOVA;
F475 = 687.2, p < 0.0001). Incubation length decreased
as incubation temperature increased, but not in a linear
pattern. The mean incubation length was shortened by
3.5 d from 30°C to 32°C, 12.4 d from 27°C to 30°C,
19.7 d from 24°C to 27°C, and 15.7 d from 22°C to 24°C
(Table 1). Incubation temperature affected hatching suc-
cess (G-test, G =11.51, df— A, p < 0.05), but not the
sexual phenotype of hatchlings (G = 4.73, df = 4,
p > 0.25). Hatching successes were apparently lower at
the two extreme temperatures (22°C and 32°C) than at
the other three moderate temperatures (24, 27, and
30°C) (Table 1).
There were no between-sex differences in all exam-
ined hatchling variables (all p > 0.05), so we pooled data
for both sexes. All examined hatchling variables, except
yolk sac, were positively correlated with initial egg
mass). ANCOVAs with initial egg mass as the covariate
showed that incubation temperatures significantly
affected wet body mass (F474 = 3.67, p <0.01; Fig. la),
SVL (F4 j4 = 4.21, p < 0.01; Fig. lc) and tail length ( F474
= 4.31,/? < 0.01; Fig. Id) of hatchlings, but not hatchling
dry body mass ( F 474 = 0.38, p > 0.05; Fig. lb). Mean
values for wet body mass, SVL and tail length were all
smaller in hatchlings incubated at 32°C than in hatch-
lings incubated at the other four temperatures (Fig. la, c,
d). Hatchlings from different incubation temperatures
differed in carcass mass (ANCOVA with the initial egg
mass as the covariate: F474 = 6.36, p < 0.001; Fig. 2a)
and yolk sac dry mass (ANOVA: F475 - 4.79, p < 0.01;
Fig. 2b), but not fatbody dry mass (F474 = 0.37,
p > 0.05; Fig. 2c). Hatchlings from 32°C had lighter car-
cass dry mass but larger residual yolk sac, whereas
hatchlings from 22°C had heavier carcass but smaller
residual yolk sac (Fig. 2a, b).
Energy contents (F4 74 = 2.78, p < 0.05) and non-
polar lipids (F474 = 2.80, p < 0.05) differed among
hatchlings from different incubation temperatures, with
hatchlings incubated at 22°C containing lower quantities
of energy and non-polar lipid than did those incubated at
other four temperatures (Table 2). Conversion efficiency
of energy during incubation at 22°C (71.1%) was thus
lower than those at 32, 30, 27, and 24°C (83.9%,
82.6%, 81.5%, and 80.2%). Similarly, conversion effi-
ciency of lipid at 22°C (55.3%) was lower than those at
32, 30, 27, and 24°C (70.9%, 69. %, 67.3% and 64.9 %).
Additionally, shells of hatched eggs were significantly
lighter than shells of freshly laid eggs (F5 84 = 3.19, p <
0.05; Table 2).
Discussion
As in numerous other reptiles, thermal environments
experienced by developing embryos affect hatching suc-
cess, incubation length, embryonic expenditure of ener-
gy, and linear dimensions (SVL and tail length) and
body composition of hatchlings in Elaphe taeniura. Our
results provide support for the previous conclusion that
reptilian embryos developing at relatively low or moder-
ate temperatures produce well developed and thus, larg-
er hatchlings (e.g. Deeming and Ferguson, 1991; Du and
Ji, 2002; Ji and Du, 2001a, b). The larger hatchling size
has an association with the greater carcass dry mass
(Chen and Ji, 2002; Du and Ji, 2002; Ji et al., 1997; Ji
and Sun, 2000). Data from the current study proved that
this conclusion is also true in E. taeniura (Fig. 1; Fig. 2).
The finding that more yolks remain unutilized at hatch-
ing when eggs are incubated at high temperatures has
been reported for nearly all reptiles studied to-date (e.g.,
Beuchat, 1988; Du and Ji, 2002; Ji and Du, 2001a, b; Lin
et al., 2005; Phillips et al., 1990; Phillips and Packard,
1994). In E. carinata (Ji et al., 1997), E. taeniura (Ji et
al., 1999a), D. rufozonatum (Ji et al., 1999b) and P. kor-
ros (Ji and Sun, 2000), hatchlings exhibit a substantial
increase in size (SVL) during the first post-hatching
days due to the transfer of resources in the residual yolk
into carcass.
The proportion of lipids transferred from the egg
contents into the hatchling was noticeably lower than
those of energy. Given that mass-specific energy density
is much higher in lipids than in proteins and carbohy-
drates, this result provides evidence that lipids are the
main source of energy for embryonic development.
28
Asiatic Herpetological Research, Vol. 11
2008
Hatchling size and mass were primarily determined by
the embryonic expenditure of energy during incubation
after removing the influence of variation in initial egg
mass (Du and Ji, 2001, 2003; Ji and Du, 2001a, b).
Given that the total energy invested in an egg is fixed,
any increase in embryonic expenditure of energy during
incubation may inevitably result in production of small
sized or lighter hatchlings. Incubating eggs at low tem-
peratures or high temperatures may increase energy
expenditure for embryonic development due to the
increased incubation length and/or embryonic metabo-
lism (Booth, 1998; Booth and Astill, 2001; Packard and
Packard, 1988). Consequently, eggs incubated at moder-
ate temperatures usually produce larger and heavier
hatchlings than did those at low or high temperatures.
A prolonged exposure of eggs of E. taeniura to tem-
peratures lower than 24°C or higher than 30°C may have
a detrimental effect on embryonic development, as indi-
cated by the fact that hatching success decreases dramat-
ically at temperatures outside this temperature range
(Table 1). The mean incubation length 30°C is 53.9
days, approximately 3.4 days longer than that at 32°C,
so the ecological disadvantage of the increased incuba-
tion length (and thus, decreased growth period prior to
the onset of the first winter) due to a decrease in incuba-
tion temperature from 32°C to 30°C is less pronounced.
Considering that less developed hatchlings are produced
at 32°C and that hatching success is low at this temper-
ature, we conclude that the temperature of 32°C is out-
side the range of optimal temperatures for incubating
eggs of E. taeniura. Eggs incubated at 24°C exhibit high
hatching success and produce well developed hatch-
lings. However, the majority of hatchlings from eggs
incubated at 24°C appear between late September and
mid-October, so the growth prior to the onset (late
November) of the first winter for these hatchlings is
about 1.5-2 months. As incubation length increasingly
increases as temperature decreases in E. taeniura (Table
1 ), we expect that the disadvantage of incubating eggs of
E. taeniura at temperatures lower than 24°C can be very
pronounced due to the increasingly prolonged incuba-
tion length. For eggs of reptiles incubated under natural
conditions, the prolonged incubation length at low tem-
peratures also increases exposure of eggs to the effects
of adverse biotic (increased microbial contamination)
and abiotic factors(extreme thermal and hydric condi-
tions) in the incubation environment of the eggs, which
potentially reduces hatching success. Thus, the tempera-
ture of 24°C is suitable but not optimal for incubating
eggs of E. taeniura. Taking the energy expenditure dur-
ing incubation, the rate of embryonic development and
hatchling phenotypes into account, we consider that
temperatures around 27°C are optimal for incubating
eggs of E. taeniura.
Acknowledgments
This work was supported by a grant from Zhejiang
Provincial Natural Science Foundation. Many thanks
were given to X.-Z. Hu, W.-Q. Xu, and J.-Q. Du for their
assistant in the laboratory.
Literature Cited
Andrews, R. M. and B. R. Rose. 1994. Evolution of
viviparity: constraints on egg retention.
Physiological Zoology 67: 1006-1024.
Andrews, R. M., C. P. Qualls and B. R. Rose. 1997.
Effects of low temperature on embryonic develop-
ment of Sceloporus lizards. Copeia 1997: 827-833.
Beuchat, C. A. 1988. Temperature effects during gesta-
tion in a viviparous lizard. Journal of
Thermodynamic Biology 13: 135-142.
Birchard, G. F. 2004. Effects of incubation temperature.
In: Reptilian incubation: environment, evolution,
and behaviour, p. 103-123, Deeming, D. C. (ed.).
Nottingham: Nottingham Univ. Press.
Booth, D. T. 2004. Artificial incubation. In: Reptilian
incubation: environment, evolution, and behav-
iour. p. 253-263, Deeming, D. C. (ed.).
Nottingham: Nottingham Univ. Press.
Booth, D. T. 1998. Effects of incubation temperature on
the energetics of embryonic development and
hatchling morphology in the Brisbane river turtle
Emydura signata. Journal of Comparative
Physiology. 168 B: 399^404.
Booth, D. T. and K. Astill. 2001. Incubation tempera-
ture, energy expenditure and hatchling size in the
green turtle ( Chelonia mydas ), a species with tem-
perature-sensitive determination. Australian
Journal of Zoology 49: 389-396.
Booth, D. T., M. B. Thompson, and S. Herring. 2000.
How incubation temperature influences the physi-
ology and growth of embryonic lizards. Journal of
Comparative Physiology 170B: 269-276.
Brana, F., and X. Ji. 2000. Influence of incubation tem-
perature on morphology, locomotor performance,
and early growth of hatchling wall lizards
(■ Podarcis muralis). Journal of Experimental
Zoology 286: 422^433.
2008
Asiatic Herpetological Research, Vol. 1 1
29
Burger, J. 1991. Effects of incubation temperature on
behavior of hatchling pine snakes: implications for
reptilian distribution. Behavioral Ecology
Sociobiology 28: 297-303.
Burger, J. 1998. Antipredator behaviour of hatchling
snake: ettects of incubation temperature and stim-
ulated predators. Animal Behavior 56: 547-553.
Chen, H. L. and X. Ji. 2002. The effects of thermal envi-
ronments on duration of incubation, hatching suc-
cess and hatchling traits in a colubrid snake
Rhabdophis tigrinus lateralis (Boie). Acta Ecology
Sinica 22: 1850-1858.
Deeming, D. C. and M. W. J. Ferguson. 1991.
Physiological effects of incubation temperature on
embryonic development in reptiles and birds. In:
Egg Incubation, Its Effect on Embryonic
Development in Birds and Reptiles, p. 147-171.
Deeming, D.C., and M. W. J. Ferguson. Eds.
Cambridge: Cambridge University Press.
Du, W. G. and X. Ji. 2001. Influence of incubation tem-
perature on embryonic use of material and energy
in the Chinese soft-shelled turtle ( Pelodiscus sinen-
sis). Acta Zoology Sinica 47: 512-517.
Du, W. G. and X. Ji. 2002. Effects of incubation temper-
ature on duration of incubation, hatching success,
and hatchling traits in the gray rat snake, Ptyas kor-
ros. Acta Ecology Sinica 22: 548-553.
Du, W. G. and X. Ji. 2003. The effects of thermal envi-
ronments on size, locomotor performance and
early growth of hatchling soft-shelled turtles,
Pelodiscus sinensis. Journal fo Thermal Biology.
28: 279-286.
Janzen, F. J., and G. L. Paukstis. 1991. Environmental
sex determination in reptiles: ecology, evolution,
and experimental design. Quarterly Review of
Biology 66: 149-179.
Ji, X, P. Y. Sun, X. F. Xu, and W. G. Du. 2000.
Relationships among body size, clutch size, and
egg size in five species of oviparous colubrid
snakes from Zhoushan islands, Zhejiang, China.
Acta Zoologica Sinica 46: 138-145.
Ji, X., W. G. Du, and X. F. Xu. 2001. Influence of ther-
mal and hydric environments on incubating eggs
and resultant hatchlings in a colubrid snake
Senochrophis piscator. Acta Zoologica Sinica 47:
45-52.
Ji.X., H. Y. Hang, X. Z. Hu and W. G. Du. 2002.
Geographic variation in female reproductive char-
acteristics and egg incubation in the Chinese skin
Eumeces chinensis. Chinese Journal of Applied
Ecology 13: 680-684.
Ji, X., F. Chen, W. G. Du and H. L. Chen. 2003.
Incubation temperature affects hatchling growth
but not sexual phenotype in the Chinese soft-
shelled turtle Pelodiscus sinensis. Journal of
Zoology, London 261: 409-416.
Ji, X., and W. G. Du. 2001a. Effects of thermal and
hydric environments on incubating eggs and hatch-
ling traits in the cobra, Naja naja atra. Journal of
Herpetology 35: 186-194.
Ji, X. and W. G. Du. 2001b. The effects of thermal and
hydric environments on hatching success, embry-
onic use of energy and hatchling traits in a colubrid
snake, Elaphe carinata. Comparative
Biochemistry and Physiology 129A: 461^171.
Ji, X. and P. Y. Sun. 2000. Embryonic use of energy and
post-hatching yolk in the gray rat snake, Ptyas kor-
ros (Colubridae). Herpetological Journal 10:
13-17.
Ji, X., P. Y. Sun, S. Y. Fu and H. S. Zhang. 1997.
Utilization of energy and nutrients in incubating
eggs and post-hatching yolk in a colubrid snake,
Elaphe carinata. Herpetological Journal 7: 7-12.
Ji, X., P. Y. Sun, S. Y. Fu, and H. S. Zhang. 1999a.
Utilization of energy and material in eggs and
posthatching yolk in an oviparous snake, Elaphe
tarniura. Asiatic Herpetological Research 8:
53-59.
Ji, X., X. F. Xu, and Z.H. Lin. 1999b. Influence of incu-
bation temperature on characteristics of Dinodon
rufozonatum (Reptilia: Colubridae) hatchlings,
with comments on the function of residual yolk.
Zoological Research 20: 342-346.
Lin, Z.H., X. Ji, L. G. Luo, X. M. Ma. 2005. Incubation
temperature affects hatching success, embryonic
expenditure of energy and hatchling phenotypes of
a prolonged egg-retaining snake, Deinagkistrodon
acutus (Viperidae). Journal of Thermal Biology
30: 289-297.
Overall, K. L. 1994. Lizard egg environments. In: Lizard
Ecology: Historical and Experimental
30
Asiatic Herpetological Research, Vol. 1 1
2008
Perspectives, p. 51-72. Vitt, L. J., and E. R. Pianka,
Eds. Princeton: Princeton University Press.
Packard, G. C. and M. J. Packard. 1988. The physiolog-
ical ecology of reptilian eggs and embryos. In:
Biology of the Reptilia vol. 16. p. 523-605. Gans,
C., and R. B. Huey, Eds. New York: A. Liss.
Phillips, J. A., A.Garel, G. C. Packard, and M. J.
Packard. 1990. Influence of moisture and tempera-
ture on eggs and embryos of green iguanas {Iguana
iguana). Herpetologica, 46: 238-245.
Phillips, J. A. and G. C. Packard. 1994. Influence of
temperature and moisture on eggs and embryos of
the white-throated Savanna monitor Varanus
albigularis : implications for conservation.
Biological Conservation 69: 131-136.
Rhen, T., and J. W. Lang. 1995. Phenotypic plasticity for
growth in the common snapping turtle: effects of
incubation temperature, clutch and their interac-
tion. American Naturalist 146: 726-747.
Sexton, O.J., and K. R. Marion. 1974. Duration of incu-
bation of Sceloporus undulates eggs at constant
temperature. Physiological Zoology 47: 91-98.
Shine, R., and P. S. Harlow. 1996. Maternal manipula-
tion of offspring phenotypes via nest-site selection
in an oviparous lizard. Ecology 77: 1808-1817.
Zhang, Y. P. and X. Ji. 2002. Further studies of egg incu-
bation on red-banded wolf snakes Dinodon rufo-
zonaturn , with comments on influence of hydric
environments. Acta Zoologica Sinica 48:51-59.
Zhao, E. M. and K. Adler. 1993. Herpetology of China,
Ohio: Oxford. 235 pp.
Zhao, E. M. 1998. China red data book of endangered
animals: Amphibia and Reptilia. Beijing: Science
Press. 245-247 pp.
Submitted: 1 7 November 2006
Accepted: 22 September 2007
2008
Asiatic Herpetological Research, Vol. 1 1
pp.31-38
Behavioral Observations and Descriptions of the Endangered Knobby
Newt Tylototriton wenxianensis and Their Application in Conservation
Da-Jie Gong* and Mai Mu
Department of Biology, College of Life Science, Northwest Normal University
Lanzhou, Gansu, China.
* Corresponding author E-mail: [email protected]
Abstract.- Tylototriton wenxianensis is an endangered species at the status of VU. This paper introduces observations
and studies including breeding, territorial, communication and antipredatory behaviors. The rules and mechanisms of
the behaviors are recorded separately and described in the paper. Relationships between the behaviors and environ-
ment are also explained tor the purpose of describing how the environment acted on the behaviors and how the behav-
iors adapted to the environment. The paper ends with conservation plans in connection with behavioral ecology: A)
protect the particular habitat and avoid anthropogenic threats, B) artificial construction for natural migration and gene
communication and C) artificial breeding and re-introduction into nature.
Keywords.- Observations, Tylototriton wenxianensis , behaviors, habitats, conservation.
Introduction
Tylototriton wenxianensis (Caudata: Salamandridae) is
peculiar in China and poorly known. It is only found
along the boundary between Gansu and Sichuan
Province, narrowly distributed in Wenxian, Qingchuan
and Pingwu (details see Table 1 and Fig. 1). It was
defined as a threatened species with the status of VU
(IUCN, 2006).
A representative of the Family Salamandridae, T.
wenxianensis has rough and toxic skin with seasonal
colors. The bilateral warts stay longitudinal and clus-
tered in the same size and the boundaries between them
are not clear enough. It is dark all over apart from the
red-orange fingers, toes and the venter of the tail (Fei,
1993).
The newt lives in the heavily forested mountains at
approximately 940 m. The adult is terricolous and usu-
ally wanders about the pool. It stays hidden under wet
gravel or small muddy caves covered by fallen leaves in
the daytime and appears at night for preying (Gong and
Mou, 2006).
Behavioral studies on tailed amphibians have
recently been reported. The studies were mainly focused
in the following fields: breeding behaviors, including
sexual recognition and sexual selection (Dawley, 1984),
modes of courtship and mating (Arnold et al., 1972,
1977; Salthe, 1967, 1974), sperm competition (Arnold,
1977; Halliday, 1998; Massey, 1988; Sparreboom, 1995;
Verrel et al., 1998), reproductive behavior (Fang, 1984;
Harris et al., 2002; Park et al., 2000), parental care
(Cramp, 1995; Nussbaum, 1985; Peterson, 2000), evolu-
tion of reproduction (Arnold, 1977; Veith, 1998; Verrell
and Krenz, 1998,); migratory behavior (Amtzen, 2002;
Douglas, 1979; Griffiths, 1996; Serbiolova, 1995;
Twitty, 1966); territorial behavior (Mathis, 1991; Mathis
et al.,1998; Mathis et al.,2000; Simons et al., 1997);
communications (Holliday, 1997; Houck, 1988; Houck
and Sever, 1994; Rollmann, 1999; Verrell, 1989,1989a;);
antipredatory behavior (Brodie, 1990; Graves and
Quinn, 2000; Maerz et al.,2001; Sih et al., 2000, 2003;
Storfer and Sih, 1998; Sullivan, 2002; Woody and
Mathis, 1997). All the above provide a source of refer-
ence for the behavioral study on T. wenxianensis.
Methods
Migratory behavior.- We chose the habitat in Qingchuan
as the site to observe, where a large population was
found (Gong and Mou, 2006). The newts are not active
year round except for the breeding season, so their
migratory behaviours seem quite obvious and clear. We
© 2008 by Asiatic Herpetological Research
32
Asiatic Herpetological Research, Vol. 1 1
2008
Date
Figure 2. Reproductive migration of Tylototriton wenxianensis. The polyline represents temperature, columns repre-
sent number of the migratory newts and “ * ” rainy days.
made continuous observations when they migrated for
breeding towards the pools nearby. We marked each
migratory group with varisized loops and observed by
radio tracking and GPS. Finally we made records of the
time, route length, size of groups and sex ratio in the
migration.
Reproductive behavior.- Reproductive behaviors
included mating and spawning. We observed the course
and took down the data of sex ratio, time, envioronment
and quantity of the spawns etc.
Conmmunication.- Communication happens along with
courtship. We tried to understand how the newts com-
municate with each other and why. The communications
included chemical signals and body-contacts (Jiang,
2004). Mechanisms of chemical signals from glands are
expected to be understood through dissection. Types of
the body-contacts and their effects on courtship were
studied.
Territorial behaviors - We measured the size of the ter-
ritory occupied by 6 female newts and size of the tails
and bodies in contrast. Aggressive behaviors related to
the available prey in the environment were also
observed. Relationships between the data and phenome-
non were discussed and concluded.
Antipredatory behavior.- The newts were less aggres-
sive without structures for aggressivity (Jiang, 2004).
They moved too slowly to escape attacks from enemies
and to defend themselves. We made some model ene-
mies and demonstrated the predation and antipredatory
behaviors artificially.
Results and Analysis
Behaviors.- We made continuous observations on the
migratory behaviors and found 186 adults including 170
females and only 16 males, the ratio was 170:16 ($:$)
= 10.625:1. Breeding lasted from early April to late May
with a peak from April 8th to May 6th. The average tem-
perature was 15.5±4°C (Fig. 2).
Like many other newts, T .wenxianensis does not
seem to have significant secondary sexual characters. It
distinguishes and selects the opposite sex primarily by
sight and sense of smell. The male seemed more active.
It courted the female by wagging its tail and dancing
round. Meanwhile, the female was secreting chemicals
and emitting a strong smell to attract the male. Soon the
male bit the female on the tail (or hind limb), then they
circled around both with their tails wagging (Fig. 3).
Experiments show that the male prefers to choose a big-
ger one with more ovums and a stronger smell.
Mating did not accompany spawning in the mean-
time. It was the female that selected where to spawn.
The male moved to the pool and settled down earlier
than the female. However, the female left soon after
spawning, while the male stayed untill the end of the
Figure 3. Model of mating behavior. Shows the male (black) wagging its tail and dancing round.
2008
Asiatic Herpetological Research, Vol. 1 1
33
Table 1 . Distribution and flora of T. wenxianensis along the boundary between Gansu and Sichuan Province.
Figure 4. The sperm transmission. Swells show the col-
loidal secretion.
Figure 6. Rigid body: the reaction to anti-predator. Shows
ribs jutting through the side warts.
Figure 5. The courtship behavior. Shows the transmis-
sion of pheromones in the fantail.
Figure 7 The raised tail and warning color on the ventral
surface of the tail.
34
Asiatic Herpetological Research, Vol. 1 1
2008
Figure 8. The protuberant glands and warning color on
the back. Shows harmful and toxic skin secretion, glan-
diform warts, spine glands, caudal glands, glandiform
warts, spine glands, caudal glands, tergal glands, etc.
Figure 10. Mimicry: newt playing dead, with venter
upward and body rigid.
v
Figure 9. Playing dead. Shows the newts played dead
with upward bottom and rigid body.
Figure 11. The breeding pool (after spawning). Vicinity of
Wuxing Village, Sichuan Province, southwest China.
Table 2. Relation between spawning territory, food and size of six female newts.
Table 3. The antipredatory behaviors of T. wenxianertsis, grouped by different types. The observations were made in
the field and in artificial conditions, a. harmful skin secretion; b. toxic skin secretion; c. parotids; d. glandiform warts; e.
spine glands; f. caudal glands; g. tergal glands; h. tergal colors; i. ventral colors; j. rigid body; k. roll of body; I. exposed
abdomen; m. raised tail; n. raised jaw; o. arched body; p. larger head; q. swagging tail; r. curved forehead; s. extended
nerve.
2008
Asiatic Herpetological Research, Vol. 11
35
Figure 12. The artificial breeding box made of glass, 110
x 40 x 60 cm (lateral view). Shows the constitution and
features of the breeding ecotope under artificial control.
breeding season. The analysis from Douglas (1979):
First, to choose the optimum condition for spawning and
to reduce risks in breeding migration; Second, to control
the male genotype effectively through sexual selection.
Mating behavior happened on land, while spawning
underwater. We analyzed the reason: the adult newt
mainly lives a terricolous life. Sometimes it approaches
the pools or streams for food. The observations on the
behaviors in captivity indicate that the adults needed
almost no water unless they felt too dry. They had adapt-
ed to the climate overland. In addition, in reproductive
seasons, inorganic conditions overland near the pools
may help them to secrete pheromones and sex hormones
which could be significantly reduced underwater.
The newt took no attack on its kin, but became quite
different towards non-related individuals. The newt rec-
ognized its kin through chemical signals. In the hot sum-
mer, the adult admitted the posterity into its territory
sometimes and food became insufficient. Occupying ter-
ritory usually accompanied attacks and fights. That
depended on food quantity, size of body and environ-
ment (Table 2). The newt with longer tail and body
occupied larger territory, closely related to the food
quantity.
Communications were drived mainly by chemical
signals and body contact. Chemical signals are neces-
sary for the accurate and regular courtship behavior. The
newts distinguished the sex and attracted each other by
transmission of pheromones (Fig. 4) and secretion of
hormones (Fig. 5), which later brought about the mating
behavior.
Body contact was also important, particularly in
breeding behavior. Tactile signals were transmitted
through touch on the mouth, collisions and friction
between bodies.
In the long course of evolution, series of antipreda-
tory behaviors had formed against captures, such as
escapes, cryptic coloration, rigid body (Fig. 6), apose-
matic coloration (Fig. 7, Fig. 8), camouflage (Fig. 9),
warning postures (Fig. 7), imitative toxicants, particular
skeletal adaptations (Fig. 6), chemical defenses and
playing dead (Fig. 10) etc. (Table 3).
Relationship between the behaviors and environment-
al female finished spawning in a short time without
male involved. Spawning lasted 2-3 days smoothly in
rainy seasons without interference. They got to the
spawning pools no sooner than they selected the proper
sites. Spawning began one day later. The female
spawned one a time lasting half a hour, and the whole
course 5-6 hours. The course maintained a even pace
slowly without a peak.
In Qingchuan, three pools were found with female
newts and a mass of spawn. The three conditions for
spawning sites were: A) ground covered with plants (the
plants may be divided into three layers: the upper con-
sisting of tall sparse laurisilvae, bushes in the middle and
wet weeds at the bottom), B) spawning sites with semi-
permanent pools, and the water soaked out after rain, C)
it chose a mesa with loose soil as the spawning site on
the hillside, covered by fallen leaves (Fig. 11).
The newt preyed mainly on insects, earthworms and
snails. Like other amphibians, it stayed hidden in the day
and preyed in the night. The behaviors changed sensi-
tively with the temperature and sunlight.
In summers, plants flourished and numerous insects
appeared, when the newt acts frequently. After thunder-
storms, earthworms come out from the soil and supply
food to the newts. In winter, the newts have to hibernate
in response to the lack of food and low temperature.
Conservation plans.-
(1) Protect the particular habitat and avoid anthro-
pogenic threats.
•Figure 10 shows the particular breeding habitat. The
newts enter the pools and ground nearby only in
Table 4. Relationship between the conditions and hatching rate under artificial control.
*Huang (2007) reported that pH 5.2-6.0 was most suitable for the development of larvae.
36
Asiatic Herpetological Research, Vol. 11
2008
reproductive seasons, so it is of great significance to
protect the similar pools. The pools were more or less
50 cm deep, 10 m2 in size and at an elevation of 1000
m. Pieces of rocks piled around. Soil and mud around
the pool was covered densely by rotted leaves. The
vegetation nearby were mainly made up of shrubs and
arbors (see Table 1).
Human activities, especially farming and poaching
severely threatens breeding. Recommendations about
plans to avoid these threats: A) build up fences around
the mating sites and breeding pools to prevent the
natural enemies and poachers from breaking in, B)
reduce farming and grazing by livestock, especially
around irrigation water from the pools, C) make (and
enforce) laws to punish poachers.
(2) Artificial construction for natural migration and
gene communication.
•Protect the whole habitat and ensure the natural
migratory behavior. The migratory routes are uaually
blocked by farmland etc., so it may help keep the
proper migration to build up artificial passages across
the farmland.
Connect the adjacent pools by building canals as
much as possible in order to ensure the communica-
tion of gene from different populations, especially
from breeding groups. The measure may help avoid
inbreeding depression and loss of genetic diversity in
a small population and also help with evolution of the
species.
(3) Artificial breeding and re-introduction into nature
•In view of the high sex ratio ($:$ = 10.625:1 on
average, n = 186) in the breeding season and the low
rate of hatchability (46.54%; n = 1272) in nature, it is
quite feasible to increase the hatching rate and reduce
the sperm competition between the males in artificial
conditions. We directly gathered the females and
eugenic males with longer bodies (longer tails and
bodies seem dominant in the sex competition apt to
survive under natural selection (Jiang, 2004) and
higher sperm density, and also keep the sex ratio at
1:1 in a artificial glass box (Fig. 12) to avoid compe-
tition and injury as well as to ensure high-quality
inheritance.
Studies showed that factors influencing the hatching
rate were natural enemies (such as snakes), climate
changes and pollution (Tian et al., 1997). It is an
effective approach to raising the survival rate and
enlarging the population by hatching out the larvae in
artificial conditions and re-introducing them into nature.
The conditions include temperature, humidity, sunlight
period and pH of water etc. (Table 4). Re-introduce the
juveniles into nature when they complete metamorpho-
sis and get ready to land.
Acknowledgments
We wish to thank K. R. Zhang for assistance and valu-
able help with our investigation of distribution of T.
wenxianensis and J. R. Teng who provided us the speci-
mens of T. wenxianensis.
Literature Cited
Arnold, S. J. 1972. The Evolution of Courtship Behavior
in Salamanders. Ph.D. Thesis. University of
Michigan.
Arnold, S. J. 1977. The Evolution of Courtship Behavior
in new world salamanders with some comments on
old world salamanders. In: Taylor, D. H., Ph. D.
Thesis. University of Michigan.
Amtzen, J. W. 2002. Seasonal variation in sex ratio and
asynchronous presence at ponds of male and female
Triturus newts. Journal or Herpetology 36(1): 30-
35
Brodie, E. D. 1990. Behavioral modification as a means
of reducing the cost of reproduction. American
Naturalists 134: 225-238.
Dawley, E. M. 1984. Identification of sex through odors
by male red-spotted newts, Notopthalmus viri-
descens. Herpetologica 40: 101-105.
Douglas, M. E. 1979. Migration and sexual selection in
Ambystoma jeffersonianum. Canadian Journal of
Zoology 57: 2303-2310.
Fang, J. J., S. Chen and H. Wang. 1984. [Preliminary
observation on egg depositing of Salamandrella
keyserlingii ]. Acta Herpetologica Sinica 3(3): 67-
69. (In Chinese).
Fei, L., C. Y. Ye and S. Q. Hu. 1993. The rare and eco-
nomic amphibians in China. Sichuan Science and
Technology Press, Chengdu. 103 pp. (In Chinese)
Gong, D. J. and M. Mou. The source status of salaman-
ders in Gansu and protection plans. Sichuan Journal
of Zoology 25: 332-335. (In Chinese)
Graves, B. M. and V. S. Quinn. 2000. Temporal persist-
ence of alarm phoromones in skin secretions of the
2008
Asiatic Herpetological Research, Vol. 1 1
37
salamander, Plethodon cinereus. Journal of
Herpetology 34: 287-291.
Griffiths. 1996. Newts and salamanders of
Europe. Poyser Natural History, London.
322 pp.
Halliday, T. R. 1998. Sperm composition in amphibians.
Pp. 465-502. In T.R.Birkhead and A. P. Moller,
Sperm Composition and Sex Selection. Academic
Press, London.
Halliday, T. K. 1997. The courtship of European newts:
An evolutionary perspective. Pp. 185-232. In D. H.
Taylor and S. I. Guttman. The Reproductive
Biology of Amphibians. Plenum Press, New York..
Harris, W. E. and J. R. Lucas. 2002. A state-based model
of sperm allocation in a group-breeding salamander.
Behavioral Ecology 13: 705-712.
Houck, L. D. 1988. The effects of body size on male
courtship success in a plethodontid salamander.
Animal Behaviour 36: 837-842.
Houck, L. D. and D. M. Sever. 1994. The role of the skin
in reproduction and behaviour. Pp. 351-388. In H.
Heatwole and G. Barthalamus (eds.), Amphibian
Biology, Vol. 1, The Integument, Survey Beatty and
Sons, Chipping Norton, New South Wales,
Australia.
Huang, H. L., J. R. Teng, and T. Zhang. Preliminary
study on the artificial feeding of Tylototriton
wenxianensis (to be published). (In Chinese)
IUCN. 2006. 2006 IUCN Red List of Threatened
Species. Internet references. Retrieved from
http://www.iucnredlist.org/search 14/04/2007.
Jiang, Z. G. 2004. Principles of animal behaviours and
approaches to conservation. Science Press, Beijing.
408 pp. (In Chinese)
Maerz, J. C., N. L. Panebianco and D. M. Madison.
2001. The effects of predator chemical cues and
behavioural biorhythms on the foraging activity of
terrestrial salamander. Journal of Chemical Ecology
27:1333-1344.
Massey, A. 1988. Sexual interactions in res-spotted
newts population. Animal Behaviour 36:205-210.
Mathis, A. 1991. Large male advantage for access to
females: evidence of male-male competition and
female discrimination in a terrirotial salamander.
Behavioral Ecology and Sociobiology 29:133-138.
Mathis, A., K. Deckard, and C. Duer. 1998. Laboratory
evidence for territorial behaviour by the southern
red-backed salamander, Plethodon serratus:
Influence of residency status and pheromonal
advertisement. Southwestern Naturalists 43: 1-5.
Mathis, A., D. W. Schmidt, and K. A. Medley. 2000. The
influence of residency status on agonistic behavior
of male and female Ozark zigzag salamanders,
Plethodon angusticlavius. The American Midland
Naturalist 143: 245-249.
Nussbaum, R. 1985. The evolution of parental care in
salamanders. Miscellaneous Publications, Museum
of Zoology, University of Michigan 169:1-50.
Park, D. and S. R. Park. 2000. Multiple insemination
and reproductive ecology of Hynobius leechii.
Jounal of Herpetology 34: 594—598.
Peterson, M. G. 2000. Nest, but not egg, fidelity in a ter-
ritorial salamander. Ethology 106: 781-794.
Rollmann, S. M., L. D. Houck and R. C. Feldhoff 1999.
Proteinacious pheromone affecting female receptiv-
ity in a terriestrial salamander. Science 285: 1907-
1909.
Salthe, S. N. 1967. Courtship patterns and the phylogeny
ofUrodeles. Copeia 1967: 100-117.
Salthe, S. N. and J. S. Mecham. 1974. Reproductive and
courtship patterns. In Loffs, B. The physiology of
amphibians, Vol. 2. New York, Academic Press:
309-521.
Serbiolova, M. and H. Ota. 1995. Notes on the life-his-
tory and reproductive behaviour of Cynops ensicau-
da popei (Amphibia: Salamandridae).
Herpetological Journal 5: 310-315.
Sih, A., L. B. Kates and E. C. Mauder. 2003.
Behavioural correlations across situations and the
evolution on antipredator behavior in a sunfish-
salamander. Animal Behavior 65:29-44.
Sih, A., L. B. Kates and E. C. Mauder. 2000. Does phy-
logenetic interia explain the evolution of ineffective
antipredator behaviour in a sunfish-salamander sys-
tem? Behavioral Ecology and Sociobiology 49: 48-
38
Asiatic Herpetological Research, Vol. 11
2008
56.
Simons, R. R., R. G. Jaeger and B. E. Felgenhaur. 1997.
Competition assessment and area defense by terri-
torial salamanders. Copeia 1997(1): 70-76.
Sparreboom, M. and H. Ore. 1995. Notes on the life-his-
tory and reproductive behaviour of Cynops ensicau-
da Popi (Amphibia: Salamandridae). Amphibia-
Reptilia 16: 15.
Storfer A. and A. Sih. 1998. Gene flow and ineffective
antipredatory behaviour in a stream-breeding sala-
mander. Evolution 52: 558-565.
Sullivan, A. M., J. M. Maerz, and D. M. Madison. 2002.
Anti-predator response of red-backed salamanders
( Plethodon cinreus) to chemical cues from garter
snakes ( Thamnophis sirtalis ): laboratory and field
experiments. Behavioral Ecology and Sociobiology
51: 227-233.
Twitty, V. C. 1966. Of scientists and salamanders.
Freeman, San Francisco. 101pp.
Tian, Y. Z., A. Q. Sun and S. Li. 1997. Observations on
the reproductive behaviours of Tylototriton
kweichowensis. Chinese Journal of Zoology 32:
20-23. (In Chinese)
Verrel, P. A. and L. E. Brown. 1993. Competition among
females for mates in a species with male parental
care, the midwife toad Alytes obstetricans.
Ethology 93: 247-257.
Verrell, P. L. and J. D. Krenz. 1998. Competition for
mates in the mole salamander, Ambystoma
talpoideum : tactics that may maximize male mating
success. Behavior 135: 121-138.
Verrell, P. A. 1989. Male mate choice for fecund female
in a plethodontid salamander. Animal Behaviour
38: 1086-1088.
Verrell, P. A. 1989a. The sex strategies of natural popu-
lations of newts and salamanders. Herpetologica
45: 265-282.
Veith, M., S. Steinfartz, and R. Zardoya. 1998. A molec-
ular phylogeny of “true” salamander (family sala-
mandridae) and the evolution of terrestriality of
reproductive modes. Journal of Zoological
Systematics and Evolutionary Research 36: 7-16.
Woody, D. R. and A. Mathis. 1997. Aviodance of area
labeled with chemical stimuli from damaged con-
specifics by adult newts {Notophthalmus viri-
descens ) in a natural habitat. Journal of
Herpetology 31:31 6-3 1 8.
Submitted: 17 November 2006
Accepted: 22 September 2007
2008
Asiatic Herpetological Research, Vol. 1 1
pp.39-44
Observations on the influence of Seasonality, Lunar Cycles,
and Weather Condition on Freshwater Turtle Activity in Sarawak,
East Malaysia (Borneo)
Karen A. Jensen1’* and Indraneil Das1
1 Institute of Biodiversity and Environmental Conservation
Universiti Malaysia Sarawak,
94300, Kota Samara han, Sarawak, Malaysia.
Corresponding author E-mail: kitti [email protected]
Abstract.- Freshwater turtles were surveyed at two sites in Sarawak: Loagan Bunut National Park and Balai Ringin.
Capture results were tested against environmental factors such as lunar phase, weather and seasonality to examine
differences in activity level. Proportionally, soft-shelled turtles were most active during the full moon (29.0%) and
the last quarter lunar phase (29.4%). Hard-shelled turtles were active during the full moon 50.0% of the time. Both
soft-shelled and hard-shelled turtles were more active during overcast periods (53.0% and 66.0%, respectively).
Seasonality did not seem to affect soft-shelled turtle activity, while hard-shelled turtles were active 50.0% of the time
during the dry South-west Monsoon from June to September.
Keywords.- Testudines, Malaysia, Borneo, capture success, environmental factors.
Introduction
Southeast Asia has a highly diverse freshwater turtle
fauna due to a combination of factors, including the
presence of major mountain massifs, some of the largest
archipelago systems in the world, large tracts of lowland
forests, streams and rivers, high precipitation and tropi-
cal climate (Iverson, 1992; Lovich, 1994). Due to their
cryptic nature and the presence of intense hunting in the
recent past, however, these enigmatic species have been
difficult to study. Consequently, there is a paucity of
published information regarding the current status and
basic ecology of the Southeast Asian fauna, including
those populations endemic to Borneo. As part of a larger
study on the ecology of Amyda cartilaginea (described
in Jensen, 2006), the activity of freshwater turtles in
Borneo in relation to environmental factors, such as
lunar phase, precipitation, and seasonality, were
assessed.
Materials and Methods
The primary study area was Loagan Bunut National
Park (03° 44-03° 00' N, 114° 09-114° 17' E) in north-
ern Sarawak, which is within a three hour drive to the
town of Miri. Field work was concentrated at the Park,
but two visits were also made to Balai Ringin (01° 03'
00" N, 110° 45' 00" E), a fishing village about two hours
driving distance from Kuching. Both sites are located
within peat swamp forests (Fig. 1).
Loagan Bunut National Park contains the only
freshwater floodplain lake in Sarawak (Sayer, 1991),
encompassing 650 ha2 at its maximum diameter. The
lake is completely dry during prolonged droughts.
Annually, the lake completely dries between three and
six times, typically in February, May, and June.
A variety of techniques were attempted to assess the
most effective method for capturing Amyda carti-
laginea. One method employed was the use of hoop
traps according to techniques described by Frazer et al.
(1990), Legler (1960), and Vogt (1980). Native hoop
traps called 'bubu' were ineffective in trapping turtles.
Another local fishing device called a 'selambau' caught
a single turtle in Balai Ringin.
Figure 1. Locations of Balai Ringin and Loagan Bunut
National Park in Sarawak, East Malaysia.
© 2008 by Asiatic Herpetological Research
40
Asiatic Herpetological Research, Vol. 1 1
2008
Table 1. Total number of individuals of freshwater turtle
species caught during the present study. The asterisk
refers to an unsexed carcass. Sites include: 1 = Loagan
Bunut National Park; 2 = Balai Ringin; 3 = Matang
Wildlife Centre; and 4 = Vicinity of Mulu National Park.
Manual capture, otherwise known as 'muddling'
(Cagle, 1943), was an effective, albeit labor-intensive,
method of collecting turtles in the surrounding forests
and streams, although it was only effective during low
water periods. The technique consists of wading through
streams and probing areas of sand or mud and among
roots with a stick, hands, or feet. Comparisons with
other studies were not possible as there are no compara-
tive studies of Amyda cartilaginea available.
Hard-shelled turtles were searched for in forested
areas by walking 100 m transects (2 m wide) through the
forest, looking under leaves, tree roots, and debris. The
turtles were most frequently located as they crossed
trails or other open areas.
At Loagan Bunut National Park, 51 field days were
spent during five sampling trips. Over the course of 33
evenings, two hoop nets and 60 baited hand lines were
set, totaling 2,046 trap nights. At Balai Ringin, 16 field
days were spent during two sampling trips; in total, 45
baited hand lines were set over 16 evenings, totaling 720
trap nights. There were 2,766 trap nights in total.
With the exception of the Balai Ringin trips, traps
were set for a minimum of seven days. The baits used,
chosen on the basis of availability, consisted of parts of
chicken, pork, or local fishes such as Ikan Kali ( Clarius
nieuhofii), Ikan Toman ( Channa micropeltes) or Ikan
Haruan ( Channa striatus). If habitat conditions changed
noticeably, the traps were re-located to a nearby site with
at least one meter of water depth.
Lunar phase was recorded at the time of capture to
test for possible differences in turtle activity level during
the different phases of the lunar cycle. Turtles that were
captured while physically active, as opposed to resting,
were used in the present study. “Active” animals were
qualified as those specimens caught with traps or lines
because they must have swam or walked to the area of
capture. Three Amyda cartilaginea were found by mud-
dling and one Cyclemys dentata was found buried near
the trunk of a tree. These animals were inactive at the
time of capture and were not included in subsequent
analyses. One A. cartilaginea was caught by baited line
on a trip near Gunung Mulu National Park, and was
included in subsequent analyses, as were any active
hard-shelled turtles found in localities other than the
study sites.
Lunar phase was divided into four categories; new
moon, first quarter, full moon, and last quarter. New
moon was defined as when the non-illuminated side is
facing the Earth; at this time, the moon is not visible,
except during a solar eclipse. First quarter moon was
defined as the phase when one half appears to be illumi-
nated by direct sunlight; during this phase, the illuminat-
ed fraction of the moon's disk increases. Full moon was
the phase when the moon was completely illuminated by
direct sunlight. Last quarter moon was defined as the
phase when one half of the moon appears to be illumi-
nated by direct sunlight; during this phase, the illuminat-
ed fraction of the moon's disk decreases. Moon phases
were obtained from the U.S. Navy Astronomical
Applications Department website (U.S. Navy, 2003). In
the analyses, hard-shelled and soft-shelled species were
pooled separately due to their presumed different behav-
ior, capture method, and habitat use.
To determine if weather affected capture success,
weather conditions at the time of collection was record-
ed, being divided into three categories: clear, overcast,
and raining. Overcast was defined as times when the sky
was completely cloudy and grey, and clear weather was
defined as entirely clear to having some white cumulus
clouds.
Seasonality was divided into the North-east
Monsoon (wet season), the South-west Monsoon (dry
season) and non-monsoonal times, which occurred dur-
ing April, May and October. The North-east Monsoon
prevails from November to March and the South-west
Monsoon occurs from June to September. The North-
east Monsoon brings the majority of precipitation to
Sarawak, while the South-west Monsoon season is typi-
cally characterized by dry weather.
2008
Asiatic Herpetological Research, Vol. 1 1
41
Last Quarter,
29.4
New, 1 1.8
1st Quarter,
29.4
Full, 29.4
Figure 2. Percentage of Amyda cartilaginea collected
while physically active during various lunar phases.
Last Quarter,
25
New, 16.7
1st Quarter,
8.3
Full, 50
Figure 3. Percentage of hard-shelled turtles collected
while physically active during various lunar phases.
Twenty-two days were spent searching for turtles
during the North-east Monsoon, 15 days were spent
searching during the South-west Monsoon and 30 days
were spent searching during non-monsoonal times.
Results
Species richness - A total of 34 individual turtles from
four species were found at the sites examined (Table 1).
Loagan Bunut National Park.- A total of five freshwa-
ter turtle species were recorded over a period of 5 1 field
days and 2,046 trap nights. In all, 14 Amyda cartilaginea
were captured: six males, six females and two juveniles.
Six Cyclemys dentata were collected: one female, four
juveniles and one unsexed carcass. Three juvenile Cuora
amboinensis were collected.
Of the 14 Amyda cartilaginea captured at Loagan
Bunut National Park, three individuals were found by
muddling, and 11 were caught during the 2,046 trap
nights. Of the 1 1 trapped animals, ten were caught on
handlines with Ikan Kali and one was caught on a hand-
line baited with Ikan Haruan. No more than a single tur-
tle was collected per night, representing a 0.54% trap
success, with only 1 1 out of 2,046 trap nights being suc-
cessful.
Balai Ringin.- Three freshwater turtle species were col-
lected over a period of 1 6 days and 720 trap nights: one
female Cyclemys dentata , one female Heosemys spinosa
and five Amyda cartilaginea (four females and one juve-
nile).
Of the turtles captured at Balai Ringin, three were
caught using handlines baited with Ikan Kali, one was
found in a selambau and one was caught in a bubu. The
trapping success rate was 0.69%.
Additional species.- An adult Amyda cartilaginea was
caught in the vicinity of Mulu National Park (4° 1' 15
N, 114° 54' 2" E). Three Heosemys spinosa (one male,
one female, and one juvenile) were also found by vari-
ous Universiti Malaysia Sarawak personnel while per-
forming wildlife surveys at Matang Wildlife Centre (01°
36’ 398" N, 110° If 33" E).
Effects of lunar phase on capture success.- During the
new moon phase, traps and lines were set for 8 days; two
adult Amyda cartilaginea (one male, one female) were
captured. During the first quarter moon phase, traps and
lines were set for 18 days; five adult A cartilaginea (one
male, four females) were captured.
During the full moon phase, traps and lines were set
for 14 days; five A. cartilaginea were captured (four
females, one juvenile). During the last quarter phase,
traps and lines were set for nine days; five A. carti-
laginea were captured (two males, one female, two juve-
niles). These data are shown in Figure 2. The active
hard-shelled turtle species captured were Heosemys
spinosa (four individuals), Cuora amboinensis (three
individuals) and Cyclemys dentata (five individuals, one
of which was inactive). During the new moon lunar
phase, one juvenile Cuora amboinensis and one juvenile
Cyclemys dentata were collected over a period of three
days. During the first quarter lunar phase, 10 days were
spent searching for turtles with only one female
Heosemys spinosa (8.3% of the total) captured. During
the full moon lunar phase, collections over 1 1 days pro-
duced one female and one juvenile Heosemys spinosa ,
one juvenile Cuora amboinensis , and one female and
two juvenile Cyclemys dentata. During the last quarter
lunar phase, collections over five days yielded one male
Heosemys spinosa , one juvenile Cuora amboinensis and
one juvenile Cyclemys dentata (Fig. 3).
Results for both soft-shelled and hard-shelled tur-
tles indicate that lunar phase may not have an influence
on their activity patterns. A larger sample size with at
least one radio-tagged species would provide more sig-
nificant results.
Effects of weather on capture success.- During clear
weather, three Amyda cartilaginea (one male, two juve-
42
Asiatic Herpetological Research, Vol. 1 1
2008
Clear, 0
Rain, 34
Overcast, 53
Figure 4. Percentages of Amyda cartilaginea collected Figure 5. Percentages of hard-shelled turtles collected
during different weather conditions. during different weather conditions.
Non-Monsoon,
35
Northeast
Monsoon, 30
Southwest
Monsoon, 35
Non-Monsoon,
31
Southwest
Northeast
Monsoon, 46
Monsoon, 23
Figure 6. Percentages of all Amyda cartilaginea collected
based on seasonality.
niles) were collected, nine individuals were captured
during overcast weather (three males, six females), and
six individuals were captured when it was raining (four
females and one juvenile) (Fig. 4).
For hard-shelled turtles, 12 individuals were found
on the forest floor or on forest trails when it was clear,
while only four were found when it was raining (one
female, one male and one juvenile Heosemys spinosa
and one female Cyclemys dentata). When it was over-
cast, eight turtles were found (one female Heosemys
spinosa, three juvenile Cuora amboinensis, and four
juvenile Cyclemys dentata ) (Fig. 5).
Effects of seasonality on capture success.- Amyda car-
tilaginea capture success was examined between sea-
sons. As might be expected, the water levels of both the
lake and its tributaries at Loagan Bunut National Park
and the riparian habitats in Balai Ringin were lower in
the dry season. Consequently, three of the 20 individuals
captured were found buried in the mud. During the wet
season, six female Amyda cartilaginea were captured,
while in the dry season, only seven soft-shelled turtles
(three males, two females, and two juveniles) were cap-
tured. During the non-monsoon seasons, seven soft-
shelled turtles (four males, two females, one juvenile)
were captured, representing 41% of the total (Fig. 6).
Thirteen hard-shelled turtles were collected. One
female Cyclemys dentata was found buried under the
hollowed trunk of a tree, and although inactive at the
Figure 7. Percentages of all hard-shelled turtles collected
based on seasonality.
time of capture, was included in this component of the
analysis since we were looking at the overall effects of
capture and seasonality. Six of these turtles were collect-
ed during the wet season (one female Heosemys spinosa ,
two juvenile Cuora amboinensis, and three juvenile
Cyclemys dentata). Three of the turtles were found dur-
ing the dry season (one juvenile Heosemys spinosa, one
juvenile Cuora amboinensis, and one juvenile Cyclemys
dentata). Four turtles were captured during non-mon-
soon times (one male and one female Heosemys spinosa,
and two female Cyclemys dentata) (Fig. 7).
All four turtles found buried in mud or hidden in a
tree hollow were collected in the dry season. During the
North-east Monsoon, these localities would have been
covered by at least two meters of water.
Discussion
Capture rates for both Amyda cartilaginea and hard-
shelled turtles were low, (0.54% and 0.69%, respective-
ly), indicating that the populations of these species may
be at critically low levels, although this is difficult to
substantiate considering the paucity of historical data for
southeast Asia.
Turtle capture rates were tested against three envi-
ronmental factors: lunar phase, weather, and season. In
the lunar phase analysis, it appeared that a new moon
may have some influence on the movements of Amyda
cartilaginea. At a capture rate of 11.8% (compared to
2008
Asiatic Herpetological Research, Vol. 1 1
43
29.4% for all other phases), the darkness of the sky may
have an effect on the foraging capabilities of this
species. Other predatory species have also been noted as
having increased foraging activity with increased moon-
light (Brigham and Barclay, 1992). A capture rate of
50.0% during the full moon phase indicated that hard-
shelled turtles may need lunar illumination for foraging
activity.
The effects of lunar phase on changes in animal
behavior are well known. Tigar and Osborne (1999)
hypothesized that fewer predaceous arthropods were
active during full moons than new moons, possibly
because of the increased risk of vertebrate predation.
Alvarez-Castaneda et al. (2004) concluded that fewer
rodent remains were present in bam owl ( Tyto alba) pel-
lets during full moons, indicating that rodent activity
may be decreased during this phase, which is supported
by other studies that have found rodent activity to be
linked to lunar phase. O'Farrell (1974) found that the
most important factors affecting rodent activity was the
amount of time between sunset and sunrise, as well as
lunar phase. Price et al. (1984) reported that bright
moonlight reduces the overall activity of nocturnal
rodents. Church (1960a), concluded that ovulation of the
common Asian toad ( Duttaphrynus melanostictus) was
correlated with the lunar cycle in Java. Church (1960b)
also found this to be the case with the crab-eating or
mangrove frog ( Fejervarya cancrivora ) in Java.
In the present study, 53.0% Amyda cartilaginea
collections occurred during overcast weather, 29.0%
ocurred during rain events, and 18% occurred when the
skies were clear. A total of 66.0% of hard-shelled turtles
captured during overcast conditions, 34.0% were cap-
tured during rainy conditions and none were captured
during clear weather, indicating that turtles may favor
overcast weather for moving and foraging. Seasons did
not have a dramatic affect on the capture rate of turtles,
however, more information is necessary to make this
determination with any confidence. Clearly, a large
amount of effort is required to examine the behavior of
turtles, as well as other animals, especially when con-
ducted across multiple seasons, lunar phases, weather
conditions, or even years. This paper thus presents pre-
liminary information on the influences of environmental
factors on turtle behavior in Borneo.
Acknowledgments
This project was made possible through financial sup-
port from Chelonian Research Foundation's (CRF)
Linnaeus Fund, British Chelonian Group (BCG)
Conservation Grant, Idea Wild, Universiti Malaysia
Sarawak ('The herpetofauna of Loagan Bunut' ; funda-
mental grant number: 1/94/441/2004 [179] and 'Studies
on the natural history and systematics of the herpetofau-
na of peat swamp forest of Sarawak, East Malaysia';
fundamental grant number: l/26/303/2002[40], the
UNDP-GEF ('Conservation and Sustainable Use of
Tropical Swamp Forests and Associated Wetland
Ecosystems', UNDP-GEF Funded Project
MAL/99/G31). Thanks are due to the Sarawak
Biodiversity Centre for providing a research permit
(Research Agreement Number: SBC-RA-0073-KAJ
and Research Permit Number: SBC-RP-0085-KAJ). We
also thank the Sarawak Forestry Department for provid-
ing permission to survey freshwater turtles in Sarawak
(Permit number: 03697). Special thanks are due to the
Sarawak Forestry Corporation and the staff at Loagan
Bunut National Park for permission and use of equip-
ment.
Literature Cited
Alvarez-Castaneda, S. T. S., N. Cardenas and L.
Mendez. 2004. Analysis of mammal remains from
owl pellets (Tyto alba), in a suburban area in Baja
California. Journal of Arid Environments 59(1):
59-69.
Brigham, R. M. and R. M. R. Barclay, 1992. Lunar
influence on foraging and nesting activity of com-
mon poorwills ( Phalaenoptilus nuttallii). The Auk
109(2): 315-320.
Cagle, F. R. 1943. Turtle populations in southern
Illinois. Copeia 1942(3): 155-162.
Church, G. 1960a. Annual and lunar periodicity in the
sexual cycle of the Javanese toad, Bufo melanostic-
tus Schneider. Zoologica 45(13): 181-189.
Church, G. 1960b. The effects of seasonal and lunar
changes on the breeding pattern of the edible
Javanese frog, Rana cancrivora Gravenhorst.
Treubia 25(2): 215-233.
Frazer, N. B., J. W. Gibbons, and T. J. Owens. 1990.
Turtle trapping: preliminary tests of conventional
wisdom. Copeia 1990(4): 1150-1152.
Iverson, J. B. 1992. Global correlates of species richness
in turtles. Herpetological Journal 2: 77-81.
Jensen, K. A. 2006. Ecology and use of the Asian soft-
shell turtle (Amyda cartilaginea), with notes on
other species. Unpublished MSc Thesis, University
Malaysia Sarawak, Kota Samarahan. xxii+140pp.
44
Asiatic Herpetological Research, Vol. 1 1
2008
Legler, J. M. 1960. A simple and inexpensive device for
trapping aquatic turtles. Utah Academy
Proceedings 37: 63-66.
Lovich J. E. 1994. Biodiversity and zoogeography of
non-marine turtles in Southeast Asia. Pp. 380-
391. In: S.K. Majumdar, F.J. Brenner, J.E. Lovich,
J.F. Schalles and E.W. Miller (eds.) Biological
Diversity Problems and Challenges. Pennsylvania
Academy of Science, Easton, Pennsylvania.
O'Farrell, M. J. 1974. Seasonal activity patterns of
rodents in a sagebrush community. Journal of
Mammalogy 55(4): 809-823.
Price, M. V., N. M. Waser. and T.A. Bass. 1984. Effects
of moonlight on microhabitat use by desert
rodents. Journal of Mammalogy 65(2): 353-356.
Sayer, J. 1991. Rainforest buffer zones. Guidelines for
protected area managers. IUCN Forest
Conservation Programme, Cambridge, UK. 94 pp.
Tigar, B. J. and P. E. Osborne. 1999. The influence of the
lunar cycle on ground-dwelling invertebrates in an
Arabian desert. Journal of Arid Environments
43(2): 171-182.
U.S. Navy. 2003.
http://aa.usno.navy.mil/faq/docs/moon_phases.ht
ml.
Vogt, R.C. 1980. New methods for trapping aquatic tur-
tles. Copeia 1980(2): 368-371.
Submitted: 05 January 2007
Accepted: 22 September 2007
2008
Asiatic Herpetological Research, Vol. 1 1
pp. 45-49
Effect of Stocking Density on the Energy Budget of Juvenile
Soft-Shelled Turtles (Pelodiscus sinensis)
Runzhen Jing1 and Cuijuan NlU1’*
1 Ministry of Education Key Laboratory of Biodiversity Science and Ecological Engineering,
College of Life Sciences, Beijing Normal University, Beijing, 100875, People’s Republic of China.
* Corresponding author E-mail: [email protected]
Abstract.- The present work investigates the effect of stocking density on the energy budget of juvenile soft-shelled
turtles ( Pelodiscus sinensis ). Turtles (body weight: 16.22±0.28 g) were stocked at densities of SD1 (8 animals/m-,
0.14 kg/m2), SD2 (48 animals/m2, 0.81 kg/m2) and SD3 (96 animals/m2, 1.62 kg/m2) in aquaria in triplicate for each
treatment. The experiment lasted for 35 days. Survival rate, coefficient of size variation, productivity, and apparent
digestibility coefficient were not significantly different at the three stocking densities. While there were no significant
differences between treatments SD2 and SD3, turtles in group SD1 showed a lower excretion rate and significantly
higher food intake and growth rate. Turtles in group SD1 also showed higher crude lipid content and lower crude ash
content. No significant differences were found among the treatments in body moisture and crude protein.
Keywords.- Survival, growth, food consumption, stress, body composition.
Introduction
Stocking density is one of the most important biotic fac-
tors in aquaculture because it directly influences sur-
vival, growth, behavior, health, feeding, and production.
High densities may interfere with intra-population inter-
actions and eventually affect biomass gain. The relation-
ship between stocking density and growth for fish has
been shown to be positive (Papst et al., 1992), negative
(Hengsawat et al., 1997; Irwin et al., 1999) or density-
independent (Fairchild and Howell, 2001; Rowland et
al., 2004; Rowland et al., 2006), depending on different
experimental density ranges. In the fish farming indus-
try, it is very important for the farmer to know the opti-
mum stocking density of the animals being reared to
maximize production and profitability.
The soft-shelled turtle ( Pelodiscus sinensis ) is a
commonly cultured aquatic reptile species in China with
a yield of more than 140,000 tons in 2004 (Shen et al.,
2006; Zhang, 2005). Despite the fact that the aquacul-
ture of this species is widespread, scientific studies con-
cerning the effects of stocking density on biological
characters are limited (Mayeaux et al., 1996). The objec-
tive of the present study is to evaluate the effect of stock-
ing density on the energy budget of juvenile P. sinensis.
Materials and Methods
Turtles and rearing conditions.- Juvenile Pelodiscus
sinensis (body weight: 16.22±0.28 g) were obtained
from a commercial turtle farm in Beijing. Turtles were
reared in rectangular aquaria (80 length [L] x 35 width
[W] x 30 cm height [H]), with 1 1 individuals per aquar-
ium, at a water depth of 15 cm. Water temperature was
maintained at 29.5±0.5°C by a thermo-controlled heater.
Aquaria were supplied with dechlorinated water. The
dissolved oxygen level was over 5 mg/L and the pH was
7.95. Natural photoperiod was followed. Turtles were
fed to satiation once daily at 1500 h. Commercial turtle
food was used with 0.5% Cr203 added for the apparent
digestibility coefficient assay. Proximate dry matter
composition of the diet was as follows: moisture 3.97%;
crude protein 40.27%; crude lipid 7.04%; and crude ash
15.73%. Energy content was 16.06 kJ/g. Turtles were
allowed to acclimate to the laboratory conditions for
three weeks before the experiments began.
Experimental process.- Healthy turtles were randomly
stocked at initial densities of SD1 (8 animals/m2, 0.14
kg/m2), SD2 (48 animals/m2, 0.81 kg/m2) and SD3 (96
animals/m2, 1 .62 kg/m2) in aquaria (40 L x30 W x30 cm
H) in triplicate for each treatment. There were no signif-
icant differences in initial average body weight or coef-
ficient of size variation within each aquarium among the
treatments. The experiment lasted for 35 days. The final
densities were 0.34 kg/m2, 1.20 kg/m2 and 2.26 kg/m2,
respectively. To maintain a constant numbers of animals,
an alternative turtle with approximately the same body
weight was added when an initial turtle died. All the
water in the tanks was replaced by an equal amount of
fresh water daily after surplus food was removed. The
aquaria were inspected once daily for mortalities and
dead turtles were removed immediately after detection.
© 2008 by Asiatic Herpetological Research
46
Asiatic Herpetological Research, Vol. 1 1
2008
Table 1. Survival, specific growth rate, food consumption, apparent digestibility coefficient, and excretion of juvenile
soft-shelled turtles ( Pelodiscus sinensis ) held at different stocking densities (Mean ± S. E.)1.
'Values in each row with different superscript letters are significantly different (p < 0.05).
2Means are significantly different among treatments (p < 0.01).
3Means are extremely different among treatments (p < 0.001).
Turtles were weighed to an accuracy of 0.1 g before and
after the experiment following three days starvation. Six
turtles at the beginning of the experiment and all turtles
remaining at the end of the experiment were sacrificed
and dried at 65°C to constant weight for analysis of body
biochemical composition. Crude protein was determined
by the Kjeldahl method, crude lipid was extracted by
ether, and crude ash was determined after 12 h of burn-
ing at 550° in a muffle furnace. Energy contents were
measured using a calorimeter (CA-4P, Shimadzu,
Japan). All samples were analyzed in triplicate.
Measurements of various components of the energy
budget.- A weighed excess of feed pellets was fed to the
turtles once daily (at 1500 h) with a fraction of feed
retained for determination of dry matter content.
Uneaten food was collected an hour later and dried.
Food intake was determined as the difference between
the food supplied and the food left uneaten.
Fresh complete feces were collected once daily.
Cr->03 content in the diet and feces were determined by
the method described in detail by Bolin et al. (1952).
The apparent digestibility coefficient (ADC) and the
energy lost via feces (F) were calculated by the follow-
ing expressions:
ADC (%) = 100 x (1- Cr203 content in diet/Cr203
content in feces)
productivity were calculated by the following formulae:
CV (%) = 1 00 x Standard deviation/ Average body
weight
SGR (%/day) = 100x(lnW2-lnW1)/(t2- ft)
Productivity (g/daydn2) = (Wt2-Wtl)/S/( t2- ft)
where W2 and Wft express final average weight at time
t2 and initial average weight at time ft in days, respec-
tively. Wt2, Wtl and S express biomass at day t2, biomass
at day ft, and aquarium surface area, respectively.
Energy allocated to growth was calculated from weight
gain (g) and energy content (kJ/g) of the whole body.
Energy lost via excretion was calculated from the
ammonia and urea excreted using energy equivalents for
ammonia (24.83 J/mg N) and urea (23.03 J/mg N)
(Elliott, 1976). Ammonia and urea concentrations inside
the water were measured by firstly catalyzing urea to
ammonia using urease, and then assaying the total
ammonia via standard Nessler’s colorimetric technique.
The turtles were kept in a given amount of renewed
experimental water for 48 h and fasted during the meas-
urement. Water samples were taken before and after this
period.
The energy budget for juvenile animals can be
described as:
F = I x (100- ADC) x Ef/1 00
where I and Ef are food consumption in dry weight and
feces energy content, respectively.
The coefficient of variation in body weight (CV)
within each aquarium, specific growth rate (SGR), and
C=F+U+R+G
where C is the energy in the food consumed, F is the
energy lost in fecal production, U is the energy lost in
nitrogenous excretory products, R is the energy spent in
metabolism, and G is growth energy. In this study, C, F,
2008
Asiatic Herpetological Research, Vol. 1 1
47
Table 2. Chemical composition of juvenile soft-shelled turtles ( Pelodiscus sinensis) held at different stocking densities
in 35-day experimental period (Mean ± S. E.)1.
‘Crude protein, crude lipid, and crude ash based on the contents in the dry matter.
'Values in each column with different superscript letters are significantly different p < 0.05).
2Means were extremely different among treatments (p < 0.001).
U, and G were determined directly, and R was calculated
by the equation:
R = C- F- U-G.
Statistical analysis.- All data were analyzed with SPSS
for Windows, Version 1 1 .0. A one-way ANOVA was used
to test the differences among treatment means when
assumptions of normality and homogeneity were met.
When a significant treatment effect was found, the
Least-Significant-Difference (LSD) test was applied to
determine which specific pairs differed. The nonpara-
metric Kruskal-Wallis test was applied when the
required homogeneity of variance and normality were
not satisfied. A regression analysis was carried out to
estimate the relationship between stocking density and
growth rate. The significant level was set at p < 0.05.
Results
All turtles in one aquarium of treatment SD2 died due to
a malfunction of the thermo-controlled heater. This
replicate was not taken into account for any statistical
comparisons.
The effects of stocking density on survival, specific
growth rate, food consumption, apparent digestibility
coefficient, and excretion.- Survival rates were not sig-
nificantly different among the three treatments (Table 1 ),
but all showed a negative relationship with increased
stocking density (r = -0.708,/? = 0.050). Stocking densi-
ty showed a clear influence on final body weight, specif-
ic growth rate, food consumption, and excretion, as
identified by the statistical significance (Table 1).
Turtles in group SD1 showed significantly higher food
intake and growth rate than those held at the other two
densities, which did not differ significantly from each
other. Lower excretion rate was observed in group SD1
compared to groups SD2 and SD3. The apparent
digestibility coefficients of juvenile turtles ranged from
74.29% to 78.14%. The relationship of SGR and stock-
ing density (SD, animals/m2) can be described as the lin-
ear model or the quadratic model:
SGR = -0.0171 x SD + 2.4360
o < 0.01, R2= 0.769)
SGR - 0.0003 x SD2 - 0.053 1 x SD + 2.8805
o < 0.01, R2 = 0.915).
The effect of stocking density on body composition. -
Body composition for each treatment group is shown in
Table 2. There were significant differences in lipid and
ash contents between treatments (F25 = 11.520,
p = 0.013; F2 5 = 64.577, p = 0.000). Crude lipid con-
tents of group SD1 were much higher than those of
groups SD2 and SD3 while crude ash contents were
lower. No significant differences were found among
treatments in body moisture and crude protein
(F2 5 = 0.155, /?= 0.860; F2 5 = 3.412,/? = 0.116).
The effect of stocking density on energy ; budget.- No
marked differences were found among treatments in F/C
and R JC (Table 3; F2 5 = 0.058,/? = 0.945; F25 = 2.561,
p = 0.171). Stocking density significantly influenced
U/C and G/C (F2 5 = 27.151, p = 0.002; F2 5 = 6.243,
p = 0.044). Energy budgets for the different treatments
can be described as:
100C = 10. OF + 0.3U + 73.3R + 16.5G; SD1
100C = 10.3F + 0.7U + 78.3R + 10.8G; SD2
100C = 10. OF + 0.8U + 79. 1R + 10.2G; SD3
Discussion
Stocking density has been considered to be chronically
stressful to reared animals (Vijayan and Leatherland,
1988). Several studies have also demonstrated that
increased stocking density has a negative effect on sur-
vival and growth (Penha-Lopes et al., 2006; Schram et
al., 2006), except in some fish species that exhibit
schooling behavior (Jorgensen et al., 1993;
Papoutsoglou et al., 1998). This impaired growth by
stocking density may be attributed to reduced food con-
48
Asiatic Herpetological Research, Vol. 11
2008
Table 3. Energy budget of juvenile soft-shelled turtles ( Pelodiscus sinensis) held at different stocking densities in 35
day experimental period (Mean ± S. E.)1.
C: food intake in energy; F: energy lost in fecal production; U: energy lost in nitrogenous excretion; R: energy lost in metabolism; G: energy allocated to
growth.
'Values in each column with different superscript letters are significantly different (p < 0.05).
2Means are significantly different among treatments (p < 0.01).
3Means are extremely different among treatments (p < 0.001).
sumption, lowed food conversion rate or increased
metabolic cost (Jorgensen et al., 1993; Li and Brocksen,
1977; Vijayan and Leatherland, 1988).
In the present study, an obvious trend of decreased
survivorship of juvenile soft-shelled turtle with elevated
stocking density was observed. This agrees with the
results of Mayeaux et al. (1996), who reported that com-
mon snapping turtles ( Chelydra serpentine ) stocked at
58 animals/m2 exhibited greater mortality, lower weight
gain, and higher food consumption compared to those
stocked at 29 animals/m2. Food consumption also
reduced with increasing stocking density in the present
study, however, conflicting with the above snapping tur-
tle results. This discrepancy may be caused by differ-
ences in life habit or varying experimental conditions.
Knights (1985) observed that more aggressive (and usu-
ally larger) eels of Anguilla anguilla ate more, while the
feeding of smaller subordinates was inhibited, even
when food was offered to excess. In the present experi-
ment, despite food being divided between at several
spots in each tank, a similar phenomenon was observed
during the feeding process. It is likely that the appetite
of the subordinate turtles was suppressed and their
growth inhibited when the turtles were grouped at high
density.
The lower feed intake in treatments SD2 and SD3
appear to explain the lower growth in the same treat-
ments, because reduced food ingestion reduces the
amount of energy available for growth (Table 1).
Moreover, the proportions of food energy spent in
growth (indicated by the gross energy efficiency, Table
3) in treatments SD2 and SD3 were obviously lower in
relation to that in treatment SD1 (10.8% and 10.2%,
compared to 16.5%). These results may suggest that the
ingested energy was not efficiently converted to body
reserves, especially at high stocking density.
Juvenile soft-shelled turtles tend to grab each other
with their sharp claws, and grabbing activities often
result in injuries of the toes and neck, and may even
result in death. Agonistic interactions among individuals
and elevated swimming activity also lead to increased
metabolic expenditure. In the present experiment, turtles
of groups SD2 and SD3 exhibited hyperactivity com-
pared to group SD1, and had reduced lipid and higher
ash contents. The difference in chemical composition in
these turtles suggest that elevated stocking density may
induce extra energy expenditure, subsequently allocat-
ing less energy to storage.
In conclusion, the pattern of energy allocation of the
turtles in the present experiment was significantly influ-
enced by different stocking densities. Turtles cultured at
lower density had a relatively higher survival rate, dis-
tinctly higher growth rate and transfer more consumed
energy to growth. The lower energy input and lower
gross energy efficiency in treatments SD2 and SD3 may
have contributed to their reduced growth rate.
Furthermore, the excretion of nitrogenous wastes to the
environment was relatively lower with reduced stocking
density. Conversely, higher stocking density could result
in higher productivity to some degree, since there were
no significant differences in productivity among the
treatments. We suggest that the turtle farmer pursue an
optimal stocking density based on profitability, consid-
ering that lower stock densities are shown to be related
to increased survivorship, growth rate and feed utiliza-
tion, while also being associated with a reduction in
nitrogenous wastes.
Acknowledgments
We are thankful to Ms. C. Huang and our other col-
leagues at the animal physiological ecology lab, college
of life science, Beijing normal university, for their valu-
able advice and assistance to the experiment. This work
was funded by the National Natural Science Foundation
of China (No. 30271014, No. 30671598).
Literature Cited
Bolin, D. W., R. R King and E. W. Klosterman. 1952. A
simplified method for the determination of chromic
oxide (Cr203) when used as an index substance.
Science 116: 634-635.
2008
Asiatic Herpetological Research, Vol. 1 1
49
Elliott, J. M. 1976. Energy losses in the waste products
of brown trout (Salmo trutta L.). Journal of Animal
Ecology 45(2): 561-580.
Fairchild, E. A. and W. H. Howell. 2001. Optimal stock-
ing density for juvenile winter flounder
Pseudopleuronectes americanus. Journal of the
World Aquaculture Society 32(3): 300-308.
Hengsawat, K., F. J. Ward and P. Jamratjamom. 1997.
The effect of stocking density on yield, growth and
mortality of African catfish ( Clarias gariepinus
Burchell 1822) cultured in cages. Aquaculture
152(1—4): 67-76.
Irwin, S., J. O'Halloran and R. D. FitzGerald. 1999.
Stocking density, growth and growth variation in
juvenile turbot, Scophthalmus maximus
(Rafinesque). Aquaculture 178(1-2): 77-88.
Jorgensen, E. H., J. S. Christiansen and M. Jobling.
1993. Effects of stocking density on food intake,
growth performance and oxygen consumption in
Arctic charr ( Salvelinus alpinus). Aquaculture
110(2): 191-204.
Knights, B. 1985. Energetics and fish farming. Pp. 309-
340. In: P. Tytler and P. Calow (eds.), Fish
Energetics: New Perspectives. Croom Helm,
London. Total # pages??
Li, H. W. and R. W. Brocksen. 1977. Approaches to the
analysis of energetic costs of intraspecific competi-
tion for space by rainbow trout ( Salmo gairdneri).
Journal of Fish Biology 11(4): 329-341.
Mayeaux, M. H., D. D. Culley Jr. and R. C. Reigh. 1996.
Effects of dietary energy : Protein ratio and stock-
ing density on growth and survival of the common
snapping turtle Chelydra serpentina. Journal of the
World Aquaculture Society 27(1): 64-73.
Papoutsoglou, S. E., G. Tziha, X. Vrettos and A.
Athanasiou. 1998. Effects of stocking density on
behavior and growth rate of European sea bass
(. Dicentrarchus labrax) juveniles reared in a closed
circulated system. Aquacultural Engineering 1 8(2):
135-144.
Papst, M. H., T. A. Dick, A. N. Amason and C. E. Engel.
1992. Effect of rearing density on the early growth
and variation in growth of juvenile Arctic charr,
Salvelinus alpinus (L.). Aquaculture and Fisheries
Management 23: 4 1 — 47.
Penha-Lopes, G., A. L. Rhyne, J. Lin and L. Narciso.
2006. Effects of temperature, stocking density and
diet on the growth and survival of juvenile
Mithraculus forceps (A. Milne Edwards, 1875)
(Decapoda: Brachyura: Majidae). Aquaculture
Research 37(4): 398-408.
Rowland, S. J., G. L. Allan, M. Hollis and T. Pontifex.
2004. Production of silver perch ( Bidyanus
bidyanus ) fingerlings at three stocking densities in
cages and tanks. Aquaculture 229(1-4): 193-202.
Rowland, S. J., C. Mifsud, M. Nixon and P. boyd. 2006.
Effects of stocking density on the performance of
the Australian freshwater silver perch ( Bidyanus
bidyanus) in cages. Aquaculture 253(1-4):
301-308.
Schram, E., J. W. Van der Heul, A. Kamstra and M. C. J.
Verdegem. 2006. Stocking density-dependent
growth of Dover Sole ( Solea solea). Aquaculture
252(2^4): 339-347.
Shen, X., Q. Zhang and W. Zhu. 2006. [Status quo and
developmental strategy of turtle industry in China].
Gansu Agriculture (1): 48. (In Chinese)
Vijayan, M. M. and J. F. Leatherland. 1988. Effect of
stocking density on the growth and stress-response
in brook charr, Salvelinus fontinalis. Aquaculture
75(1-2): 159-170.
Zhang, J. 2005. [Economic Analysis and Forecast of
Tortoise and Turtle Industry in 2005]. Chinese
Fisheries Economics (3): 49-50. (In Chinese)
Submitted: 26 October 2006
Accepted: 29 May 2007
pp. 50-56
Asiatic Herpetological Research, Vol. 1 1
2008
Genetic Variation and Trans-species Polymorphism of
MHC Class II B Genes in Reptiles
En Li1, Xiao Bing Wu1’* and Peng Yan1
1 Anhui Provincial Key Laboratory of the Conservation and Exploitation of Biological
Resources, College of Life Science, Anhui Normal University, 241000 Wuhu, China.
* Corresponding author E-mail: [email protected].
Abstract.- Trans-species polymorphism has been extensively documented for the major histocompatibility complex
(MHC) in mammals, fishes and birds, but not for non-avian reptiles. Our study has addressed this by focusing on three
species of the reptiles: Chinemys reevesii, Plestiodon chinensis and Alligator sinensis. Using polymerase chain reac-
tion (PCR) and nucleotide sequence analyses, we examined a total of twenty-five sequences of exon 2 of the MHC
class II B genes in these species. High allelic variability was observed among sequences within each of these species,
indicating extensive MHC polymorphism. Nonsynonymous substitution rates (< dN ) exceeded synonymous substitution
rates ( ds ) greatly within the antigen-binding sites (ABS), suggesting the effect of balancing selection. Phylogenetic
analysis of these reptile sequences clearly supports the hypothesis of trans-species polymorphism. We therefore con-
fidently conclude that trans-species polymorphism in the MHC is now known for reptiles, as well as mammals, fishes
and birds. This suggests that the main function of the MHC (presentation of peptides to T lymphocytes) has remained
largely unchanged despite of long periods of evolution.
Keywords.- Major Histocompatibility Complex (MHC), reptiles, trans-species polymorphism.
Introduction
The genes of the major histocompatibility complex
(MHC) code for polymorphic membrane glycoproteins
that play a key role in the T-cell mediated immune
response (Klein, 1986). There are two distinct classes of
MHC molecules, class I and class II, which are encoded
by separate but tightly linked loci. The diverse, but
always specific, antigen-binding properties of the MHC
class I and II molecules determine which foreign pep-
tides can be identified to trigger an immune response.
Such MHC-dependent recognition of certain antigens
has been considered as an important contributing factor
in susceptibility to disease (Klein, 1986). In many verte-
brate species, the MHC class I and class II loci exhibit
an extraordinarily high degree of polymorphism, partic-
ularly in exon 2 of the beta genes. This variation is prob-
ably maintained through some kind of balancing selec-
tion related to interactions between the immune system
and pathogens (Parham and Ohta, 1996), although it has
not been resolved as to whether the selection is over-
dominant (heterozygote advantage hypothesis), frequen-
cy dependent (rare-allele advantage hypothesis) or a
combination of these factors (Hughes and Hughes,
1995; Hughes and Yeager, 1998; Hill et al., 1992;
Hughes, 2000; Thurz et ah, 1997).
A characteristic feature of the MHC genes is trans-
species polymorphism, i.e. the existence of allelic line-
ages shared by related species, supporting the theory that
the divergence of MHC allelic lineages predate specia-
tion (Graser et ah, 1996; Klein, 1987; Ottova’ et ah,
2005). For MHC genes, this kind of polymorphism has
been well-documented in mammals, but for other verte-
brate classes, the data on trans-species polymorphism
are either fragmentary or unavailable. Only in fish
(Klein et ah, 1998; Ottova et ah, 2005) and birds (Hess
and Edwards, 2002; Richardson and Westerdahl, 2003)
is there clear evidence for the interspecific sharing of
MHC alleles, but these species are of recent origin and
do not provide information about long-term persistence
of allelic lineages. In an attempt to obtain such informa-
tion, we decided to compare the polymorphism in three
reptiles (. Alligator sinensis, Chinemys reevesii and
Plestiodon chinensis) with that in two other closely-
related reptiles {Alligator mississippiensis and Caiman
crocodilus ).
In this study, we investigate genetic variation at
exon 2 of the MHC class II B genes, including part of
the putative antigen-binding sites, in three reptiles. We
choose this particular exon because it is known to be
highly polymorphic in primates and a variety of other
terrestrial species. Our purposes in this study are: first,
to analyze the variability of MHC class II B genes
among the species listed above; second, to test for the
influence of selection on amino-acid polymorphism, i.e.
a positive (balancing) selection in exon 2; and finally, to
document whether the trans-species polymorphism in
MHC class II B genes also exits in reptiles.
© 2008 by Asiatic Herpetological Research
2008
Asiatic Herpetological Research, Vol. 1 1
51
Table 1 . The genetic parameters of the sequences within
each analysed species.
Note: N: number of sequences; L: sequence length (pb); S: variable sites;
x: nucleotide diversity; p: amino acid diversity.
Materials and Methods
Isolation of genomic DNA.- Total genomic DNA was
isolated from 20-50 pL of blood using standard phenol-
chloroform extraction methods (Sambrook and Russell,
2001). The sampled individuals (without existing
sequence data on GenBank) included a total of four
Chinemys reevesii (terrapin) and two Plestiodon chinen-
sis (saurian) from natural populations.
Polymerase chain reaction (PCR).- A 166 bp fragment
of exon 2, from the class II B genes coding for part of
the peptide-binding region, was amplified by PCR using
the following degenerate primers reported by Shi et al.
(2004): the forward (sense) primer MHC-UP 5’-
AAGG(T/G/C)C(C/G)AGTG(T/C)TACT(T/A)(C/T)A(
T/G/C)(T/G/C)AACGG-3’; the reverse (anti-sense)
primer MHC-DP 5’-
TAGTTGTG(C/G)C(G/T)GCAG(A/T)A(C/G)GTGTC-
3’. PCR reaction were performed in 30 pL of reaction
mixture containing 10 mM Tris-HCl (pH 8.3), 1.5 mM
MgCl2, 150 pM dNTP, 1 pM of each primer, 20-100 ng
of isolated genomic DNA and 1 unit of Taq DNA
Polymerase (Promega). Thermocycler conditions were
as follows: an initial denaturation for 5 min at 94°C, fol-
lowed by 35 cycles, each consisting of 30 s at 94°C, 40
s at 52°C, and 40 s at 72°C. The final extension at 72°C
was for 10 min. PCR products were separated in a 2%
agarose gel containing ethidium bromide (0.5 pg mL1).
Separated PCR products were visualized under UV light
and photographed to examine the banding patterns.
Cloning and sequencing.- Following agarose gel elec-
trophoresis, PCR products of appropriate size were
recovered, purified and concentrated using the DNA Gel
Extraction Kit (V-gene Biotechnology Limited). The
purified PCR products was ligated into the pGElVD-T
Vector using the TA cloning kit (Promega); Competent
Escherichia coli DH5a cells were transformed in a liga-
tion reaction, and positive clones were identified by
blue/white selection, as described in the manufacturer’s
protocol. Twenty to thirty positive clones were selected
for each individual. Insert size was verified by PCR
using Ml 3 universal forward and reverse primer.
Different inserts were screened by single-strand confor-
mation polymorphism (SSCP) analysis and sequenced
using the dideoxy nucleotide chain termination method
(Sanger et al., 1977) on an Applied Biosystems 377
automated sequencer.
Data analysis.- Nucleotide and inferred protein
sequences were aligned using the CLUSTAL X software
(Jeanmougin et al., 1998). MHC sequences from close-
ly-related species were acquired using the GenBank
BLAST program (Altschul et al., 1990). Genetic dis-
tances were measured using the two-parameter method
(Kimura, 1980). The computer package MEGA 2.1
(Kumar et al., 2001) was used to estimate the rate of
nonsynonymous (dN) and synonymous (ds) substitutions
according to Nei and Gojobori (1986), applying the
Jukes and Cantor (1969) correction for multiple hits.
The differences between these rates was evaluated with
a /-test with infinite degrees of freedom according to the
test statistic t = d!s{d)\ s(d) is the standard error of d and
Table 2. Numbers (mean±standard error) and relative rate (d^/ds) of nonsynonymous (dN) and synonymous (ds) sub-
stitutions per nucleotide in exon 2 sequences given for all sites and for pABS and non-pABS for comparison of three
species.
Asterisks indicated the significance of two-tailed t-test in the order: * p < 0.01 , ** p < 0.001 .
Figure 1. Amino acid sequences translated from nucleotide sequences of exon 2 from MHC class II B genes of C. reevesii, P. chinensis and A. sinensis. The Alsi
sequences are from our laboratory work (Shi et al. 2004). Asterisks (*) indicate the putative antigen-binding sites correspond with those for human class II
sequences; dots (.) indicate identity with the consensus sequence at the top; dashes (-) gaps introduces to achieve optimal sequence alignment.
52
Asiatic Herpetological Research, Vol. 1 1
2008
in >
<
<
On
on
•<< Q.
£ £
> ■ ■ <
a ■■ a ■■ ■*
in Q
<
LU
Q.
O
CO
z
§
a a a
*
*
o
•^r
>-
LU
*
*
<
Q • • • co oo O
CL <
O • • LU QC QC QC QC CD LU LU LU LU LU LU LU LU
CD LU
—I • • • ■ 0. Q.
*
LULULULULULULULU
LU
Q
Q
v — i '
co Q
<
> uj
on a:
CD on
> • • • _i _i _i s
□ • • • LU LU
CO
a
a
o
on
CD
>
X>-§§>IXX>-XXXIIX - XX - CO •*
■ CO >
X > > LL 0- • • • CO *
Q- • • •> CL> •>>
• — I — I LL
a oaaooooooooo aaaaa
2008
Asiatic Herpetological Research, Vol. 1 1
53
0.05
Figure 2. Phylogenetic tree of MHC class II B genes
nucleotide sequences in different reptiles constructed by
neighbor-joining method in MEGA. Bootstrap values
from 1000 replications were indicated above the branch-
es, values less than 50% are not shown.
is given by s(d) = [Var^) + Var^)]1 2 (Kumar et al.,
1993). These analyses were performed on the 24 codons
comprising the ABS sites (as defined in the crystal struc-
ture of a human class II molecule, DRB1 (Brown et al.,
1993)) and on all remaining non-ABS codons in the
amplified segment. The phylogenetic tree was construct-
ed using MEGA 2.1 program for distance-based meth-
ods, applying the neighbour-joining (NJ) algorithm.
Bootstrap analysis (1000 replications) was performed to
determine the reliability of the branching pattern in the
phylogenetic tree. To further quantify polymorphism,
nucleotide diversity (jt) was also calculated using the
computer application DnaSP (Rozas et al., 1999).
Results
Amount and extent of variation.- In total, fifteen
sequences were obtained from Chinemys reevesii and
Plestiodon chinensis (see Table 1); sequence identity
was confirmed by sequencing multiple clones in both
directions. These sequences are designated Chre for
Chinemys reevesii and Plch for Plestiodon chinensis , in
accordance with the proposed nomenclature (Klein et
al., 1990), and have been deposited in GenBank under
the accession numbers AY937200-AY937207 (for
Chre-\~Chre-&), AY772946-AY77295 1 and AY764032
(for Plch-\~Plch-l). Ten sequences (. Alsi-\~Alsi-\0\
GenBank accession numbers AY49 1421 -AY49 1430) of
exon 2 of the class II B genes from \hrze Alligator sinen-
sis, used for the subsequent data analysis, were also sub-
mitted. All sequences except for one from A. sinensis
(Alsi-S), which had six nucleotides deletions, were
166bp in length. Published sequences were aligned with
those derived here, illustrating numerous variable sites
in Chinemys reevesii (84 [=50.6%]), P. chinensis (12
[=7.2%]) and A. sinensis (38 [=22.9%]); these numbers
are consistent with those seen for this fragment in other
species. Nucleotide diversity was also calculated within
species, with all three species exhibiting a mean pair-
wise nucleotide diversity of 0.22203, 0.02180 and
0.09236, respectively. Furthermore, Chre-5 was also
found to be identical to Plch- 3 in P. chinensis, and Alsi-
1 in A. sinensis. Sharing of these same alleles in different
species was also reported in Hedrick et al. (2002).
Amino acid variation within Chinemys reevesii,
Plestiodon chinensis and Alligator sinensis was 35.8%,
5.2% and 18.4%, respectively (Table 1). Aligned amino
acid sequences are presented in Figure 1. The putative
antigen-binding sites (pABS), corresponding to those in
the human class II sequences (Brown et al., 1993), are
indicated by an asterisk. The term “putative” has used
here because the actual antigen-binding sites for reptiles
have not yet been verified. Among the Chinemys
reevesii sequences, 92.9% (13 out of 14 codons) of
pABS are variable and 63.4% (26 out of 41 codons) of
the nonbinding sites (non-pABS) are variable. Within A.
sinensis, 71.4% of pABS and 31.7% of the non-pABS
are variable, and in P chinensis, 21.4% of pABS (3 of
14) are variable, while 12.2% (5 of 41 positions) of non-
pABS are variable. The numbers of synonymous substi-
tutions (ds) and nonsynonymous substitutions (dN) per
nucleotide in exon 2 sequences are given in Table 2. The
ratio of dN to ds tended to be greater than 1 .0, particular-
ly for pABS, which has a ratio consistent with that seen
in other MHCs, suggesting that there is selection for
amino acid replacements in the antigen-binding region.
Meanwhile, dN/ds for pABS and non-pABS in Chinemys
reevesii and A. sinensis were all larger than 1.0.
Phylogenetic analysis.- BLAST searches in genome
sequence databases have revealed that a number of alle-
les from other reptiles exhibit a high degree of similarity
to the sequences derived here. Of these, three Caiman
crocodilus alleles {Cacr-\~Cacr-2>\ Accession Numbers
AF256651, AF256652 and AF277661) and three
Alligator mississippiensis alleles (Almi-\~Almi- 3;
Accession Numbers U24402-U24404) were chosen for
54
Asiatic Herpetological Research, Vol. 1 1
2008
phylogenetic analysis. A neighbor-joining tree showing
the relationships among these nucleotide sequences is
presented in Figure 2. The sequences of Chinemys
reevesii and Plestiodon chinensis tend to cluster togeth-
er. Interestingly, Caiman crocodilus sequences were
widely dispersed in the tree (supported by high bootstrap
values), being more similar to the crocodile sequences.
A cluster of four Alsi sequences (Alsi- 2, Alsi- 3, Alsi- 5,
Alsi-6) showed a higher degree of similarity to Pick
sequences than to other lineages. The phylogenetic tree
supports the hypothesis of trans-species polymorphism,
as indicated by the clustering of lineages from different
species and the presence of sequences from different
species in the same allelic lineage. This trans-species
allelic similarity is not unusual for MHC genes, as it has
been proposed that MHC allelic lineages are maintained
by selection and are often older than the species them-
selves.
Discussion
In the present study, we investigated exon 2 (of MHC
class II B genes) sequences from three reptiles and
examined within species polymorphism. The results
revealed relatively high amounts of variability in both
nucleotide and amino acid sequences (Table 1), as well
as a pattern of evolution consistent with those seen in a
variety of mammalian species, including humans.
However, the level of genetic variation within each of
these species differed, possibly reflecting different pat-
terns of evolution and population genetic structure.
Levels of polymorphism are higher in Chinemys reevesii
dead Alligator sinensis compared to Plestiodon chinensis ,
which may prove to be of value in future studies on pop-
ulation genetics and conservation biology.
As an important genetic component of the verte-
brate immune system, variation in the MHC is signifi-
cant to consider selective pressure due to parasitic or
pathogen resistance. It has been suggested that species
or populations with low MHC diversity might be partic-
ularly susceptible to infectious disease and parasites
(Hedrick and Kim, 2000; O’Brien and Evermann, 1988).
Furthermore, in this and other studies (Hedrick et al.,
2002; Ottova et al., 2005), identical MHC alleles have
been found amongst different species; the sharing of
these likely homologous sequences may be due to expo-
sure to similar (or the same) antigens present throughout
the evolution of each species.
Balancing selection appears to play a determinant
role in MHC evolution (Bematchez and Landry, 2003),
evidence of which is the presence of more nonsynony-
mous (< dN ) than synonymous ( ds ) substitutions in anti-
gen-binding sites (Binz et al., 2001; David and Helena,
2003; Hedrick et al., 2002). In the present study, the
observed excess of nonsynonymous substitutions, par-
ticularly at putative antigen-binding sites, indicates that
nonsynonymous sites evolve faster than synonymous
sites. This implies the presence of balancing selection
(or positive Darwinian selection), which favors new
variants and increases MHC diversity, which has been
observed in a number of species (Hughes and Nei,
1989). In the case of Chinemys reevesii and Alligator
sinensis, however, a significant excess of nonsynony-
mous substitutions was also found in non-pABS sites,
possibly suggesting that reptile ABS sites may not exact-
ly correspond to those in humans as originally defined
by Brown et al. (1993). Similar findings were reported
for the Pacific salmon (Miller and Withler, 1996) and
Sonoran topminnow (Hedrick et al., 2001).
The phylogenetic tree suggests that some Alsi
sequences are more similar to Plch sequences than to
other Alsi sequences, with species sequences intermin-
gling to form several significantly-supported clusters
(Fig. 2). This intermixing suggests a trans-species per-
sistence of MHC class II exon 2 sequences, with some
allelic lineages predating species cladogenesis. The pro-
longed maintenance of MHC alleles is contrary to what
would be expected from neutral loci, supporting the idea
that long-term balancing selection on the MHC alleles
has occurred (Figueroa et al., 1988). Our results are con-
sistent with the theory of trans-species evolution in
MHC alleles (Klein, 1987), which has been previously
supported by studies on mammals and fish (reviewed in
Hedrick, 2001), suggesting that MHC polymorphism is
widespread in the Vertebrata.
In conclusion, we are presenting strong evidence
for trans-species polymorphism at exon 2 of class II
gene in reptiles. The polymorphism is putatively main-
tained by balancing selection and is restricted to what
are apparently functional loci on (primarily) the ABS
sites. These observations suggest that the MHC carries
out the same function in reptiles as it does in mammals,
but additional research needs to be conducted, particu-
larly with regards to trans-species polymorphism and
specific binding loci across taxa.
Acknowledgments
We greatly thank Dr. R. Hu from the Division of Biology
at the California Institute of Technology for correcting
the English in this paper. This study was supported by
project grants (No.30270213 and 30470244) from the
National Natural Science Foundation of China, the
Foundations for Excellent Youth in Anhui Province
(04043049) and a Special Foundation for Anhui Key
Laboratory of Biotic Environment and Ecological
Security, Anhui Normal University.
2008
Asiatic Herpetological Research, Vol. 1 1
55
Literature Cited
Altschul, S. F., W. Gish, W. Miller, E. W. Myers and D.
J. Lipman. 1990. Basic local alignment search tool.
Journal of Molecular Biology 215: 403-410.
Bematchez, L. and C. Landry. 2003. MHC studies in
nonmodel vertebrates: what have we learned about
natural selection in 15 years? Journal of
Evolutionary Biology 16: 363-377.
Binz, T., C. Largiader, R. Miiller and C. Wedekind.
2001. Sequence diversity of MHC genes in lake
whitefish. Journal of Fish Biology 58: 359-373.
Brown, J. H., T. S. Jardetzky, J. C. Gorga, L. J. Stem, R.
G. Urban, J. L. Strominger and D. C. Wiley. 1993.
Three-dimensional structure of the human class II
histocompatibility antigen HLA-DR1. Nature 364:
33-39.
David, S. R. and W. Helena. 2003. MHC diversity in
two Acrocephalus species: the outbred great reed
warbler and the inbred Seychelles warbler.
Molecular Ecology 12: 3523-3529.
Figueroa, F., E. Gunther and J. Klein. 1988. MHC poly-
morphism predating speciation. Nature 335:
265-267.
Graser, R., C. O’hUigin, V. Vincek, A. Meyer and J.
Klein. 1996. Trans-species polymorphism of class
II MHC loci in danio fishes. Immunogenetics 44:
36-4-8.
Hedrick, R W. and T. J. Kim. 2000. Genetics of complex
polymorphisms: parasites and maintenance of
MHC variation. Pp. 204-234. In R.S. Singh and
C.K. Krimbas (eds.), Evolutionary Genetics from
Molecules to Morphology, Cambridge University
Press, Cambridge.
Hedrick, P. W., R. N. Lee and D. Garrigan. 2002. Major
histocompatibility complex variation in red wolves:
evidence for common ancestry with coyotes and
balancing selection. Molecular Ecology 11:
1905-1913.
Hedrick, P. W„ K. M. Parker and R. N. Lee. 2001. Using
microsatellite and MHC variation to identify
species, ESUs, and Mus in the endangered Sonoran
topminnow. Molecular Ecology 10: 1399-1412.
Hedrick, P. W. 2001. Conservation genetics: where are
we now? Trends in Ecology and Evolution 16:
629-636.
Hess, C. M. and S. V. Edwards. 2002. The evolution of
the major histocompatibility complex in birds.
Bioscience 52: 423^131.
Hill, A. V. S., D. Kwiatkowski, A. J. McMichael, B. M.
Greenwood and S. Bennett. 1992. Maintenance of
MHC polymorphism. Nature 335: 167-170.
Hughes, A. L. and M. K. Hughes. 1995. Natural selec-
tion on the peptide-binding regions of major histo-
compatibility complex molecules. Immunogenetics
42: 233-242.
Hughes, A. L. and M. Nei. 1989. Nucleotide substitution
at major histocompatibility complex class II loci:
evidence for overdominant selection. Proceedings
of the National Academy of Science of the USA 86:
958-962.
Hughes, A. L. and M. Yeager. 1998. Natural selection at
major histocompatibility complex loci of verte-
brates. Annual Review of Genetics 32: 415-435.
Hughes, A. L. 2000. Evolution of introns and exons of
class II major histocompatibility complex genes of
vertebrates. Immunogenetics 51: 473—486.
Jeanmougin, F., J. D. Thompson, M. Gouy, D. G.
Higgins and J. Gibson. 1998. Multiple sequence
alignment with Clustal X. Trends in Biochemical
Sciences 23: 403^-05.
Jukes, T. H. and C. R. Cantor. 1969. Evolution of protein
molecules. Pp. 21-132. In H. N. Munro (ed.),
Mammalian Protein Metabolism, Academic Press,
New York.
Kimura, M. 1980. A simple method for estimating evo-
lutionary rates of base substitutions through com-
parative studies of nucleotide sequences. Journal of
Molecular Evolution 16: 111-120.
Klein, J., R. E. Bontrop, R. L. Dawkins, H. A. Erlich, E.
B. Gyllensten, E. R. Heise, P. P. Jones, P. Parham,
E. K. Wakeland, and D. I. Watkins. 1990.
Nomenclature for the major histocompatibility
complexes of different species: a proposal.
Immunogenetics 31: 217-219.
56
Asiatic Herpetological Research, Vol. 1 1
2008
Klein, J., A. Sato, S. Nagl and C. O’Huigin. 1998.
Molecular trans-species polymorphism. Annual
Review of Ecology and Systematics 29: 1-21.
Klein, J. 1986. Natural history of the major histocompat-
ibility complex. John Wiley, New York.
Klein, J. 1987. Origin of major histocompatibility com-
plex polymorphism: the trans-species hypothesis.
Human Immunology 19: 155-162.
Kumar, S., K. Tamura and M. Nei. 1993. MEGA:
Molecular evolutionary genetics analysis, version
1.01. Institute of Molecular Evolutionary Genetics,
Pennsylvania State University, University Park,
Pennsylvania.
Kumar, S., K. Tamura, I. B. Jakobsen and M. Nei. 2001.
MAGE2: Molecular evolutionary genetics analysis
software. Pp. 1244-1245. In Bioinformatics,
Oxford University Press, England.
Miller, K. M. and R. E. Withler. 1996. Sequence analysis
of a polymorphic MHC class II gene in Pacific
salmon. Immunogenetics 43: 337-351.
Nei, M. and T. Gojobori. 1986. Simple methods for esti-
mating the numbers of synonymous and nonsyn-
onymous nucleotide substitutions. Molecular
Biology Evolution 3: 4 1 8 — 426.
O’Brien, S. J. and J. F. Evermann. 1988. Interactive
influence of infectious disease and genetic diversity
in natural populations. Trends in Ecology &
Evolution 3: 254—259.
Ottova, E., A. Simkova, J. F. Martin, J. G. Bellocq, M.
Gelnar, J. F. Allienne and S. Morand. 2005.
Evolution and trans-species polymorphism of MHC
class II (3 genes in cyprinid fish. Fish & Shellfish
Immunology 18: 199-222.
Parham, P. and T. Ohta. 1996. Population biology of
antigen presentation by MHC class I molecules.
Science 272: 67-74.
Richardson, D. S. and H. Westerdahl. 2003. MHC diver-
sity in two Acrocephalus species: the outbred great
reed warbler and the inbred Seychelles warbler.
Molecular Ecology 12: 3523-3529.
Rozas, J., J. C. Sanchez-Delbarrio, X. Messeguer and R.
Rozas. 1999. DnaSP, DNA polymorphism analyses
by the coalescent and other methods.
Bioinformatics 19: 2496-2497.
Sambrook, J. and D. W. Russell. 2001. Molecular
cloning: A laboratory manual, third edition. Cold
Spring Harbor Laboratory Press, New York.
Sanger, F., S. Nicklen and A. R. Coulson. 1977. DNA
sequencing with chain-terminating inhibitors.
Proceedings of the National Academy of Science of
the USA 74: 5463-5467.
Shi, Y., X. Wu, P. Yan and B. Chen. 2004. Cloning and
sequences analysis of the second exon of MHC
class II B genes in Chinese alligator, Alligator
sinensis. Zoological Research 25(5): 415^421. (In
Chinese).
Thursz, M. R., H. C. Thomas, B. M. Greenwood and A.
V. S. Hill. 1997. Heterozygote advantage for HLA
class-II type in hepatitis B virus infection. Nature
Genetics 17: 11-12.
Submitted: 25 October 2006
Accepted: 23 September 2007
2008
Asiatic Herpetological Research, Vol. 1 1
pp.57-61
The Biology and Taxonomic Status of the
Sunken Ear Frog (Rana tormotus Wu, 1977)
PlPENG Li* AND YUYAN Lu
Liaoning Key Laboratory of Biodiversity and Evolution, Shenyang
Normal University, Shenyang 110034, P. R. China.
* Corresponding author E-mail: [email protected]
Abstract.- The biology and taxonomic status of the sunken ear frog, Rana tormotus Wu, 1977, are reviewed and
briefly discussed. This is a rare species restricted the mountain streams and rivers of Anhui and Zhejiang provinces
in East China, and is characterized by a sunken tympanic membrane that forms an external ear canal, similar to that
seen in birds. The male, which is known to produce ultrasonic sounds when calling, has a more deeply sunken mem-
brane. The karyotype of this frog is 2n = 26, having five pairs of large, eight pairs of small and seven pairs of sub-
metacentric chromosomes. The frog is active during the night and females are uncommonly encountered. Specimens
are often found in the same habitat as Megophrys boettgeri, Bufo gargarizans, Rana limnocharis, R. schmackeri, Paa
spinosa, Amolops wuyiensis and A. ricketti. This frog was first described within Rana , but it was recombined in
Amolops because its tadpole was of the “ Amolops type”, even though the tadpole was unknown at the time. The
recently-discovered tadpole has no abdominal sucker and the poison glands, smaller than and similar to those of R.
schmackeri with LTRF (1:4-4/111:1-1), making it distinct from the “Amolops- type” tadpole. Adult and larval morphol-
ogy, as well as developmental characters, support the placement of this species in Wurana, a new genus setup recent-
ly-
Keywords.- Amphibia, Ranidae, Rana , tormotus, Wurana, Amolops.
Introduction
Rana tormotus Wu, 1977 is a characteristic frog with a
sunken ear membrane that is particularly distinct in the
male, giving this species the common name of “sunken
eared frog” or “concave-eared torrent Frog,” the former
of which translates to “Ao Er Wa” or “Wa Er Wa ” in
Chinese. In 1972 and 1974, Ermi Zhao, Guanfu Wu and
two assistants collected one female and 18 male frogs
with sunken tympana at Taohua Creek on Mt. Huanshan.
These frogs were subsequently described as members of
the new species Rana tormotus (Sichuan Institute of
Biology [Wu, G. F.]). During the next 23 years, only a
few reports on this frog’s taxonomy and karyotype were
published (Chen, 1991; Fei et al., 1991; Guo and Dong,
1986; Huang et al., 1990). The species was subsequently
moved to Amolops by Fei et al. (1991), because its tad-
pole might be of the “ Amolops type”, even though the
tadpole was unknown at the time. The correct taxonomic
placement of this species is currently ambiguous (Global
Amphibian Assessment, 2005; Zhao and Adler, 1993;
Zhao and Zhao, 1994; Zhao et al., 2000;).
Recently, the ecology, bioacoustics and evolution-
ary history of this species have been explored by Liu and
Hua (2001), Wu and Wu (2002) and Feng et al. (2002,
2006). We have also completed surveys on its distribu-
tion and habitat (at Jiande, Zhejiang and its type locality
at Huanshan, Anhui), which are presented below. We
further placed this species in the new genus Wurana on
the basis of developmental characters and adult and lar-
val morphology (Li et al., 2006).
Distribution and habitat - This sunken ear frog is a rare
endemic species restricted to the mountain streams and
rivers of East China at elevations between 150 and 750
m. It is currently known only from the type locality
(Taohua Creek, Hotspring Creek, Fu Creek and Xiang
Creek of Huanshan, Anhui Province) and two locations
in Zhejiang province (Huang, et al, 1990, personal com-
munication with Prof. Qinghui Gu): two small creeks in
the Jiangde Forestry Centre and the creeks of Anji
County. The latter creeks are filled with large rocks and
are surrounded by trees, brushes and grass (Figs. 1-3).
All frogs were collected at night since they could
not be found during the day. Adult males were found on
rocks in the river and in the surrounding trees and
shrubs, and were located by their calls. No females were
observed; in Liu and Hua (2001), it was reported that
females were collected only after midnight following the
appearance of males. It was suggested that the females
were not commonly found because they occupied higher
tree branches (Wu and Wu, 2002). Neither sex was
observed following the breeding season.
Wu and Wu (2002) reported that the frogs were only
found in shrubs along the flat parts of the river. In com-
parison, at the bases of mountains we found that trees
© 2008 by Asiatic Herpetological Research
58
Asiatic Herpetological Research, Vol. 1 1
2008
115° 120°
Figure 1. Distribution of Rana tormotus (red square) in
Anhui and Zhejiang province.
were preferentially chosen (57.32% at Taohua Creek and
51.9% at Fu Creek), followed by shrubs (31.71% and
40.51%) and then rocks in the water (10.98% and
7.95%). Liu and Hua (2001) observed 11 of 53 frogs on
branches, four on sand near vegetation along the river
bank and the remainder on exposed sand and rock in the
river far from any vegetation. In the present study at
Taohua Creek, 20% of frogs were found on tree branch-
es, 40% on shrubs, 20% on grass leaves and 20% on
rocks; specimens were never found along sandy river
banks, where they may have been excluded by Rana
species. The differences in observations between sur-
veys may be due to climatic variation.
Males were kept in an aquatic box simulating the
natural environment. During the day, the frogs hid in
gaps between stones and vegetation, but at night they
emerged on the surrounding leaves and rocks despite
variation in weather (including rain).
The other frogs found in the same habitat as Rana
tormotus at the type locality were Megophrys boettgeri,
Bufo gargarizans, Rana limnocharis , Rana schmackeri
(Boettger, 1892), Paa spinosa (David, 1875) and
Amolops wuyiensis (Liu and Hu, 1975) (Liu and Hua,
2001; Li, Lu and Lii, 2006). Amolops ricketti was found
instead of A. wuyiensis at Jiande. Frogs observed in the
Figure 2. Type locality of Rana tormotus, Taohua Creek
of Mt. Huanshan in Anhui province, China.
surrounding areas included Rana nigromaculata ,
Microhyla heymonsi, R. livida and R. japonica (Wu and
Wu, 2002). Tadpoles of Rana schmackeri, Paa spinosa
and Amolops wuyiensi were also collected from Taohua
Creek.
Karyotype and Ag-banding pattern.- Guo and Dong
(1986) reported the karyotype and Ag-banding pattern of
Rana tormotus. The karyotype is 2n = 26, consisting of
five pairs of large and eight pairs of small chromosomes.
A secondary constriction is present near the centromere
on the long arms of chromosome 6 and 10. No hetero-
morphic chromosomes were present. One homologous
pair of NORs were found in the secondary constriction
of chromosome 10 using Ag-AS staining techniques.
There were also seven pairs of submetacentric chromo-
somes, the largest among frogs with a 2n = 26 karyotype
in the Raninae (Guo and Dong, 1986; Pan et al., 2002).
Calling and related morphological characters. -
Recently, Feng et al. (2002, 2006) detailed the extraordi-
narily rich vocal repertoire of the sunken ear frog. These
frogs produce countless vocalizations, some of which
share features of bird songs or primate calls - e.g., ultra-
sonic frequency, multiple upward and downward FM
sweeps and sudden the onset and offset of selective har-
monic components within a call note. Most frog calls go
either up or down, and no others are known to extend
into the ultrasonic range. Frame-by-frame video analysis
of the frog's calling behavior suggests the presence of
two pairs of vocal sacs that may contribute to its remark-
able call-note complexity. Electrophysiological studies
of the frog’s auditory midbrain confirmed that its audi-
ble range extends into the ultrasonic (Xu et al., 2005).
This characteristic can likely be explained by the fact
2008
Asiatic Herpetological Research, Vol. 11
59
Figure 3. Another locality of Rana tormotus at Jiande
county of Zhejiang province, China.
that the frog lives by noisy streams that produce acoustic
signals with significant ultrasonic harmonics that would
mask normal calls; selective pressure on this species
could eventually produce a call that would not be
masked by the wideband noise produced by the river
(Peter et al., 2003).
With regard to sound reception, the sunken ear frog
has a unique structural autapomorphy not seen in other
Anura - a sunken tympanic membrane that forms an
external ear canal like that seen in birds. The tympanic
membrane is more deeply sunken in the male, suggest-
ing that it receives the airborne sound in a manner some-
what different from that in the female (Feng et al., 2006;
Xu et al., 2005).
Tadpoles and taxonomic status.- Several different
species of tadpoles from the frog’s type locality were
reared to metamorphosis in the lab. The first morpho-
type was identified as Amolops wuyiensis, which had an
abdominal sucker and poison glands; the second to
fourth morphotypes were without either of these struc-
tures. Among latter, one identified as Paa spinosa had a
relatively larger body and body-tail length, and froglets
that very closely resembled the adult in general mor-
phology. The remaining two morphotypes were signifi-
cantly smaller and had the same LTRF (1:4-4/111:1-1); of
these, one was externally similar to the adult of Rana
schmackeri and one was similar to the adult of R. tormo-
tus (Fig. 4); the characters used to aid in the separation
of these two species were those listed in Li et al. (2006)
and another paper discussing this species in the present
journal issue (Li et al., 2007).
These characters are enough to verify that Rana
tormotus does not have an Amolops- type larva, and
Figure 4. Tadpole, froglets and adult male of Rana tormo-
tus (Wu, 1977). (A) Adult male and froglets, (B) tadpoles,
(C) froglet just after metamorphosis, (D) froglet in ventral
view.
should be placed elsewhere. This conclusion was veri-
fied by examining and comparing the skeletons of Rana
tormotus to the ranine genera Amolops , Pseudoamolops,
Rana and Staurior (Li et al., 2006).
Li et al. (2006) designated Rana tormotus as the
type species of the new monotypic genus Wurana (ety-
mologically, the specific epithet honors Wu Guanfu for
the research on this and other frogs), which is known
from Anhui and Zhejiang Provinces, China. Wurana is
diagnosed as follows:
Adult.- Dorsolateral folds relatively thick and
wide; tympanum deep, forming an external audito-
ry canal that is pronounced in the male; no temporal
folds; male without humeral glands; tarsal folds
absent; tips of fingers and toes expanded into small
disks with circummarginal grooves on outer three
digits; width of crossbar on terminal phalanx much
less than 0.3 times phalanx length.
Larva.- Small type tadpole with weak homy beak;
two rows of lower labial papillae with bases origi-
nating in same line; oral disc emarginate laterally,
with single row of truncate marginal papillae in
posterolateral margin of upper lip and with wide
rostral gap; labial tooth row formula (LTRF) usual-
60
Asiatic Herpetological Research, Vol. 1 1
2008
ly 1:4-4/111: 1-1 (sometimes 1:3-3/111:1-1); without
external gland groups; spiraculum on the left with
free tube.
From the general external morphological and skele-
tal characters, Wurana is closer to Rana, especially to
some of the odorous frogs, than Amolops.
The surveys done by Qinghui Gu, Pipeng Li and
others have shown that Wurana tormota is likely either
a threatened or “rapidly declining” species (Global
Amphibian Assessment, 2005; Liu and Hua, 2001). It
has a restricted distribution in a region that is heavily-
impacted by human activities such as sight-seeing,
therefore continued biological research and regional
conservation are strongly recommended.
Acknowledgments
This study was supported by Natural Science
Foundation of China (grant no. 30470206 to Pipeng Li).
We thank Prof. Ermi Zhao, Qinghui Gu, Guangfu Wu,
Hui Zhao, Xisheng Tang, Song Huang and Shunqing Lb
for their help in field surveys and research.
Literature Cited
Chen, B. H. 1992. The Amphibian and Reptilian Fauna
of Anhui. Anhui Publishing House of Science and
Technology, Heifei, China.
Dubois, A. 2005. Amphibia Mundi 1. Alytes 23(1-2):
1-24.
Feng, A. S, P. M. Narins and C.H. Xu. 2002. Vocal acro-
batics in a Chinese frog, Amolops tormotus.
Naturwissenschaften 89: 352-356.
Feng, A. S, P. N. Narins, C. H. Xu, W. Y. Lin, Z. L. Yu,
Q. Qiu, Z. M. Xu and J. X. Shen. 2006. Ultrasonic
communication in frog. Nature 440: 333-336.
Fei L, C. Y. Ye and Y. Z. Huang. 1991. Key to Chinese
Amphibia. Chongqing Branch, Science and
Technology Literature Publishing House,
Chongqing, China. Pp 124-126.
Fei, L, C. Y. Ye, J. P. Jiang, F. Xie and Y. Z. Huang.
2005. An illustrated key to Chinese amphibians.
Sichuan Publishing Group - Sichuan Publishing
House of Science and Technology, Chengdu,
China. Pp 150-158.
Frost, D. 2006. Amphibian Species of the World 3.0, an
online reference, http://research.amnh.org/herpetol-
ogy/amphibia/index.php.
Global Amphibian Assessment. 2005. Global
Amphibian Assessment - Amolops tormotus. an
online reference,
http ://w ww.globalamphibians.org/ servlet/G AA? sea
rchName=Amolops+tormotus.
Guo, C. W. and Y. W. Dong. 1986. Studies on the kary-
otype and Ag-banding pattern of Rana tormotus
Wu. Acta Herpetologica Sinica 5: 181-184.
Huang, M. H, Y. L. Jin and C. M. Cai. 1990. Fauna
Zhejiang: Amphibia/Reptilia. Zhejiang Science and
Technology Publishing House, Hangzhou, China.
Pp. 77-78.
Li, P. P., Y. Y. Lu, A. Li and F. L. Yu. 2008. Tadpole of a
little-known frog, Wurana tormotus. Asiatic
Herpetological Research, 11:71-75.
Li, P. P, Y. Y. Lu and S. Q. Lb. 2006. Taxonomic status
of Rana tormotus Wu, 1977 with description of a
new genus of subfamily Raninae. Sichuan Journal
of Zoology, 25(2): 206-209.
Liu, B. R. and T. M. Hua. 2001. Ecological research of
Rana tormotus. Journal of Biology 18(3): 27-28.
Pang, Q. P, Y. Ye. and Y. T. Wen. 2003. Chromosome
data of Chinese amphibians. Chinese Journal of
Zoology 37(4): 49-62.
Peter, M. N, A. S. Feng and W. Y. Lin. 2004. Old World
frog and bird vocalizations contain prominent ultra-
sonic harmonics. J. Acoust. Soc. Am. 115(2):
910-913.
Sichuan Institute of Biology (Wu, G. F.). 1977. A new
species of frogs from Huang-Shan, Anhui - Rana
tormotus Wu. Acta Zoologica Sinica 23(1):
113-115.
Wu, H. L. and X. B. Wu. 2002. Habitat selection and
food habit of Rana tormotus. Herpetologica Sinica
9: 123-126.
Yu, Z. L, Q. Qiu, Z. M. Xu, J. X. Shen, A. Feng, P.
Narins and W. Y. Lin. 2005. A study of sound com-
munication and hearing in the concave-eared tor-
rent frog {Amolops tormotus ). Herpetologica Sinica
10:266-268.
2008
Asiatic Herpetological Research, Vol. 11
61
Zhao, E. M. and K. Adler. 1993. Herpetology of China.
Published by Society for the Study of Amphibians
and Reptiles in cooperated with Chinese Society for
Study of Amphibians and Reptiles. Oxford, Ohio,
USA.
Zhao, E. M, H. W. Chang and X. L. Zhao. 2000.
Taxonimic bibliography of Chinese amphibia and
reptilian, including karyological literature.
Herpetological Series 11: 215-238. Kaohsiung Fu-
Wen Publishing Co. Ltd, Taiwan, China.
Zhao, E. M. and H. Zhao. 1994. Chinese Herpetological
Literature - Catalogue and Indices. Chengdu
Science and Technology University Press,
Chengdu, China.
Submitted: 16 October 2006
Accepted: 25 November 2007
pp. 62-70
Asiatic Herpetological Research, Vol. 1 1
2008
A New Species of Brown Frog from Bohai, China
Pipeng Li1’*, Yuyan Lu1 and Ang Li1
1 Liaoning Key Laboratory of Biodiversity and Evolution,
Shenyang Normal University, Shenyang 110034, P. R. China.
* Corresponding author E-mail: [email protected]
Abstract.- A new species of brown frog is described from Mt. Culai in Shandong province, China. The new species
differs from other Chinese members of the R. longicrus group (R. zhenhaiensis, R. chaochiaoensis and R. omeirnontis)
in that the head is wider than long and female leg is longer than that of the male. Furthermore, the body is larger the
web on the inner side of the male fifth toe nearly extends to the toe tip, the dorsal color is reddish-brown, there are
no gray or dark bars across the eyes or spots on the back, the labial tooth row formula is frequently 3(2-3)/3, the male
tibia is slightly longer than the foot, the dorsal masculine line is absent and the ventral masculine line is weakly devel-
oped.
Keywords.- Ranidae, Rana, brown frog, new species, China.
Introduction
Brown frogs, also known as wood frogs (Liu, 1946), are
a widespread, complex and diverse group in the genus
Rana. Thirteen brown frogs are known from China, five
of which were previously recognized as R. japonica
(Pope and Boring, 1940). These five species, together
called the southern Chinese Brown Frog (2n = 26), occur
south of the Yangtse River and in Taiwan. The brown
frog in Taiwan was revived as R. longicrus Stejneger,
1898 and the species on the mainland were subsequently
considered to be R. chaochiaoensis Liu, 1945, R.
chevronta Hu and Ye, 1981, R. omeirnontis Ye and Fei,
1993, R. zhenhaiensis Ye, Fei and Matsui, 1995 and R.
japonica (Fei et al., 1993; Fei et al., 2005; Liu and Hu,
1961; Ye et al., 1995).
The species of southern Chinese brown frog do not
overlap in their distributions. Rana chaochiaoensis and
R. omeirnontis are more western in distribution, with the
former found in Yunnan, Guizhou and Sichuan
Provinces, and the latter found in Sichuan and Gansu
Provinces, as well as some counties in Guizhou, Hunan
and Hubei Provinces (Fei et al., 2005, Li et al., 2005). R.
zhenhaiensis occurs in eastern and southeastern China,
in Anhui, Jiangsu, Zhejiang, Jiangxi, Hunan, Fujian,
Guandong and Guangxi Provinces (Fei et al., 2005; Li et
al., 2005). R. chevronta is also western in distribution,
found only on Mt. Omei (Fei, 1999; Fei et al., 2005; Li
et al., 2005). In northern China, R. japonica, now
replaced by R. zhenhaiensis and no R. japonica in China
(Ye et al., 1995), was recorded formerly at Mt. Culai in
Shandong Province and Jixian county in Tianjin (Wang
et al., 1997; Wang et al., 1995). The two other species of
brown frog found in northern China are R. chensinensis
and R. kunyuensis, found in Shandong peninsula (Li et
al., 2006; Lu and Li, 2002), 500 km away from Mt.
Culai.
The present study, part of a project funded by the
National Natural Science Foundation of China, was con-
ducted in a region near the Bohai Sea, where the authors
collected three species of brown frogs (Li et al., 2005; Li
et al., 2006; Lu and Li, 2002). Several specimens resem-
bling Rana zhenhaiensis and R. omeirnontis were col-
lected on Mt. Culai, and were subsequently described as
a “species belong to Rana longicrus species group in
Shandong Province” (Lu et al., 2005). However, after
comparing these specimens with representatives of R.
zhenhaiensis and R. omeirnontis collected from their
type localities and the original descriptions of these
species, the frog from Mt. Culai appears to be a distinct
and separate species. This new species is here placed
within Rana as part of the R. longicrus group and its
relationship to other Chinese members of the group is
discussed.
Materials and Methods
From May 2005 to March 2006, surveys were conducted
at Mt. Culai, Shandong Province (Fig. 1), and the type
localities of Rana zhenhaiensis (Caiqiao of Beilun (for-
merly Zhenhai County), Zhejiang Province) and R.
omeirnontis (Longdong of Mt. Omei, Sichuan Province),
where adults, juveniles and tadpoles were collected.
Some tadpoles were reared through metamorphosis to
confirm their identification, as well as to describe and
compare their coloration with respect to the adults, or at
least until stages 36-38 for proper description.
Specimens were raised in captivity in plastic boxes (260
x 175 x 160 mm) filled with 1.5 L of water. Egg yolk and
© 2008 by Asiatic Herpetological Research
2008
Asiatic Herpetological Research, Vol. 1 1
63
Figure 1. Collection Area in Shandong province, China.
A: Culai Mountain.
vegetable leaves were regularly provided. Frogs and tad-
poles were preserved in 10% formalin and deposited in
the collections of Shenyang Normal University.
Measurements were made with digital calipers to
the nearest 0.01 mm. Abbreviations are as follows: SVL
= snout-vent length; HDL = head length, from tip of
snout to rear of jaws; HDW = maximum head width;
SNT = snout length, from tip of snout to anterior comer
of eye; EYE = diameter of exposed portion of eyeball;
IND = intemasal distance; IOD = interorbital distance at
narrowest point; TMP = horizontal diameter of tympa-
num; TEY = tympanum-eye distance, from anterior edge
of tympanum to posterior comer of eye; FAHL = fore-
arm and hand length; FAW = forearm width; TLL = total
length of leg; TIB = tibia length; TFL = tarsus and foot
length; FL = foot length, from proximal edge of inner
metatarsal tubercle to tip of fourth toe.
All tadpoles were staged according to Gosner
(1960). Tadpoles in stage 33, including both reared spec-
imens and those preserved immediately after capture,
were measured and used in descriptions. Measurements
and terminology follow McDiarmid and Altig (1999).
The labial tooth row formula follows those outlined by
McDiarmid and Altig (1999) and Dubois (Li, 2006).
All measurements were taken with a digital caliper
(to the nearest 0.01 mm) under a stereomicroscope,
except for total length, which was measured with the
caliper directly. Photographs were taken with Nikon
D100 and Sony 7 1 7digital cameras.
Data from Rana zhenhaiensis and R. omeimontis
were taken from their original descriptions and from
additional specimens collected from their respective
type localities and other localities stored in Chengdu
Institute of Biology (CIB) and Museum of Natural
History of Shenyang Normal University (SYNU).
Taxonomy
Rana culaiensis, new species
(Figs. 2-3)
Holotype and type locality.- An adult male, Field num-
ber YT050526007, collected by Lu Yuyan on 27 May
2005 from Mt. Culai (1 17° 18' E, 36° 02' N), Taian City,
Shandong province, China (Fig. 1), at 900 m elevation.
Paratypes.- An adult female, Field number
YT050526005, other information as forthe holotype.
64
Asiatic Herpetological Research, Vol. 11
2008
Figure 2. Holotype of Rana culaiensis, sp. nov. and its
allied species from type localities. (A) Dorsal, (B) Lateral
and (C) Ventral view of R. culaiensis, (D) Lateral view of
R. zhenhaiensis, (E) Lateral view of R. omeimontis, (F)
Dorsal and (G) Lateral view of tadpole of R. culaiensis at
stage 33, (H) Palmar view of hand in R. culaiensis, (I)
Palmar view of hand in R. zhenhaiensis.
Five males, Field number YT050526001-004,
YT050526006, collected by Lu Yuyan on 27 May 2005
from ML Culai (36° 02-03' N, 117° 17-18' E, Taian
City, Shandong province, China, at 690-900 m eleva-
tion.
Tadpoles - Other information as for the holotype.
Diagnosis and comparisons.- This new species is super-
ficially similar to Rana zhenhaiensis, but it can be dis-
tinguished by the following characters: 1) average
snout-vent length larger in adult males (53.6 mm) and
females (62.0 mm); 2) head length slightly less than
head width; 3) toes 3/4 webbed, with web on inner side
of male fifth toe nearly extending to tip; 4) dorsal color
reddish brown, without gray or dark bar across eyes or
spots on back; 5) dorsal masculine line absent and ven-
tral masculine line weakly developed; 6) male tibia
slightly longer than foot; 7) labial tooth row formula fre-
quently 3(2-3)/3. Furthermore, with respect to similar
brown frogs in China, the female leg of R. culaiensis is
longer than the male leg.
On the other hand, this new species can be separated
from all other southern Chinese brown frogs on the basis
Figure 3. Flolotype of Rana culaiensis, sp. nov. (A)
Dorsal view, (B) Ventral view, (C) Lateral view of head,
(D) Palmar view of hand, (E) Tarsal view of Foot. Scale
bar = 10 mm.
of a head that is wider than long and a female leg that is
longer than that of the male. When comparing Rana
culaiensis to other southern Chinese brown frogs in the
R. longicrus group, it appears to be a very well-defined
species with conspicuous diagnostic features (Fig. 4;
Table 2) that easily separate it from the superficially
similar R. zhenhaiensis, R. omeimontis and R.
chaochiaoensis .
From R. zhenhaiensis in having larger males and
females, longer female legs, a more well-developed web
on inner side of male toe 5 (ill developed in R. zhen-
haiensis), an indistinct ventral masculine line (on both
sides in R. zhenhaiensis ) and a different breeding season
(from March to April in R. culaiensis and January to
March in R. zhenhaiensis).
From R. omeimontis in having slightly curved dor-
solateral fold (straight in R. omeimontis), relatively
longer female legs, an indistinct ventral masculine line
(on both sides in R. omeimontis), a larger TMP:EYE
ratio (0.66) and different breeding seasons (July to
2008
Asiatic Herpetological Research, Vol. 1 1
65
R. culaiensis R. zhenhaiensis R. omeimontis
Figure 4. Rana culaiensis, sp. nov. and its allied species from their type localities. (A) dorsal view of male and (B)
ventral view of male (scale bar = 10 mm).
October in R. omeimontis).
From R. chaochiaoensis in having slightly curved
dorsolateral fold, relatively longer female legs (legs of
subequal length in both sexes of R. chaochiaoensis), an
indistinct ventral masculine line, a yellowish-white
female venter (reddish-orange in R. chaochiaoensis ),
three rows of teeth on the tadpole lower lip (four rows in
R. chaochiaoensis ) and a different breeding season
(April to May in R. chaochiaoensis , with some breeding
seen as late as August).
In distribution, Rana culaiensis is allopatric to its
related species. It is a common case in the brown frogs
in China, such as Rana chevronta which only found
located at a narrow area in Mt. Omei (Fei et al., 2005)
and R. kunyuensis, which is closed to R. amurensis and
located in Mt. Kunyu only (Che et al., 2007; Li et al.,
2005).
Description of holotype.- An adult female with SVL
62.0 mm; HDW slightly wider than HDL and head
strongly depressed; snout rounded (more so on projec-
tion beyond lower jaw) and SNT slightly longer than
EYE; canthus rostralis distinct, loreal region slightly
oblique; nostril slightly closer to tip of snout; IND wider
66
Asiatic Herpetological Research, Vol. 1 1
2008
Table 1. Measurements (mm) of allotype and paratypes of Rana culaiensis, sp. nov.
Note: * size range, ** mean ± SD (n = 5), *** % SVL.
than IOD and IOD wider than upper eyelid width; tym-
panum large, round, TMP two-thirds diameter of EYE
and separated from eye (TEY) by one-third of TMP;
vomerine teeth developed in slightly oblique groups
between and behind choanae, with groups narrowly sep-
arated in “\ /” shape; tongue deeply notched and with
papillae.
FAHL less than half of SVL; fingers obtuse with
relative length of fingers II < IV < I < III; subarticular
tubercles prominent; three metacarpal tubercles distinct
(inner one large and outer two separated at bases). TLL
relatively long; tibio-tarsal joint reaching nostril, mak-
ing TIB about 57.8% of SVL; heels overlapping when
limbs folded at right angles to body; TIB slightly longer
than FL; toes also obtuse with tips similar to those of
fingers, toes 3/4 webbed with subarticular tubercles well
developed; web of inner side of male fifth toe nearly
extending to tip of toe; inner metatarsal tubercle oval,
outer metatarsal tubercle weakly developed.
Skin rather smooth above, with few warts; glandu-
lar dorsolateral fold running along each side of body
behind eye to insertion of hind leg and slightly curved to
temporal fold above tympanum; temporal fold distinctly
curving posteriorly from above tympanum to large trian-
gular gray patch behind eye; ventral surface of body
smooth except for posterior and median surfaces of
femora, which are covered with coarse granular glands
(small granules).
Measurement of holotype.- SVL 56.8 mm; HDL 17.15
mm; HDW 17.9 mm; SNT 7.8 mm; IND 5.32 mm; IOD
3.51 mm; UED 3.97 mm; EYE 6.26 mm; TMP 3.69 mm;
FAHL 23.63 mm; FAW 7.6 mm; TLL 106.17 mm; TIB
34.2 mm; TFL 47.91 mm; FL 33.7 mm.
Coloration of holotype in life (in preservative). -
Dorsum evenly reddish or yellowish-brown (gray),
without gray or dark interorbital bars; stripe on upper lip
dark brown with white blotches, extending from tip of
snout to venter of eye, joining with dark reddish-brown
2008
Asiatic Herpetological Research, Vol. 11
67
(yellow) stripe running to behind arm insertion; lower
lip with brown speckles; rictal glands brown (yellow);
limbs gray dorsally with four and five dark cross-bars on
thigh and tibia, respectively; sides of body light yellow.
Dorsolateral told pale brown (yellow); throat and belly
creamy-yellow (white with pale gray nebulous marks);
triangular patch gray to somewhat black (gray with tym-
panum dark brown); metacarpal tubercles and nuptial
pad dark brown (black).
Description of paratypes.- The paratypes, six adult
specimens, one female (YT050526005) and five males
(YT05052600 1-004, YT050526006) approximate the
holotype in almost all pertinent details. The measure-
ments of paratypes summarized in Table 1. However,
there are some minor differences between paratypes and
the holotype as follows:
Male paratypes.- One male specimen with small
tubercles on sides of body covered with black. And
the following characters of male paratypes as sec-
ondary sexual characters: smaller than female with
FAW much thickened; male with strong nuptial
pads on the inner-dorsal side of first fingers, extend-
ed to figure tip and separated at metacarpus; no
vocal sacs; lineae musculinae indistinct ventrally
and absent dorsally; TLL is shorter than the female
TLL.
Female paratype.- The female specimen with light
jacinth spots ventrally in life (pale gay flecks in pre-
servative).
Tadpoles.- The body ovoid in dorsal profile, pear-like in
lateral profile; darkly colored in life (tail more grey in
preservative). In stage 33, body length 16 mm, tail
length 34 mm, length of hind limb 9 mm; snout rounded,
eye dorsolateral, nostril slightly closer to snout tip;
spiraculum small, on left side of body and with no free
tube; vent dextral, tube of vent continuous with ventral
caudal fin; dorsal fin rising from base of tail. Tail height
about half of body length with apex obtuse; musculation
weakly developed on pointed tip; mouth anteroventral,
with row of labial papillae on lower lip and mouth cor-
ner (papillae of lower lip regularly arranged); comer of
mouth with several additional papillae; labial tooth row
formula frequently 3(2-3)/3, length of tooth row long,
homy beak weak and narrow.
Habitat.- During field work at Mt. Culai of Shandong
province in 2005 and 2006, we surveyed the Mt. Culai
and the nearby mountains and collected the trogs
described here as a new species in a forest brook (alt.
630-900m) covered with gramineous grass following
the breeding season. The tadpoles in stage 28-34 were
collected on 27 May 2005. No eggs were found at that
time, suggesting that the breeding season for this species
was in March and April.
Etymology.- Rana culaiensis is so named as it is appar-
ently restricted to Mt. Culai of Shandong procince, East
China.
Taxonomic account.- As Liu (1946) indicated, “among
the Chinese amphibian the woodfrog group presents a
problem most difficult to solve. Great confusion exists
in the literature, as there has been no satisfactory com-
parative study of preserved museum specimens of differ-
ent species, and no careful investigation in the fields.” In
some species groups, the frogs are quite conservative in
their morphology and very difficult to separate (Liu and
Hu, 1961; Lu and Li, 2002; Tanaka et ah, 1996; Xie et
al., 2000), as is also the case for the many species of
Eurasian brown frogs (Kim et al., 2002). Although much
progress has been made in the systematics of these
species, many brown frogs are still difficult to identify
and some species may yet remain undescribed (Che,
2007; Lu and Li, 2005).
The brown frogs of the Rana longicrus group (for-
merly treated as the Rana japonica group) included four
species ( Rana zhenhaiensis, R. chaochiaoensis , R. omei-
montis, and R. chevronta) in the mainland of the south-
ern China and one species {Rana longicrus ) in Taiwan
(Fei et al., 2005; Xie et al., 2000). These frogs once clas-
sified as R. japonica by Pope and Boring (1940), The
species-level status of R. chaochiaoensis , R. chevronta
and R. longicrus has never been questioned, but some
researchers still treat R. omeimontis and R. zhenhaiensis
as R. japonica (Zhao et al., 2000), even though Xie et al.
(2000) provided significant morphological, ecological,
cytological and morpholometrical support to verify the
status of all five species. Well-supported phylogenetic
analyses have also been provided (Che, 2007; Jiang and
Zhou, 2001; Yang et al., 2001). The cluster tree provided
by Xie et al. (2000) illustrates a close relationship
between R. omeimontis and R. chaochiaoensis , as well
as a close relationship between R. zhenhaiensis and R.
chevronta.
The Culai frogs once reported as new province
record under Rana japonica (Wang et al. 1997), but R.
japonica was replaced by R. zhenhaiensis by Ye, Fei and
Matsui (1995). Here we treated it as a new species with
some difference from other related species in the group
and it maybe close to R. zhenhaiensis and omeimontis
(Fig. 4; Table 2). As allopatric to its congeners, it shows
the same case of as Rana chevronta and R. kunyuensis.
Material examined. -
Rana chaochoensis from CIB (n = 70). (males)
68
Asiatic Herpetological Research, Vol. 1 1
2008
Table 2. Comparisons between Rana culaiensis and its allies.*
* data of Rana chaochiaoensis , R. omeimontis and R. zhenhaiensis cited from Xie et al. (2000).
CIB37841,
CIB3785 1,
CIB37859,
CIB37873,
CIB37860,
CIB37876
CIB37842,
CIB37852,
CIB37866,
CIB37877;
CIB37862,
id CIB84495
CIB37847, CIB37850,
CIB37855, CIB37857,
CIB37867, CIB37870,
(females) CIB378853,
CIB37869, CIB37874,
from China, Sichuan
Province, Zhaojue County (as Chaocho formerly, type
locality), (males) CIB37643, CIB37683, CIB37703;
(females) CIB37641, CIB37642, CIB37644, CIB
37681, CIB37699, CIB37700 and CIB37707 from
China, Sichuan Province, Yuexi, Mianning, and
Yanyuan Counties, (males) CIB37712, CIB37713,
CIB37715, CIB37723, CIB37731, CIB37734,
CIB37735, CIB377747, CIB37748, CIB37754,
CIB37755, CIB37756, CIB37758, CIB37760; (females)
CIB37720, CIB37721, CIB37724, CIB37725,
CIB37773 and CIB37777 from China, Guizhou
Province, Weining County, (males) CIB37796,
CIB37799, CIB37798, CIB37801, CIB37802,
CIB37803, CIB37804, CIB37805, CIB37806, (females)
CIB37786, CIB37787, CIB37788, CIB37790,
CIB37792, CIB37793 and CIB37830 from China,
Yunnan Province, Kunming City, (males): CIB37840,
CIB37839 and (female) CIB37838 from China, Yunnan
Province, Lijiang County.
Rana chevronta from CIB (n = 1): (male) CIB65I0028
from China, Sichuan Province, Mt. Omei (type locality).
Rana omeimontis from SYNU (n = 8): (males)
SYNU050274, SYNU050275, SYNU050278,
SYNU06080522, SYNU06080523; (females)
SYNU050276, SYNU050277 and SYNU050279 from
China, Sichuan Province, Omei Mt (type locality).
Rana zhenhaiensis from SYNU (n = 18): (males)
SYNU050267, SYNU050268, SYNU05027 1 ,
SYNU06020126, SYNU06040129, SYNU06040130,
SYNU06040131, SYNU06040132, SYNU06040133’,
SYNU06040134, SYNU06040135; (females)
SYNU050269, SYNU050270, SYNU050272,
2008
Asiatic Herpetological Research, Vol. 1 1
69
SYNU050273, SYNU06020127, SYNU06020128 and
SYNU06040136 . China, Zhejiang Province, Beilun
region (formaerly Zhenhai county, type locality).
Acknowledgments
This study was supported by the Natural Science
Foundation ot China (grant no. 30470206 to Pipeng Li).
We wish to thanks G. F. Wu and H. Zhao, as well as to
my graduated students W. Wang., P. W. Wang and X. Z.
Cui for their help in Field surveys.
Literature Cited
Che, J., J. F. Pang, E. M. Zhao, M. Matsui and Y. P.
Zhang. 2007. Phylogenetic relationships of the
Chinese brown frogs (Genus Rana ) inferred from
partial mitochondrial 12S and 16S rRNA Gene
Sequences. Zoological Science. 24:71-80.
Fei, L. 1999. Atlas of the Amphibians of China. Henan
Scientific and Technological Publishing House,
Zhengzhou, 432 pp.
Fei, L., C. Y. Ye, J. P. Jiang, F. Xie and Y. Z. Huang.
2005. An Illustrated Key to Chinese Amphibians.
Sichuan Publishing Group-Sichuan Publishing
House of Science and Technology. 340pp.
Gosner, K. L. 1960. A simplified table for staging anu-
ran embryos and larvae with notes on identification.
Herpetologica 16: 183-190.
Jiang, J. P. and K. Y. Zhou. 2001. Phylogenetic relation-
ships of Chinese brown frogs inferred from mito-
chondrial DNA sequence of the 12S ribosomal
RNA gene. Zoological Research 22: 27-32.
Kim, J.B., M. S. Min, S. Y. Yang and M. Matsui. 2002.
Genetic relationships among Korean brown frog
species (Anura, Ranidae), with special reference to
evolutionary divergences between two allied
species Rana dybowskii and R. huanrenensis.
Zoological Science 19: 369-382.
Li, A., Y. Y. Lu and P. P. Li. 2005. Distribution of wood
frogs in China. Sichuan Journal of Zoology 25:
268-270.
Li, P. P. 2006. The labial tooth row formula of tadpoles.
Sichuan Journal of Zoology 25: 414-416.
Li, P. P., Y. Y. Lu, A. Li and X. H. Liu. 2006. Natural his-
tory studies of Chinese endemic amphibians: 1 . Life
history of wood frogs in Shandong province.
Sichuan Journal of Zoology 25: 340-343.
Li P. P., Y. Y. Lu, W. Wang, P. W. Wang, D. S. Fang and
J. Li. 2005. Diversity of brown frogs around Bohai.
Herpetologica Sinica 10:63-67.
Liu, C. C. 1946. A new wood frog from West China,
Rana chaochiaoensis, with a discussion of its allied
species. Journal of West China Border Research
Society 16(B): 7-14.
Liu, C. C. and S. Q. Hu. 1961. Tailless Amphibians of
China. Science Press, Beijing. 364pp.
Lu, Y. Y. and P. P. Li. 2002. A new wood frog of the
genus Rana in Mt. Kunyu, Shandong Province,
China (Amphibia: Anura: Ranidae). Acta
Zootaxonomic Sinica 27: 162-166.
Lu, Y. Y. and P. P. Li. 2005. A brief review on the
advance of wood frog research in China with a dis-
cussion of the importance of studying wood frog
biodiversity around Bohai. Sichuan Journal of
Zoology 24: 271-275.
Lu, Y. Y, P. P. Li, W. Wang, P. W. Wang and X. Z. Cui.
2005. Species belonging to Rana longicrus species
group in Shandong Province. Sichuan Journal of
Zoology 24: 276-278.
McDiarmid, R. W. and R. Altig. 1999. Tadpoles. The
biology of anuran larvae. University of Chicago
Press, Chicago and London. 444pp.
Pope, C. H. and A. M. Boring. 1940. A survey of
Chinese amphibians. Peking Natural History
Bulletin 15: 13-86.
Tanaka, T., M. Matsui and O. Takenaka. 1996.
Phylogenetic relationships of Japanese brown frogs
(Rana: Ranidae) assessed by mitochondrial
cytochrome b gene sequences. Biochemical
Systematics and Ecology 24: 299-307.
Wang, S. A., Y. P. Cao and M. L. Wu. 1995. The amphib-
ian fauna and zoogeographic division of Hebei
province, including Beijing and Tianjin
Municipalities. Herpetological Series 8: 57-62.
Wang, X. C., Z. L. Wang, C. Y. Zhang and Z. X. Jia.
1997. A new record of Ranidae from Shandong
70
2008
Asiatic Herpetological Research, Vol. 1 1
Province — Rana japonica japonica. Cultum
Herpetologica Sinica 6-7: 273.
Xie, F., L. Fei and C. Y. Ye. 2000. On taxonomic status
and relationships of Rana japonica group, in China
(Amphibia: Anura: Radidae). Cultum
Herpetologica Sinica 8: 74-80.
Yang, X. G., Y. Q. Wang, K. Y. Zhou and Z. Q. Liu.
2001. Phylogenetic relationships of Chinese brown
frogs (Rana) based on sequences from the mito-
chondrial cytochrome b gene. Zoological Research
22: 345-350.
Ye, C., L. Fei and S. Q. Hu. 1993. Rare and Economic
Amphibians of China. Sichuan Science and
Technology Publishing House, Chengdu. 412pp.
Ye, C. Y., L. Fei and M. Matsui. 1995. Taxonomic study
on Chinese Rana japonica. Acta Herpetologica
Sinica 4-5: 82-87.
Zhao, E. M., H. W. Chang, H. Zhao and K. Adler. 2000.
Revised Checklist of the Chinese Amphibia and
Reptilia. Sichan Journal of Zoology 19: 196-207.
Submitted: 13 September 2006
Accepted: 25 November 2007
2008
Asiatic Herpetological Research, Vol. 1 1
pp.71-75
The Tadpole of A Little-known Frog, Rana tormotus Wu, 1977
Pipeng Li*, Yuyan Lu, Ang Li and Lina Yu
Herpetodiversity Research Group, Shenyang Normal University, P. R. China 110034.
* Corresponding author E-mail: [email protected]
Abstract.- The tadpoles of a Chinese endemic and rare frog, Rana tormotus were collected from the type locality and
reared with other coexisting tadpoles of Paa spinosa, Rana schmackeri and Amolops wuyiensis in comparison. The
tadpole of Rana tormotus is small (about 27 mm in total length) and brown to slightly olive in color. Its body is ovoid
in dorsal view, widest at about midpoint, depressed and elliptical in lateral view. Body length is nearly one-third ol
total length. Lateral line pores are visible on the body and tail. No glands (such as ventral and dorsal glands in tadpoles
of genus Amolops) are visible. The snout is round, slightly flatted in dorsal profile, and rounded in lateral and ventral
profiles. Eyes directed dorsolaterally with diameter 31% of body height, closer to tip of snout than eye. Spiracle is
short and sinistral posteriorly. Tail approximately 2.1 times body length. Tail fins convex and approximately fusiform.
Tail tip is V-shaped or narrowly rounded. Vent tube is dextral and attached to ventral fin.
Oral disc is large and anteroventral in position. Labial tooth row formula 5(2-5)/4(l). Upper jaw sheath is finely
serrate and narrow, lower jaw sheath is finely serrate and shallowly V-shaped. No abdominal sucker was observed
behind the oral disc. It is similar to those of Rana andersonii and R. schmackeri in shape and oral disc characters.
From the characters of the tadpole of Rana tormotus, it does not belong to the Amolops type. It should be placed
in the genus Rana {sensu lato ) as Rana tormotus firstly or placed in a new genus (as Wurana by Li et al. [2006]) by
further analysis.
Keywords.- Amolops tormotus, Rana tormotus , Wurana tormota, tadpole, sunken ear frog, concave-eared torrent frog.
Introduction
Rana tormotus Wu, 1977 is an arboreal frog in the fam-
ily Ranidae found in the mountain streams of the Anhui
and Zhejing Provinces of Eastern China (Sichuan
Institute of Biology (Wu, G. F.), 1977; Zhao and Adler,
1993). This frog has an interesting characteristic: the
males warble melodies like a bird in order to attract
females (Feng et al., 2002), calling nightly from the low
vegetation along the banks of rivers and streams. Their
vocal repertoire is extraordinarily rich; individual calls
exhibit multiple upward and downward frequency
sweeps, rapid frequency “steps,” and sudden onset and
offset of selective harmonic components within a note
(Feng et al., 2002; Peter et al., 2004). This is the first
species of frog known to use diverse rising and falling
modulations - most frog calls only go either up or down.
These calls are also the first terrestrial frog noises
known to extend into the ultrasonic range (Feng et al.,
2002; Peter et al, 2004). Both of these phenomena are
related to the frog’s unique ear.
This frog, which is called the “sunken ear frog” or
“concave-eared torrent frog” in Chinese, has a conspic-
uous character that makes it different from most other
frogs: the males have visible ear canals leading to
eardrums within the skull, similar to Amolops cavitym-
panum Boulenger (Sichuan Institute of Biology [Wu G.
F.], 1977; Feng et al., 2002; Fei et al., 1991, 2005). Fei
et al. (1991, 2005) and Dubois (1992) placed this species
in Amolops because its tadpole might “belong to [the]
Amolops type” (Fei et al., 1990 (1991); Zhao and Zhao,
1994). Because the tadpoles have never been recorded,
however, it has been argued that this species should
instead be assigned to "Rana" (Zhao and Zhao, 1994;
Zhao et al., 2000; Global Amphibian Assessment, 2005).
Here, for the first time, we describe the tadpole of
this little-known species of frog and provide information
on its natural history. The importance of these findings
lies in the necessity for larval characters in anuran clas-
sification (Chou and Lin 1997), and may allow for clar-
ification of the uncertain position of Rana tormotus in
relation to Rana and Amolops.
Materials and Methods
Field work was conducted in a small stream of
Longjiang Forest, Zhejiang Province (China), and the
type locality of Taohuaxi stream in the Huangshan Mts,
Anhui province. Field studies were done from June to
August 2005.
The tadpoles of Rana tormotus Wu, 1977, Paa spin-
osa (Daivd, 1875), Rana schmackeri Boettger, 1892 and
A. wuyiensis (Liu and Hu, 1975) were observed and
sampled in Taohuaxi, a permanent stream. Some tad-
© 2008 by Asiatic Herpetological Research
72
Asiatic Herpetological Research, Vol. 1 1
2008
poles ol R. tormotus and R. schmackeri were reared until
stages 36-38 (Gosner, 1960) for description, or through
metamorphosis to confirm their identification and to
describe and compare adult coloration. Tadpoles were
raised in captivity in a plastic box (260 x 175 x 160 mm)
with 1.5 L ot water. Egg yolk and vegetable leaves were
provided regularly. The tadpoles were preserved in 5%
formalin. This material, together with adult voucher
specimens, is deposited in the collections of Shenyang
Normal University.
Tadpoles were staged according to Gosner (1960).
Tadpoles in stage 38, included both reared and freshly
captured specimens, were used in the descriptions and
measured. No changes were observed in the oral mor-
phology or general shape of reared tadpoles.
Measurements, terminology, and labial tooth row formu-
la follow Altig and McDiarmid (1999); labial tooth row
formula also follows Dubois (1995).
All measurements were taken with a digital caliper
(0.01 mm) and a stereomicroscope, except for total
length, which was measured directly with a hand caliper.
Drawings were made with the aid of a camera lucida
attached to a stereomicroscope. The photographs were
taken with a Nikon D100 camera.
Measurements are abbreviated as follows: BL
(body length), TL (total length), TaL (tail length), BW
(maximum body width), BH (maximum body height),
TH (height of tail), DFH (dorsal fin height), VFH (ven-
Figure 1. Standard morphometric measurements for tad-
poles used in this study.
tral fin height), SO (snout-ocular axis distance), SN
(snout-nasal axis distance), E (eye diameter), IN
(intemarial distance), IO (interorbital distance), SS
(snout-spiracle distance), ODW (oral disc width).
Standard measurements are shown in Figure 1.
Decription of external morphology at stage 38.- The
mean measurements and standard deviations of eight
tadpoles in stage 38 are shown in Table 1. Mean total
length at stage 38: 27±1.07 mm (n = 8; Table 1). Body
ovoid in dorsal view, widest at midpoint, depressed and
elliptical in lateral view; lateral part of marginal papillae
of oral disc slightly visible; Body length nearly one-third
(32%) of total length, body 1.5 times longer than wide,
2.1 times longer than high, 1.4 times wider than high.
Lateral line pores (neuromasts of caudal, dorsal,
supranaso-orbital, infranaso-orbital, lateral, mental,
postgular, postspiracle and pregular lines) visible on
body and tail. No glands visible. Snout rounded, slightly
flatted in dorsal profile, rounded in lateral and ventral
profiles; eyes moderate, not part of dorsal profile, direct-
ed dorsolaterally, diameter 31% of body height, separat-
ed by distance about 2.8 times eye diameter; interorbital
distance 88% of body width; nostrils directed dorsolat-
erally, closer to tip of snout than eye, intemarial distance
60% of interorbital distance.
Spiracle sinistral, short, posterior, opening slightly
above midline at about 5/7 of body length, directed pos-
terodorsally at about 15°, lateral wall longer than medial
wall, inner wall confluent with body, wall forming
around aperture.
Tail approximately 2.1 times body length and 3.0
times body width, maximum height 28% of tail length,
maximum tail height at end of first third of tail length.
Tail musculature highest at base, slightly higher than
dorsal and ventral fins, gradually tapering to pointed tip,
weakly developed. Tail fins convex and approximately
fusiform. Dorsal fin originates from tail muscle (the pos-
terior edge of the first section) near tail-body junction,
tallest just past to midpoint; ventral fin of nearly equal
height throughout its length; dorsal fin height E3 times
ventral fin height at highest point. Tail tip V-shaped or
narrowly rounded; vent tube dextral, short, attached to
ventral fin.
Oral disc large, anteroventral in position, width
about 0.73 times distance between eyes and approxi-
mately 45% of body width, emarginate laterally, with
single row of truncate marginal papillae in lateral poste-
rior margin of upper lip and wide rostral gap, two rows
of completely marginal papillae on lower lip but bases of
papillae originate in same line; rostral gap equal in
length of A-l. No lateral submarginal papillae. Labial
tooth row formula 5(2-5)/4(l) and l:4+4/l+l:3 (follow-
ing Dubois [1995]); A-l and A-2 longest, slightly longer
2008
Asiatic Herpetological Research, Vol. 11
73
Table 1. Mean measurements and standard deviation
(mm) of eight tadpoles in stage 38 of Gosner (1960).
than all other rows and similar in length, A-2 gap nar-
row, length of row becoming progressively shorter from
A-3 to A-5 (A-5 22% length of A-2); P-2 and P-3 equal
in length and longer than P-1 and P-4 (80% P-2); A-2
gap narrower than P-1. Labial teeth small, blunt and
devoid of cusps; longest at middle of row, teeth becom-
ing progressively smaller from PI to P4, but equal in P2
and P3, teeth of A i smaller than A2 and those of A2
equal. Jaw weakly developed. Upper jaw sheath finely
serrate, narrow, width slightly less than width of lower
jaw; lower jaw sheath finely serrate, shallowly V-
shaped.
From stage 26 onward, labial tooth row formula sta-
bilizes with very small variation in some specimens.
Larval denticles disappear after disappearance of vent
tube. Tadpole matching Orton’s Type-IV category
(Orton, 1953): oral disc elaborate and spiracle sinistral.
In preserved specimens, dorsal surface of body dark
brown; gut and heart visible ventrally, not visible later-
ally; anterior half of ventral part of body pale brown
with dark brown spots on sides, and abdominal region
whitish without dark brown spots. Coloration of muscu-
lar part of tail similar to that of body in reticulated pat-
tern. Tail fins with small brown spots.
In life, tadpole body coloration dark-brown with
head pale brown. Pupil of eye round, black, and
enclosed by narrow sliver ring.
Natural history notes.- Relative to the size of the adult
(male 35 mm, female 48 mm), the tadpole is small. If the
tadpole had not been reared to adulthood, it would have
been difficult to believe that the tadpole and frog were of
the same species.
The tadpoles gathered in groups in the small stream,
and were found to swim freely among small stones
where there was no swift water current or side pools that
were poorly connected with the main permanent stream
at night. During the daytime, the tadpoles hid under
stones and were rarely seen. The tadpoles were noctur-
nal and used their sites for grazing, avoiding areas with
silty sediment and fast water flow. The large oral disc
and numerous blunt rows of teeth suggested a greater
capacity for grazing than for suspension feeding.
The color of the tadpoles camouflaged them against
the small stones and sand on the bottom of the stream
where they spent the day. Although collected from a
mountain stream, the tadpoles were able to live in their
jars for a long time, sometimes in good condition after
three day’s travel. After 40 days of captivity, the larvae
completed metamorphosis and became froglets similar
to the adult in body shape and coloration. The biggest of
the tadpoles was less than 30 mm in total length.
Froglets were 11.4 mm (10-11.6 mm, n = 5, SD = 0.73)
from snout to vent just after metamorphosis.
The frogs and larvae that were found coexisting
with Rana tormotus in the stream were Paa spinosa
Figure 2. Rana tormotus tadpole at stage 38 (Gosner,
I960), (A) Dorsal view, (B) Lateral view, (C) Ventral View',
(D) Oral disc.
74
Asiatic Herpetological Research, Vol. 1 1
2008
(Daivd, 1875), Rana schmackeri and A. wuyiensis (Liu
and Hu, 1975). While the tadpole of R. schmackeri was
similar to R. tormotus in shape, coloration and general
oral disc characters, the other two appeared conspicu-
ously different.
Although Rana schmackeri also had a small tadpole
belonging to Orton’s Type-IV category (Orton, 1953), it
was larger than the tadpole of Rana tormotus. The total
length of R. schmackeri tadpole was more than 30 mm
from stage 35, while the maximum total length of the R.
tormotus tadpole was less than 30 mm at any later stage.
At stage 36, the body and tail length was 11.1 mm and
20.25 mm for R. schmackeri, and 8.36 mm and
18.83mm for R. tormotus. At stage 44, the back of R.
schmackeri became greenish, and after metamorphosis,
yellow patches appeared on the back.
The tadpole of Amolops wuyiensis was also of the
small type, but the ventral suctorial disc easily identified
it. This species was found at the edge of side water-bod-
ies of the stream with little current. The tadpole used the
suctorial ventral disc to adhere to the rocky substrata to
overcome the stream’s water current.
The tadpole of Paa spinosa is of the big type, and is
found alone or in groups of a few individuals at the bot-
tom of pools beside or below cascades and gently flow-
ing parts of the Taohuaxi stream. The oral disc of this
species is emarginate, with two rows of marginal papil-
lae, lateral submarginal papillae and a strong beak. The
most conspicuous character of the tadpole is a gray or
black band at the base of tail. The labial tooth row for-
mula is 5(2-5)/3(l).
Discussion of taxonomic status.- Examination of the
tadpole of Rana tormotus reveals that it is not of the
“ Amolops type”, because there is no abdominal sucker
and no ventral or dorsal glands (Yang, 1991). The tad-
pole of this species is more similar to that of Rana
andersonii (Liu, 1940) and O. schmackeri in shape and
oral disc morphology, but the tadpole and froglet just
after metamorphosis is smaller, differently shaped, and
without green or yellow back patches.
The body and tail length of the Rana andersonii tad-
pole averaged 12.27 mm (12-12.5 mm, n = 3) and 26.27
mm, and the froglet 12.7 mm (Liu, 1940). Four days
after metamorphosis, uneven green patches appeared on
the back (Liu, 1940).
While the larvae are similar in appearance, the
adults of odorous frogs and Rana tormotus are remark-
ably different in morphology, with the sunken ear and
absence of odor gland cells in the skin of R. tormotus
being most the notable characters.
Based on the above evidence, this species should
either be left to Rana as Rana tormotus, or placed in the
new genus as Wurana tormota, although further study is
needed.
Acknowledgments
We are grateful to Prof. Gu H. Q., Dr. Lu S. Q., Mr. Tang
X. S. and Ms. Zhao H. for their field working help. This
research was supported by China National Nature
Science Foundation and Special Invited Professor Grand
of Shenyang Normal University to Dr. Pipeng Li.
Literature Cited
Altig, R. and G. F. Johnston. 1989. Guide of anuran lar-
vae: relationships among developmental modes,
morphologies and habitats. Herpetological
Monographs 3: 81-109.
Altig, R. and R. W. McDiarmid. 1999. Diversity: famil-
ial and generic characterizations. In R. W.
McDiarmid and R. Altig (eds). Tadpoles: The
Biology of Anuran Larvae. Pp 259-337. Univ. of
Chicago Press, Chicago.
Chou, W. H. and J. Y. Lin. 1997. Tadpoles of Taiwan.
Special Publication - National Museum of Natural
Science 7: 1-98.
Dubois, A. 1992 Notes Sur la classification des Ranidae
(Amphibiens Anoures). Bull. Mens Soc. Linn. Lyon
61(10): 305-352.
Dubois, A. 1995. Keratodont formula in anuran tad-
poles: proposals for a standardization. Journal of
Zoological Systematics and Evolutionary Research
33: 1-15.
Fei, L, C. Y. Ye. and Y. Z. Huang. 1990 (1991). Key to
Chinese Amphibia. Pp 124-126, Chongqing Branch,
Science and Techinology Literature Publishing
House, Chongqing.
Fei, L., C. Y. Ye., J. P. Jiang., F. Xie. and Y. Z. Huang.
2005. An illustrated Key to Chinese amphibians.
Sichuan Publishing Group-Sichuan Publishing
House of Science and Technology, Chengdu.
Feng, A. S., P. M. Narins and C. H. Xu. 2002. Vocal
acrobatics in a Chinese frog, Amolops tormotus.
Naturwissenschaften. 89(8): 352-6. Epub 2002 Jun
22.
Global Amphibian Assessment. 2005. Global
Amphibian Assessment - Detailed Report: Amolops
tormotus. In: http://www.globalamphibians.org/ser-
vlet/GAA?searchName=Amolops+tormotus
2008
Asiatic Herpetological Research, Vol. 1 1
75
Gosner, K. L. 1960. A simplified table for staging anu-
ran embryos and larvae with notes on identification.
Herpetologica 16:183-190.
Liu, C. C. 1940. Tadpoles of Western China Salentia. J.
West China Border Res. Soc., 12(B): 7-62.
Narins, P. M., A. S. Feng, W. Y. Lin, et al. 2004. Old
World frog and bird vocalizations contain promi-
nent ultrasonic harmonics. J. Acoust. Soc. Am.
115(2): 910-913.
Sichuan Institute of Biology (Wu, G. F.) 1977. A new
species of frogs from Huang-Shan, Anhui - Rana
tormutos Wu. Acta Zoologica Sinica, Beijing,
23(1): 113-115.
Yang, D. T. 1991. Phylogenetic systematics of the
Amolops group of ranid frogs of Southeastern Asia
and the Greater Sunda Islands. Fieldiana: Zoology,
Chicago (USA), new ser., No. 63: 1^12.
Zhao, E. M., and K. Adler. 1993. Herpetology of China.
Published by the Society for the Study of
Amphibians and Reptiles in cooperation with the
Chinese Society for Study of Amphbians and
Reptiles. Oxford, Ohio, USA.
Zhao, E. M., H. W. Chang, and X. L. Zhao. 2000.
Taxonomic bibliography of Chinese amphibia and
reptilia, including karyological literature.
Kaohsiung Fu-Wen Publishing Co. Ltd, Taiwan.
Herpetological Series 11: 215-238.
Zhao, E. M. and H. Zhao. 1994. Chinese Herpetological
Literature - Catalogue and Indices. Chengdu
Science and Technology University Press,
Chengdu.
Submitted: 03 March 2006
Accepted: 25 November 2007
pp. 76-79
Asiatic Herpetological Research, Vol. 1 1
2008
A Brief Report on the Life History of Batrachuperus taibaiensis
at Ping He Liang of Tsinling Mts.
Pipeng Li*, Yuyan Lu and Ang Li
Liaoning Key Laboratory of Biodiversity and Evolution, Shenyang
Normal University, Shenyang 110034, R R. China.
* Corresponding author E-mail: [email protected]
Abstract.- Batrachuperus taibaiensis is a high-mountain, stream salamander endemic to China, and compared to con-
geners, is more northeastern in distribution and found at lower elevations. The distribution, life history and measure-
ments of the larva and adult of this species were recorded from 2005 to 2006 at Ping He Liang of Tsinling Mts. The
life history of the genus is discussed in the context of refining species definitions for those Batrachuperus found in
the Tsinling Mts. Past surveys carried out in Tsinling Mts found several different Batrachuperus species and there is
a need to clarify which species really exist. The distribution of Batrachuperus taibaiensis is discussed in the paper.
Keywords .- Life history, stream salamander, Batrachuperus taibaiensis.
Introduction Materials and Methods
Much of the taxonomy and phylogeny of the Chinese
Amphibia remain unresolved, as is much of the knowl-
edge on their basic natural history, generally because
observations on natural history are not considered to be
worthy of publication and the gathering observations is
often time intensive (Greene, 1993). Nevertheless, these
observations may contribute to phylogenetically inform-
ative characters (de Queiroz and Wimberger, 1993) and
data critical for developing conservation and manage-
ment strategies (Mendelson et al., 1999).
The high-mountain stream salamanders, genus
Batrachuperus Boulenger, 1878, contains seven species
that occur in Western China and adjacent Myanmar
(Frost, 2007). The natural history of the species in this
genus remains largely unknown or unpublished because
individuals generally hide under stones in small moun-
tain streams at high altitude, although reports on the
common species B. pinchonii (David) have been made
by Liu (1945).
Recently, one new species ( Batrachuperus
taibaiensis) was found in the upper Heihe River in the
Tsinling Mts. of Shaanxi Province, China. Compared to
congeners, this salamander is more northeastern distri-
bution and found at lower elevations (Song et al., 2001).
During collecting trips (1987-2005) along the rivers and
streams of Ping He Liang, the senior author collected
several B. taibaiensis and collected data on their natural
history. The following is a brief excerpt from the results
of a series of herpetological surveys made from 2005 to
2006.
Amphibian surveys were made on the south side of the
Tsinling Mts. (33° 36' N, 108° 28' E, 1800-2000 m)
between Huo Di Tang and Xun Yang Ba of Ningshan
County, Shaanxi province, China, from April 2005 to
June 2006. Ping He Liang reaches an altitude of 2160 m
at the National Way. Batrachuperus taibaiensis was also
surveyed at its type locality on the north side of the
Tsinling Mts in April 2005.
Adult specimens were stored in 10% formalin.
Larvae and egg cases were observed live in the lab.
Results
Identification.- Batrachuperus taibaiensis (Fig. 1) can
be separated from congeners by its relatively large body
size and lack of homy covers on the palms and tarsa.
Distribution.- The distribution of Batrachuperus
taibaiensis is concentrated in the upper part of two rivers
and their associated streams on the northern and south-
ern sides of Ping He Liang (Fig. 1). The pH of the water
was somewhat acidic (pH = 5. 5-6.0). Specimens were
found under rocks in river headwaters and streams in the
study area 2-3 km from the top of Ping He Liang (above
1800 m).
In the streams and rivers where Batrachuperus
taibaiensis was found, adults of a number of other
amphibians occurred: Ranodon tsinpaensis Liu and Hu,
Bufo gargarizans Cantor, Ran a chensinensis David, Paa
quadrana (Liu, Hu and Yang), Bufo andrewsi Schmidt.
Tadpoles of Bufo andrewsi and S. ningshanensis Fang
© 2008 by Asiatic Herpetological Research
2008
Asiatic Herpetological Research, Vol. 1 1
77
Figure 1. (A) Habitat of Batrachuperus taibaiensis. (B) Adult and larvae of B. taibaiensis from Ping He Liang. (C) and
(D) are egg cases of B. taibaiensis.
were also observed, the latter of which has its type local-
ity in the same region. Hyla tsinlingensis Liu and Hu,
another endemic Chinese amphibian, was found in near-
by ponds. Bufo gargarizans Cantor, Bufo andrewsi
Schmidt, H. tsinlingensis Liu and Hu, Rana chensinen-
sis David P. quadrana (Liu, Hu and Yang) and
Batrachuperus pinchonii were more widespread at
lower elevations near the study area.
The study area encompassed approximately 1 5 km2
of Subalpine conifer habitat covered with well-devel-
oped vegetation. The canopy often arched over the
rivers and streams.
Reproduction and growth.- The breeding season most
likely occurs from April to July, as the youngest larvae
with external gills and the most number of young sala-
manders in different stages of development were collect-
ed on August 3rd, 2005; young salamanders were not col-
lected after April 16th, 2005.
Egg-cases, previously unknown for this species,
were found adhered to the under-side of rocks in the
river in April 1 6lh, 2005. The body of the egg-case was a
curled columnar tube with tapered ends; the case was
smooth and almost entirely transparent with thin longi-
tudinal striations; fresh cases were the color of milk; for-
78
Asiatic Herpetological Research, Vol. 1 1
2008
Table 1. Measurements of Batrachuperus taibaiensis
(n=3)
A: larva just after hatching; B: developed larva; C: larva with fill shrivel-
ing
malin-fixed cases became brittle. The cup-like cap at the
free end of the case was more soft and delicate than the
remainder of the case (Fig. 1). Cases were 15.0-17.0
mm in length with a diameter of 18.0-20.0 mm. There
were 27-29 eggs or embryos in each egg case. Egg
diameter was 5. 0-5. 5 mm.
Free larvae appeared at stream edges under small
stones at the beginning of August. The early larvae,
compared to developed larvae, juveniles and adults, in
that the color was lighter gray with the dorsum yellow-
ish-green and the venter yellowish; the dorsal pigment
faded after fixation. The forelimb of the early larva was
fully developed with four formed fingers; the fourth toe
bud appeared after formation of the first three toes. The
fore limbs developed earlier than the hind limbs. The
labial folds were well-developed and the pores of the lat-
eral line organ were visible on the head. Eyes were
small, black and covered with a transparent membrane;
eyelids were absent. Balancers were absent from the side
of head. There were four pairs of external gills (decreas-
ing in size posteriorly); the filaments of the last gill were
very short, white and hidden beneath the third gill; the
first to third gills resemble those of Batrachuperus pin-
chonii (Liu, 1945). The vertebral groove was distinct
along the length of the trunk. The tail was much higher
and shorter than that of the adult.
The developed larva was blacker than the younger
larva, and larvae with gill regeneration were nearly
black. Pores of the lateral line organs were more con-
spicuous in the head and shoulder regions. Eyelids were
well developed (as in Batrachuperus pinchonii [Liu,
1945]). Gill filaments were blacker and longer than
those seen in earlier larva, but shorter than larva with gill
regeneration. Fingers and toes were well-developed.
Fifteen specimens from various developmental
stages were measured (Table 1). Larval head length was
26.3%, 32.58% and 34.96% of total body length, while
adults head length was 23.91% in the male and 24.69%
in the female. Larval eye length was slightly larger than
that of adults.
Discussion
Need for clarification of Batrachuperus species in
Tsinling Mts.- Song (1983) and Yuan (1984) reported
Batrachuperus pinchonii from the Tsinling Mts. in Mao
Tai Zi, Liuba County, and Huo Di Tang Forest, Ningshan
County. Later, from 1985 to 1989, the senior author and
a colleague from Shaanxi Normal University collected
two species of Batrachuperus from Huo Di Tang and
Xun Yang Ba Forests, Ningshan County, which are on
the northern and southern slopes of the same Mountain:
B. pinchonii was collected at lower elevations while B.
tibetanus was collected at higher elevations (Li and
Fang, 1993 and unpublished data). At the same time,
Song collected a new species of Batrachuperus from
Zhouzi County - B. taibaiensis - which was supported
by sequence data from cytochrome b (Song et al., 2001).
Unfortunately, these species were either excluded (Fei et
al., 2005) or treated under incorrect names (Han and Lu,
2003; Zhang and Jia, 2002) in subsequent publications.
Batrachuperus occurs throughout the Tsinling Mts.,
extending to Foping, Zhouzi, Zashui and Ningshan
Counties. Batrachuperus taibaiensis has also been
found in Kangxian, Wenxian and Fenxian in Gansu
Province, as well as Liuba and Nanjiang in northern
Sichuan Province (Zeng, 2004); these identifications
were made using molecular techniques because it is
often difficult to identity species of Batrachuperus using
traditional methods (Zeng, 2004).
Based on what is now known about the biology,
morphology and distribution of Batrachuperus taibaien-
sis, we consider that all specimens of B. tibetanus col-
lected from the Tsinling Mts south to Shaanxi,
Southeastern Gansu and the North Sichuan Provinces
(such as Micanshan and Dabashan) are actually repre-
sentatives of B. taibaiensis. Considering this, the full
range of B. taibaiensis may actually extend as far as
southeastern Shaanxi Province and the Shenlongjia Mts
in northwestern Hubei Province. To corroborate these
assumptions, it will be necessary to re-examine previ-
ously collected specimens from these localities to verify
their identity. Further fieldwork and molecular analyses
will likely be necessary.
The need to focus on Batrachuperus life history.- The
high-mountain stream salamander Batrachuperus cur-
rently was considered to contain seven species that
occur in Western China and adjacent Myanmar (Frost,
2008
Asiatic Herpetological Research, Vol. 11
79
2007). Most of these species are restricted to China, and
B. tibetanus and B. pinchonii are significant in their use
as experimental animals in embryological, morphologi-
cal and ecological investigations (Li and Fang, 1993;
Xu, 1992, 1993; Zhang and Jia, 2002; Han and Lu,
2003; Fei et ah, 2005).
Excluding one report by Liu (1945) on
Batrachuperus pinchonii, little data on life history has
previously been available for species in this genus.
Limited notes on B. longdongensis Liu and Tian, 1978,
B. cochranae Liu, 1950 and B. yenyuanensis Liu, 1950
have also been published for populations in White-drag-
on-pool at Chin-ting (Jinding) of Mt. Omei, Pao-hsing-
hsien (Baoxing County), Yen-yuan-hsien (Yanyuan
County) and Tien-shui (Tianshui) and Sia-ho (Xiahe)
Counties of Gansu Province. Data from Fei et al. (2005)
are also useful for understanding the biology of these
native animals.
Here we have reported additional life history data
for a new species in the genus, Batrachuperus taibaien-
sis, one of the largest stream salamanders in China. The
tube-like egg case is longer and thicker than those in
other species, it is strongly coiled and contains more
(27-29) eggs. In comparison, the egg case of B. pin-
chonii is cylindrical and cayenne-shaped with 7-12 eggs
(Liu, 1945); the case of B. yenyuanensis is linear and has
6-13 eggs (Zhao and Yang, 1997). The larvae of this
species are also unique.
Acknowledgments
This research was supported by National Nature Science
Foundation of China (No:30470206) and Special Invited
Professor Grand of Shenyang Normal University to
Pipeng Li. We are grateful to Dr. Zeng Xiaomao sending
her unpublished Ph. D. dissertation, Prof. Wu G. F. and
Zhao H. for field help, and three anonymous reviewers
for their reviews and corrections of the manuscript.
Literature Cited
De Queiroz, A. and P. H. Wimberger. 1993. The useful-
ness of behavior for phylogeney estimation : levels
of homoplasy in behavioral and morphological
characters. Evolution , 47(1): 46-60.
Fei, L., C. Y. Ye., Y. Z. Huang., J. P. Jiang and F. Xie.
2005. An illustrated key to Chinese amphibians.
Sichuan Publishing Group, Sichuan Publishing
House of Science and Technology, Chengdu.
Frost, D. R. 2007. Amphibian species of the World. 5.0,
an Online Reference, http://research.amnh.org/her-
petology/amphibia/references.php?id-25385
Greene, H. W. 1993. What’s good about natural history.
Herpetological Natural History 1: 3.
Han, Y. P. and X. Y. Lu. 2003. Population Structure and
Conservation of Batrachuperus tibetanus in the
Tsinling Mountains. Chinese Journal of Zoology
38(2): 68-70.
Li, P. P. and R. S. Fang. 1993. Microstructural study of
skin and its gland on Bactrachuperus pichonii. Acta
Herpetologica Sinia, Guiyang 1-2: 15-18.
Liu, C. C. 1945. Natural history studies of West China
amphibian IX: Life history of Batrachuperus pin-
chonii (David). Journal of West China Border
Research Society 15(B): 44-55.
Mendelson, J. R., III., Ustach, P. C. and A. Nieto-
Montes de Oca. 1999. Description of the tadpole of
Bufo tutelarius, natural history notes on the Bufo
valiiceps group , and a key to the tadpoles of the
group. Journal of Herpetology 33 (2): 324-328.
Song, M. T. 1983. Batrachuperus pinchonii in Mt
Tsinling. Chinese Journal of Zoology 1 8(4): 1 3—
141.
Song, M. T., X. M. Zheng., G. F. Wu., Z. J. Liu and J. Z.
Fu. 2001. A new species of Batrachuperus from
Northwestern China. Asiatic Herpetological
Research 9: 6-8.
Xu, J. and J. C. Chen. 1992. A preliminary on the repro-
ductive ecology of the Batrachuperus tibetanus.
Chinese Journal of Zoology 27(5): 33-36.
Yuang, H. 1984. A herpetological survey in the
Huoditang forest of Tsinling Mountains. Acta
Herpetologica Sinica 2(1): 70-71.
Zhang, Y. H. and L. Z. Jia. 2002. Microstructure and
ultrastructure of vitellogenesis in oocytes of the
stream salamander ( Batrachuperus pinchonii). Acta
Zoologica Sinica 48(4): 534-542.
Zeng, X. M. 2004. The phylogenetic study of Western
hynobiids in China. Ph.D. Dissertation, East China
Normal University 2004 (2): 13 1-1 34.
Zhao, E. M and D. T. Yang. 1997. Amphibians and
Reptiles of The Hengduan Mountains region.
Beijing: Science Press.
Submitted: 19 September 2006
Accepted: 25 November 2007
pp. 80-84
Asiatic Herpetological Research, Vol. 1 1
2008 1
An Investigation of the Morphometric Characteristics of Eggs of the
Chinese Alligator (Alligator sinensis)
Wei Zhi Meng1, Xiao Bing Wu1’* and Lu Sheng Wu2
1 Anhui Province Key Laboratory for Conservation and Exploitation of Biological Resource, College
of Life Science , Anhui Normal University, 1 East Beijing Road, Wuhu 241000, China,
~ Division of Science and Technology, Jinan University, 601 Huangpu Avenue, Guangzhou 5 10632, China.
* Corresponding author E-mail: [email protected]
Abstract.- In this study we analyzed morphometric intraspacific differences in the eggs of the Chinese alligator,
Alligator sinensis, (egg mass, egg width and egg length). Data were collected for 1460 eggs from 40 clutches at the
Anhui Research Center for Chinese Alligator Reproduction (ARCCAR). Our results found that the mean clutch size
was 36.5 eggs, mean egg mass per clutch was 41.9 g, and clutch mass was 1519.7 g. We generated three regression
equations relating to relationships among egg width, length and mass. The average of clutch size in 2004 was much
higher than it was in 1985 as indicated by a two-sample t-test.
Keywords.- Egg shape index, egg length, egg width, egg mass, clutch size.
Introduction
Studies of the reproductive ecology of Alligator sinensis
are important for our understanding of its conservation
biology and status. Several studies about the reproduc-
tive ecology of Alligator sinensis are available and
include information on egg incubation in captivity (Gu
and Zheng, 1983; Liang and Pan, 1990), nest excavation
(Huang and Watanabe, 1986), the relationships between
egg hatching and environmental factors (Wang et al.,
2000) and captive breeding (Cheng and Wang, 1984;
Wang and Zhang, 2000; Xu et al., 1989). Egg character-
istics are important when examining reproductive ecol-
ogy, as has been illustrated in previous studies (Cariello
et al., 2004; Du, 2003; Huang et al., 2003; Reese, 2000),
but little of this research has been devoted to Alligator
sinensis. We herein record data on egg characteristics of
the Chinese alligator in the ARCCAR, and analyze these
characteristics to investigate intraspecific differences,
providing fundamental information for further study of
the influence of egg shape on hatching rate and quality
of young alligators.
Materials and methods
Measurements of eggs - A total 1460 eggs from 40
clutches were collected between 5 and 16 July 2004 at
the artificial breeding area of the ARCCAR. Eggs were
collected within 12 hours of laying and taken to a hatch-
ing room where their length and width were measured
with digital calipers (precision 0.01 mm). Egg mass was
taken using a scale (precision 0.1 g).
Statistical analysis.- We analyzed the morphological
characteristics of the eggs using the statistical software
SPSS (Version 10.0). Data on the distribution of egg
characteristics (including egg length, width, mass, egg
shape index [length/width], clutch size, clutch mass and
clutch mean egg mass) were analyzed using descriptive
statistics. The coefficient of variation (SD/Mean) was
used to study variation in egg characteristics. Regression
analyses were used to examine the correlation among
egg width, length and mass. Hoyt (1979) put forward an
empirical formula:
W = KWXY2
where Kw is the coefficient of mass, W is egg mass, X is
egg length, and Y is egg width.
Results
Descriptive statistics of the morphological characteris-
tics of the eggs of the Chinese alligator.- Table 1 pro-
vides descriptive statistics for the morphological charac-
teristics of the eggs examined. From the frequency dis-
tributions of these morphological characteristics
(Fig. 1), it is apparent that in most cases, egg length
ranges from 51.42 mm to 60.00 mm, egg width from
32.49 mm to 37.51 mm, egg mass from 33.34 mm to
48.33 mm, clutch mass from 1200 g to 1800 g, clutch
size from 30 to 45, and clutch mean egg mass from 35.0
g to 47.5 g.
The egg of the Chinese alligator usually has the
form of an elongate ellipse, although some eggs deviated
from this shape. From the frequency distribution of ego
© 2008 by Asiatic Herpetological Research
2008
Asiatic Herpetological Research, Vol. 1 1
81
Table 1. Descriptive statistics of the morphological characteristics of the eggs of Alligator sinensis.
shape index, it was evident that in most cases, egg shape
falls between 1.50 and 1.72.
Intraspecific difference of egg morphological charac-
teristics.- Since there were a high proportion of mal-
formed eggs in four of the 40 clutches, only the 36
remaining clutches were analyzed. Figure 2 shows the
CV (coefficient of variation) of egg morphological char-
acteristics, indicating morphological variation among
eggs of the same clutch.
There were differences in variation among the mor-
phological characteristics of the eggs laid by different
females. The CV of egg morphological characteristics
were calculated from Table 1 , revealing that variation in
egg mass (CV = 0.18) and clutch size (CV = 0.17) were
the greatest.
The correlations among the CV of egg morpholog-
ical characteristics were analyzed using a Pearson corre-
lation analysis (Table 2). Table 2 indicates that the CV of
the egg shape index had a significant positive correlation
with the CV of egg width. The CV of egg mass had a
significant positive correlation with the CV of egg
length.
Correlations of egg length, egg width and egg mass.-
Data (including egg length, width and mass) collected
from 1445 eggs (malformed and broken eggs not includ-
ed) were used to generate scatter plots. These plots indi-
cated that both egg width and length had a positive cor-
relation with mass, while length was negatively correlat-
Table 2. Pearson Correlations of CV of four egg morpho-
logical characteristics.
** Correlation is significant at p < 0.01 (2-tailed).
ed with width. In order to obtain the exact correlation
between the two parameters, the influence of other
parameters was eliminated by using a partial correlation
analysis. The results showed that egg length had a sig-
nificant positive linear relationship with egg mass
(r = 0.875, p < 0.00 1 ); egg width had a significant posi-
tive linear relationship with egg mass
(r = 0.856, p < 0.001); and egg width had a significant
negative linear relationship with egg length (r = -0.638,
p< 0.001).
Linear regression analysis was used to analyze the
relationships between egg width (Fig. 4), length, and
mass (Fig. 3). Two regression equations were generated
(1) W = -29.855 + 1.265 XL
R2 = 0.681, p < 0.001; df= 1443
(2) W = -53.078 + 2.699 Xw
R2= 0.637, p< 0.001; df= 1443.
Where W is egg mass (g), XL is egg length (mm), Xw is
egg width (mm).
We were able to approximate the original egg mass
from data about egg width and length using the two
equations.
In order to estimate egg mass (W) more exactly, we
used the empirical formula given by Hoyt (1979) to
derive another regression equation. From the scatter
plots of egg mass and the volume (V) of the cube
approximately the volume of the egg (egg width X egg
width X egg length), it is evident that egg mass had a sig-
nificant positively correlation with the volume of this
cube. Linear regression analysis (Fig. 5) yielded the fol-
lowing equation expressing the relationship between egg
mass and volume:
(3) W= 1.656 + 0.00057V
R2 = 0.928, p < 0.001; df= 1443,
where V = XLXW2, so the final equation is:
82
Asiatic Herpetological Research, Vol. 1 1
2008
(a) Egg length (mm)
(b) Egg width (mm)
(c) Egg mass (g) (d) Egg shape index
(e) Clutch mass (g) (f) Clutch mean egg mass (g)
Figure 1. Frequency distributions of egg morphological
characters of Alligator sinensis.
(4) W = 1 .656 + 0.00057XlXw2,
p < 0.05). The data collected in 1985 were from the orig-
inal parent generation captured from the wild, which is
no longer breeding, leaving the FI generation to consti-
tute the dominant portion of the breeding population
(Wu et al., 1999, 2005). Many reproductive characteris-
tics of squamate reptiles are fictile, clutch size being one
of them. In the wild, adult alligators must face pressures
relating to natural selection potentially reducing their
full reproductive potential, but in the ARCCAR, the
nutrition of the alligators is regulated by artificial diets,
maximizing their reproductive potential. One way to
quantify this potential is to examine egg morphological
characteristics, which are directly influenced by nutri-
tion.
Egg width and length data can be collected easily,
but data on egg mass are more difficult to obtain because
some eggs might break while the female alligator pro-
tects her clutch, or if it is usurped by other females.
Furthermore, there is variation in egg mass during incu-
bation (Wang and Zhang, 2000). In bird species exam-
ined in the wild, investigators have correlated egg
weight, width and length (Hoyt, 1979; Zhao and Ma,
1997; Zhou, 1994) in order to calculate egg mass. The
regression equations (1), (2), and (4) established in this
study have been found to accurately estimate the origi-
nal egg mass from data on egg width and length, provid-
ing an efficient means of measurement that can also be
applied to the mass of recently-hatched young alligators
if only the eggshell is available. This information subse-
quently be used to estimate the constitution of the young
alligators, gain basic information on wild populations,
and develop a sound basis for investigation of wild pop-
ulations. We conducted an analysis of variance test
(ANOVA) to determine whether the egg masses predict-
ed by the three equations differed from actual observa-
tions. The results showed no significant differences
(F = 0.891,/? > Poos), illustrating that all three equations
can be used to calculate egg mass, although the accuracy
of equation (3) (R2 = 0.928) is higher than that of the
other two [(1) (R2= 0.681); (2) (R2 = 0.637)].
where W is egg mass (g), XL is egg length (mm) and Xw
is egg width (mm).
Discussion
In 1985 it was recorded that the clutch size of Chinese
Alligators at the ARCCAR, based on 29 clutches, was
26.2 (SD = 3.9; n = 29) (Xu et al, 1989). Means of
clutch sizes in 1985 and 2004 were compared by a two-
sample t-test, revealing that the average clutch size in
2004 was much higher than it was in 1985 (t = 7.77,
0.60-
c
o
+5 0.50 H
2
> 0.40 H
■ Egg shape index
■ Egg length
□ Egg width
□ Egg mass
..... , -MMMWMUUy
Case Number
Figure 2. Coefficient of variation of egg morphological
characteristics.
2008
Asiatic Herpetological Research, Vol. 1 1
83
60.00-
3
^ 50.00-
</>
f3
E
240.00
G)
LU
30.00
45 .00 50 .00 55 .00 60 .00 65 .00 70 .00 75 .00
R Sq Linear = 0.681 '
Egg length (mm)
Figure 3. The relationship between egg mass and length.
Egg width (mm)
Figure 4. The relationship between egg mass and width.
Figure 3. The relationship between egg mass and length.
Though selection females produce progeny of a cer-
tain size that are able to escape natural enemies and
obtain food efficiently. Compared to progeny size, the
number of progeny should show larger variation within
a single brood (Lin and Ji, 2004). The results of this
study suggest that the CV of egg mass (0.12) is smaller
than the CV of clutch size (0.17), meaning that clutch
size in the Chinese alligator exhibits greater variation
than does egg mass.
Egg shape index can be used to describe the shape
of eggs. From Table 2 we conclude that the CV of egg
shape index has a significant positive correlation with
the CV of egg width. This suggests that, compared to
egg length, egg width has a greater influence on egg
shape. According to studies on the hatching rate of some
birds and reptiles (Fang et ah, 2004; Fang et al., 2001;
Zhu, 2002), egg shape had been found to be an impor-
tant variable in hatching rate, however, little research on
the relationship between egg shape and hatching rate has
been made, and is in need of further investigation.
Acknowledgments
This work was supported by National Natural Science
Foundation of China (NSFC, No. 30270213, 30470244),
the Foundation for Excellent Youth in Anhui Province
(04043409) and Key Laboratory of Biotic Environment
and Ecological safety in Anhui Province.
Literature Cited
Cariello, M. O., M. R. Lima, H. G. Schwabl and R. H.
Macedo. 2004. Egg characteristics are unreliable in
determining maternity in communal clutches of
guira cuckoos Guira guira. Journal of Avian
Biology 35: 117-124.
Chen, B. H. and C. L. Wang. 1984. [Artificial reproduc-
tion of Alligator sinensis]. Acta Herpetologica
Sinica 3(2): 49-54. (In Chinese)
Du, W. G., Y. P. Zhang and J. K. Liu. 2003. [Cluster
analysis on reproductive characteristics of the
grass lizard Takydromus septentrionalis )].
Journal of Zhejiang University 30(3): 323-326.
(In Chinese)
Fang, X. T., J. X. Feng and G. F. Dong. 2004. [Several
physical traits of Anser cygnoides eggs and goose
eggs]. Sichuan Journal of Zoology 23(2): 1 25—
128. (In Chinese)
84
Asiatic Herpetological Research, Vol. 1 1
2008
Fang, .T., J. F. Zhao, Y. J. Song, Y. Qian, Y. T. Zhu and
C. M. Wang. 2001. [Influence of egg shape index
on hatch rate in the eggs of silk fowl]. Journal of
Economic Animal 5(1): 44-A7. (In Chinese)
Gu, W. Y. and H. S. Zheng. 1983. [Preliminary reports
on the reproductive ecology of the Chinese alliga-
tor]. Acta Herpetologica Sinica 2(4): 72-74. (In
Chinese)
Hoyt D. F. 1979. Practical methods of estimating vol-
ume and fresh weight of bird eggs. Auk 96: 73-
77.
Huang, Z. J. and M. E. Watanabe, 1986. [Nest excava-
tion and hatching behaviour of the Chinese
Alligator and the American alligators]. Acta
Herpetologica Sinica 5(1): 5-9. (In Chinese)
Huang, W. H., S. Y. Zhou, K. W. Wang and X. M. Lian.
2003. [An investigation of the natural reproduc-
tive ecology of Pelochely bibroni ]. Jouranl of
Anhui University 27(1): 103-107. (In Chinese)
Liang, B. D. and H. T. Pan. 1990. [The effect of temper-
ature and humidity on the incubation of the
Chinese alligators]. Sichuan Journal of Zoology
9(3): 27-28. (In Chinese)
Lin, Z. H. and X. Ji. 2004. [Reproductive output and
effects of incubation thermal environments on
hatchling phenotypes of mucous rat snakes Ptyas
mucosus ]. Acta Herpetologica Sinica 50(4): 541-
550. (In Chinese)
Reese, A. M. 2000. The Alligator and Its Allies. Arment
Biological Press. 136pp.
Wang, G. H., L. J. He and M. Shao. 2000. [Research on
the relationship of Chinese alligator egg hatching
and environmental factors], Sichuan Journal of
zoology 19(2): 82-83. (In Chinese)
Wang, R. P. and X. F. Zhang. 2000. [Studies on changes
in egg mass and embryonic metabolic rate of the
Chinese alligator during incubation at suitable
temperatures]. Journal of Economic Animal 4(4):
49-54. (In Chinese)
Wu, X. B., Y. Q. Wang, K. Y. Zhou, J. S. Nie, C. L. Wang
and W. S. Xie. 1999. [Analysis on the reproduction
of captive populations of Alligator sinensis in
Xuanzhou Anhui, China]. Journal of Applied &
Environmental Biology 5(6): 585-588. (In Chinese)
Wu, L. S., X. B. Wu, H. X. Jiang, and C .L. Wang. 2006.
[Analysis of the reproductive ability of the
Chinese alligator (Alligator sinensis) in a captive
population in Anhui and the anticipation of popu-
lation increase]. Acta Herpetologica Sinica 30(2):
159-165. (In Chinese)
Xu, J., W. S. Xie, and H. T. Pan. 1989. [Nest building
ecology of the Chinese alligator in an artificial
breeding area]. Sichuan Journal of zoology 8(4):
16-18. (In Chinese)
Zhao, G. and J. S. Ma. 1997. [On improvement of the
experience formula of bird egg weight]. Journal
of Shandong Normal University 12(3): 264—268.
(In Chinese)
Zhou, F. S. 1994. [Correlation analyses of the breeding
parameters of birds]. Ecology Science 2: 40-49.
(In Chinese)
Zhu, D. Y. 2002. [The shape and structure of the egg of
the Chinese Softed Turtle]. Chinese Journal of
Zoology 37(4): 63-64. (In Chinese)
Submitted: 01 November 2006
Accepted: 22 April 2007
2008
Asiatic Herpetological Research, Vol. 1 1
pp. 85-92
A New Species of Rhacophorus (Anura: Ranidae) from China
Yun Ming Mo1, Jian Ping Jiang2’*, Feng Xie1 and Annemarie Ohler3
1 Natural History Museum ofGuangxi, Nanning 530012, China,
2Chengdu Institute of Biology, The Chinese Academy of Science, Chengdu 610041, China,
}Departement Evolution et Systematique Museum national d'Histoire naturelle, Paris 75005 France.
* Corresponding author E-mail: [email protected]
Abstract.- A new brown tree frog species, genus Rhacophorus , is described on the basis of seven adult male specimens
collected from Cenwanglaoshan Nature Reserve, Guangxi, in southern China. This frog can be distinguished from all
other Asian Rhacophorus Kuhl and van Hasselt, 1822 by the combination of: skin brown and smooth; Y-shaped car-
tilage visible dorsally on tips of fingers and toes; outer fingers one-third webbed; distinct dermal ridges present on
forearms, above vent, and calcars present on heels; anterior and posterior surface of thighs tangerine in color without
distinct dark or light spots; tympanum distinct and large, about 6.6% of SVL; dorsum brown with wide dark cross-
shaped mark.
Keywords.- Amphibia, Rhacophoridae, Rhacophorus , new
Introduction
The genus Rhacophorus Kuhl and van Hasselt, 1 822, a
member of the family Rhacophoridae, contains approxi-
mately 60 species ( sensu stricto ) (Frost, 2007) that are
distributed in the tropical and temperate zones of East,
South, and Southeast Asia. Liem (1970) outlined a con-
servative definition of the genus (. Rhacophorus sensu
stricto ), and while some authors recognize the genus in
this sense (Jiang et al., 1987; Fei et al., 1990; Zhao and
Adler, 1993; Inger et al., 1999; Malkmus et al., 2002;
Frost, 2007; Frost et al., 2006), others have adopted a
broader definition ( Rhacophorus sensu lato) that
includes the genus Polypedates (Tian and Jiang, 1986;
Dubois, 1987, 1992; Fei, 1999; Fei et al., 2005). In a
recent review of the Rhacophrinae, a new generic classi-
fication was proposed for the Rhacophorinae (Delorme
et al., 2005), where some members of Rhacophorus
were transferred to the new genus Aquixalus. This clas-
sification was adopted by Frost (2007) and Frost et al.
(2006) with some modification. In view of the various
interpretations of the Rhacophoridae, the classification
of the treefrogs should still be considered unstable
(Wilkinson et al., 2002; Matsui and Orlov, 2004), and as
stressed by Frost et al. (2006), the boundaries of
Rhacophorus should be considered tentative.
All Chinese Rhacophorus {sensu lato ) have been
found in southern region north to Qinling, with most
species distributed in the tropical and subtropical
regions. Some new species were recently added to the
genus from the regions in and around southern China: R.
hainanus Zhao et al., 2005 from Hainan, R. minimus
Rao et al., 2006 from Guangxi, R. yinggelingensis Chou
et al., 2007 from Hainan, and R. jarujini Matsui and
species.
Panha, 2006 from eastern Thailand.
During the survey of the herpetofauna of
Cenwanglaoshan Nature Reserve, Guangxi, China, in
May 2004 and 2005, seven specimens of a small brown
Rhacophorus were collected (Fig. 1), which appeared to
be distinct from other congeners hitherto known from
China (Fei et al., 2005) and nearby countries (Bourret,
1942), including Vietnam (Inger et al., 1999; Orlov et
al., 2001), Thailand (Taylor, 1962) , Laos (Stuart, 1999),
India (Inger and Dutta, 1987), and Burma (Zug et al.,
2003). These specimens, which resemble some south-
eastern Asia members of the genus, are described below
as a new species.
Materials and Methods
Morphological data - The seven specimens included in
the new species were collected by hand in
Cenwanglaoshan Nature Reserve, Guangxi, China, in
May 2004 and 2005. Five were preserved in 10%
buffered formalin, and two were preserved in 70%
ethanol. Morphological information of related species
used for comparison was obtained from the literature
listed below.
Measurements - Sixteen body measurements were
made using dial callipers to the nearest 0.1 mm: SVL =
snout-vent length; HL = head length from tips of snout
to the commissure of the jaws; HW = head width at the
commissure of the jaws; SL = snout length from tip of
snout to the anterior comer of the eye; INS = intemarial
space; IOS = interorbital space, i.e., the smallest space
between the inner edge of upper eyelid; UEW = width of
© 2008 by Asiatic Herpetological Research
86
Asiatic Herpetological Research, Vol. 1 1
2008
O R. maxim us
0 R. translineatus
A R. verrucopus
■ R. bipunctcittis
&R. kio
▲ R. hounglienensis
* R. luoshan
Figure 1. Localities recorded for the six species belonging to the Rhacophorus reinwardtii group in China, with the
locality recorded for R. hoanglinensis in Vietnam.
upper eyelid; ED = diameter of eye; TD = horizontal
diameter of tympanum; LAHL = length of lower arm
and hand; HAL = hand length; HLL = hindlimb length;
TL = tibia length; FTL = length of foot and tarsus; FL =
foot length; and TFDD = third-finger disc transverse
diameter.
Analyses of advertisement calls - We recorded the
advertisement calls of this new species using a
Panasonic SV-MP21V recorder (parameter set as
22050Hz, 16 bit, monophone, wav file). Calls were ana-
lyzed using Cool Edit Pro V2.1 and BatSound V3.0.
Environmental parameters recorded during collection
(2010-2340 h) were as follows: air temperature 22°C;
moisture 92%.
Museum acronyms.- CIB, Chengdu Institute of
Biology, Chinese Academy of Sciences; GXNM,
Natural History Museum of Guangxi, Nanning, China.
Taxonomy
Rhacophorus laoshan, new species
Fig. 2
Holotype- Catalog number GXNM 2005081. Adult
male collected in Cenwanglaoshan Nature Reserve
(Guangxi, China) on 19 May 2005 (106° 24' 8.22” E,
24° 29' 1 .98” N) at 1389 m altitude by Yunming Mo.
Paratypes - Six adult males, all from the same site as the
holotype: CIB 2831k collected on 19 May 2004 by
Jianping Jiang, Annemarie Ohler, Yunming Mo, and
Feng Xie; GXNM2005079, GXNM2005082,
GXNM2005095, CIB2005080, and CIB2005094 col-
lected on 19-20 May 2005 by Yunming Mo.
2008
Asiatic Herpetological Research, Vol. 11
87
Figure 2. (A-D) Holotype of Rhacophorus laoshan sp. nov.; adult male GXNM2005081.
Diagnosis - This new species Rhacophorus laoshan is a
small brown treefrog (SVL 35. 1±1 .3 mm; n = 7) that can
be distinguished from all other Asian Rhacophoridae by
the combination of the following characters: skin brown
and smooth; Y-shaped cartilage visible dorsally on tips
of fingers and toes; outer two fingers one-third webbed;
dermal ridges present on forearm, above vent, and on
heel calcars; anterior and posterior surfaces of thigh tan-
gerine in color and without distinct dark or light spots;
tympanum large, about 6.6% of SVL; dorsum brown
with wide dark cross.
Description of holotype.- Body size small (SVL = 35.4
mm) and moderately elongate. Head moderately com-
pressed, dorsally flat, and wider (HW = 13.9 mm) than
long (HL = 13.8 mm). Snout bluntly pointed, projecting,
with length (SL = 6.4 mm) longer than horizontal diam-
eter of eye (ED = 4.6 mm). Canthus rostralis distinct
with loreal region slightly concave. Nostril oval and
closer to tip of snout than eye; interorbital space almost
flat, and larger (IOS = 4.5 mm) than upper eyelid (UEW
= 3.9 mm) and intemarial space (INS = 4.0 mm).
Tympanum rounded with diameter (TD = 2.3 mm) half
that of eye; tympanum-eye distance about half tympa-
num diameter. Supratympanic fold distinct, present from
posterior comer of eye to above and behind insertion of
88
Asiatic Herpetological Research, Vol. 11
2008
arm. Vomerine ridges oblique, at an angle of 45° to body
axis, and closer to choanae than to each other. Vomerine
teeth on tongue pear-shaped, with deep notch on poste-
rior end.
Forearm plus hand about half snout-vent length,
with forearm (6.7 mm) shorter than hand (10.9 mm);
torearm with distinct dermal ridge from elbow to wrist
(Fig. 2); relative length of fingers: 3 > 4 > 2 > 1; fingers
with dermal fringes (Fig. 2); third and fourth fingers
with web on basal one-third; tips of all fingers with well-
developed disks with distinct circummarginal grooves;
discs relatively wide compared to fingers, except for
first finger; Y-shaped cartilage easily observable on
backs of fingers; subarticular tubercle developed; super-
numerary tubercles below base of fingers distinct; inner
metacarpal distinct, large, flat, and oval.
Hind limbs rather long, with tibiotarsal articulation
reaching middle of eye when leg stretched forward;
heels strongly overlapping when limbs folded at right
angles to body; tibia (TL 18.0 mm) about half SVL and
longer than thigh (12.8 mm) and foot (FL 14.9 mm); rel-
ative length of toes: 4>3 = 5>2> 1; tips of all toes with
moderately-sized disks (slightly smaller than those of
fingers except that of first finger); discs with distinct cir-
cummarginal grooves that are relatively wide compared
to toe width; Y-shaped cartilage easily observable on
backs of toes; web present, half developed, I 1 - 2 1/2 II 1
- 2 1/2 III 1 - 2 1/2 IV 2 - 1 V dermal fringe along toe V
distinct; subarticular tubercles prominent on all toes;
inner metatarsal tubercle distinct and oval; outer
metatarsal tubercle absent.
Dorsum smooth with granules scattered along sides
of body and head, along lower mandible, and back of
forearm; venter, head, and limbs covered with flat gran-
ules; outer edge of forearm and tarsus-metatarsus with
granulose ridge; dermal calcars present on heels; gran-
ules above vent forming transverse skin fold.
Color in life.- Dorsum chocolate brown; broad trans-
verse strip present medially on upper lids and interor-
bital space; back with broad cross-shaped marking (Fig.
2); limbs with broad transverse stripes: 2 on forearms,
2-3 on carpals and fingers, 3 on thighs and tibiae, and
4—5 on feet and toes; anterior and posterior surfaces of
thighs tangerine in colour and usually without distinct
dark or light spots; inner surface of tarsus and foot tan-
gerine; belly light gray-brown and without dark spots.
Male secondary sexual characters - Adult males with
nuptial pad on the base of first finger; internal subgular
vocal sacs present with two elongate openings; linea
masculina absent.
Variation.- Most variation was found in the appearance
of the wide cross-shaped mark on the dorsum. Usually,
this mark was visible except for when the dorsum was
more darkly-colored. The snout of some specimens was
green, and some specimens had a green spot on the
shoulder; ovate yellow spots on the sides of the body
sometimes formed a line.
Etymology - The species is named after the locality, i.e.,
Cenwanglaoshan Natural Preserve in northwestern
Guangxi, China, where it was found.
Measurements.- Sixteen body measurements are pro-
vided in Table 1 .
Habitat and ecological notes.- This new species was
found in a secondary broad-leaf forest with bamboo
undergrowth. Dense grass and deciduous leaves covered
the ground (Fig. 3). There were almost no perennial
streams in the region. During April and May, especially
at night after rainfall, males were heard calling loudly in
the forest, with six to nine calls making up a chorus. The
holotype and paratypes were found on branches and
leaves of trees one to three meters from the ground.
Advertisement calls.- The analyzed results of the calls
by Cool Edit Pro 2.1 and BatSound indicated that calls
were emitted every 17-25 seconds and lasted about
3.6-A.6 seconds. The calls had 19-26 notes (6 individu-
als, 12 calls) (Fig. 4a), with a note interval of
0.171-0.267 seconds (mean ± SD: 0.189±0.0184, 6 indi-
viduals, 12 calls, 44 notes). The dominant frequency was
2000 Hz and the second dominant frequency was 4000
Hz (Fig. 4b).
Comparisons.- The new species Rhacophorus laoshan
is most similar in appearance to R. hoanglienensis
(Orlov et al., 2001) and R. verrucopus Huang, 1983. It
species can be distinguished from R. hoanglienensis by
a combination of the following characters: (1) anterior
and posterior surfaces of the thighs are orange-red and
without distinct dark or light spots (black and white ver-
miculation is present in R. hoanglienensis ); (2) body
size smaller (SVL 35.1±1.3 mm; n = 7) than in R. hoan-
glienensis (SVL 43.2 mm; n = 1); (3) tympanum more
distinct and larger (TD = 2.3 mm, about 6.6% of SVL)
than that of R. hoanglienensis (TD = 2.1 mm, about
4.86% of SVL); (4) wide dark cross-shaped mark pres-
ent on dorsum; (5) venter light gray-brown and without
spots (not creamy-white with small dark spots that
merge in the distal parts of the fore and hind limbs).
Furthermore, the new species emits a call every 17-25
sec. (see above), while R. hoanglienensis calls every 3-5
min (Orlov et al., 2001), and white lines running from
the supratympanic fold to tip of snout through eyelid and
2008
Asiatic Herpetological Research, Vol. 1 1
89
Table 1 . Measurements (in mm) of Rhacopnorus laoshan sp. nov. Variations (mean ± SD) are shown for paratypes and
ratios to SVL (%). Abbreviations as used in text.
canthal ridge of female of R. hoanglienensis (Bain and
Truong, 2004). This new species can be distinguished
from R. verrucopus by the latter lacking vocal sac, head
longer than width, outer fingers 1/2 webbed, the dermal
ridge on forearm and above vent more weak, and the
dorsum without the wide dark cross mark present
(Huang, 1983). Rhacophorus laoshan can be separated
from related species that also have dermal flaps on the
forearms, tarsus, vent, or heel as follows. Rhacophorus
laoshan shows reduced toe webbing, which is more
extensive in R. annamensis, R. bipunctatus, R. exe-
chopygus, and R. reinwardtii (Inger et al., 1999); com-
plete webbing on the feet is seen in R. kio , R.
nigropalmatus, R. reinwardtii (Ohler and Delorme,
2006), R. maximus (Liu and Hu, 1961; Fei, 1999), R.
pardalis (Brown and Alcala, 1998; Inger, 1954, 1966;
Inger and Stuebing, 1997; Malkmus et ah, 2002), R.
prominanus (Taylor, 1962; Inger, 1966), and R. robin-
soni (Taylor, 1962; Inger, 1954) have. The absence of a
dark spot in temporal region distinguishes the new
species from R. cyanopunctatus (Malkmus et ah, 2002);
and R. bipunctatus (Inger et ah, 1999).
Rhacophorus baluensis can be separated from the
new species by being larger (male SVL = 50-55 mm)
(Malkmus et ah, 2002) and by having dark transverse
bars and irregular light or dark blotches on the dorsum
(Inger and Stuebing, 1997; Malkmus et ah, 2002).
Rhacophorus bimaculatus (Peters, 1867) is also larger in
size (SVL = 65 mm) and has fingers that are almost fully
webbed (Fei, 1999). Almost fully-webbed fingers are
also seen in R. dulitensis (Taylor, 1962; Inger and
Stuebing, 1997). Rhacophorus gauni can be separated
from the new species by having a conspicuous white
spot below the eye (Inger and Stuebing, 1997). The skin
of R. kajau is leafy green dorsally and usually has
minute white spots scattered on the back, head, and
exposed surface of the limbs (Inger and Stuebing, 1997;
Das, 2007). Rhacophorus rhodopus has more developed
finger and toe webbing, which is also red in color (Liu
and Hu, 1959; Fei, 1999), not grey-brown. Rhacophorus
translineatus has dark transverse bars on dorsum
(Sichuan Institute of Biology [Hu et ah, 1977; Fei,
1999]) while R. laoshan has a dark wide cross-shaped
mark.
The new species can be distinguished from
Rhacophorus appendiculatus by having irregular low
ridges on the back, as well as a narrow flap on the heel
(Inger and Stuebing, 1997; Malkmus et ah, 2002).
Rhacophorus calcaneus differs by having oval or round
dark brown spots on the dorsum, small enameled white
spots, or pinkish dorsolateral bands and a thin black net-
work enclosing large white spots ventrolaterally (Inger
et ah, 1999). Rhacophorus verrucosus has the vomerine
teeth absent (not present) and a low conical tubercle on
the heel (Inger et ah, 1999). Rhacophorus bisacculus has
no prominent projections in the infra-anal area, but it
may have several short, pointed tubercles (Inger et ah,
1999). Rhacophorus naso has a dorsolateral fold and a
skin projection on the tip of the snout (Fei, 1999).
90
Asiatic Herpetological Research, Vol. 1 1
2008
Figure 3. Habitat of Rhacophorus laoshan sp. nov.
Remarks.- Those Rhacophorus with dermal flaps are
distributed in the tropical region of southeastern Asia,
extending north to the southern slopes of the eastern
Himalayas, the Hengduan Mountains, the Yunnan-
Guizhou Plateau, and the Nanling Mountains. Within
this area, most species are distributed north of 20° N. Of
these taxa, R. bipunctatus, R. maximus, R. kio, R. hoan-
glienensis, R. laoshan , R, translineatus, and R. verruco-
pus, are distributed along the southern border of China
(Fig. 1).
Rhacophorus bipunctatus (recorded as R. bimacu-
latus by Fei (1999) and Fei et al. (2005) in their list of
Chinese amphibians) has the widest Chinese distribution
of these seven species (Fig. 1), and is also known from
Northeastern India, Myanmar, Thailand, Laos and
Vietnam. In China this species occupies the tropical
region of the southern slopes of the Yunnan-Guizhou
Plateau, the Nanling Mountains, and southern Medog.
Rhacophorus maximus has and R. bipunctatus are
known from Yunnan and Tibet. The northern extent of R.
kio in China is the southern border regions of Yunnan
and Guangxi (Ohler and Delorme, 2006; Fei, 1999).
Rhacophorus translineatus and R. verrucopus are found
along the southern slope of the eastern Himalayas in
Medog, while R. hoanglienensis and R. laoshan are
known from the southern slope of the Yunnan-Guizhou
Plateau.
In summary, there are only five Rhacophorus
species with dermal flaps along the southern slopes of
the Yunnan-Guizhou Plateau and the Nanling
Mountains: R. maximus, R. kio , R. hoanglienensis, R.
laoshan, and R. bipunctatus. Of these, the new species
A.
0 1 2 3 4 5 6
Time (seconds)
Figure 4. Audio-spectrogram with FFT size 512 (A), and
power spectrum (B) of advertisement calls of the new
species Rhacophorus laoshan (Holotype)
R. laoshan is the most northern, R. bipunctatus the most
eastern and R. kio and R. hoanglienensis the most south-
ern.
Lastly, only four rhacophorids were recorded in
Cenwanglaoshan Nature Reserve (Mo and Xie, 2005),
including the new species, suggesting that further sur-
veys of the herpetofauna along the southern slopes of
Yunnan-Guizhou Plateau and the Nanling Mountains
should be carried out to further explore the little-known
biodiversity of this region. Such efforts may elucidate
more species or populations of Asian treefrogs or other
new species.
Acknowledgments
We are grateful to Prof. Fei Liang, Ye Changyaun (CIB),
and Prof. Masafumi Matsui (Kyoto University) and Dr.
R. Steven Wagner (Central Washington University) for
comments on the manuscript, Mr. Jian Li (CIB) for the
line drawing, and Mr. Zhiming Xie (GXNM) for field
assistance. This work was supported partially by NSFC
(No. 30000018, 30670245) and Life Science Special
Fund of Chinese Academy of Sciences (CAS) Supported
by the Ministry of Finance (STZ-01-19) to Jian-ping
Jiang.
2008
Asiatic Herpetological Research, Vol. 1 1
91
Literature Cited
Bain, R. H. and N. Q. Truong. 2004. Herpetofaunal
diversity of Ha Giang Province in Northeastern
Vietnam, with descriptions of two new species.
American Museum Novitates 3453: 1-42.
Bourret, R. 1942. Les Batrachiens de L’lndochine.
Mem. Insti. Oceanogr. LTndochines, Hanoi. 1-517.
Brown, W. C. and A. C. Alcala. 1998. Philippine
Amphibians: An Illustrated Field Guide. Bookmark
Inc, Makati City, Philippines.
Chou, W. H., M. W. N. Lau, and P. L. Chan. 2007. A new
treefrog of the genus Rhacophorus (Anura:
Rhacophridae) from Hainan Island, China. The
Raffles Bulletin of Zoology 55(1): 157-165.
Das, I. 2007. A Pocket Guide to Amphibians and
Reptiles of Brunei. Kota Kinabalu, Natural History
Publications (Borneo). 200 pp.
Delorme, M, A. Duobis, S. Grosjean and A. Ohler. 2005.
Ne nouvelle classification generique et subgene-
rique de la tribu des Philautini (Amphibia, Anura,
Ranidae, Rhacophorinae). Bulletin de la Societe
Linneenne de Lyon 74(5) : 165-171.
Dubois, A. 1987. Miscellanea taxinomica
batrachologica (I). Alytes 5(1-2): 7-95.
Dubois, A. 1992. Notes sur la classification des ranidae
(Amphibiens, Anoures). Bull. Soc. Linn. Lyon 61:
305-352.
Fei, L, C. Y. Ye and Y. Z. Huang. 1990. Key to Chinese
Amphibia. Chongqing; Chongqing Branch, Science
and Technology Literature Publishing House, 1-
364. Fei, L. 1999. Atlas of Amphibians of China.
Zhengzhou: Henan Science and Technology Press.
432 pp.
Fei. L., C. Y. Ye, Y. Z. Huang, J. P. Jiang and F. Xie.
2005. An Illustrated Key to Chinese Amphibians.
Chengdu: Sichuan Publishing House of Science and
Technology. 340 pp + xii pi.
Frost, D. R., T. Grant, J. Faivovich, R. H. Bain, A. Haas,
C. F. B. Haddad, R. O. de Sa', A. Channing, M.
Wilkinson, S. C. Donnellan, C. J. Raxworthy, J. A.
Campbell, B. L. Blotto, P. Moler, R. C. Drewes, R.
A. Nussbaum, J. D. Lynch, D. M. Green and W. C.
Wheeler. 2006. The amphibian tree of life. Bulletin
of the American Museum of Natural History 297:
1-370.
Frost, D. R. 2007. Amphibian Species of the World: an
Online Reference. Version 5.0 (1 February, 2007).
Electronic Database accessible at
http://research.amnh.org/herpetology/amphibia/ind
ex.php. American Museum of Natural History, New
York, USA.
Huang, Y. Z. 1983. A new species of flying frog from
Xizang — Rhacophorus verrucopus. Acta
Herpetologica Sinica 2(4): 63-65.
Inger, R. F. and S. K. Dutta. 1987. An overview of the
amphibian fauna of India. Journal of the Bombay
Natural History Society 83(suppl.): 135-146.
Inger, R. F. 1954. Systematics and Zoogeography of
Philippine Amphibia. Fieldiana Zoology 33(4):
370-413.
Inger, R. F. 1966. The Systematics and Zoogeography of
the Amphibia of Borneo. Fieldiana Zoology 52:
279-351.
Inger, R. F. and R. B. Stuebing. 1997. Field Guide to the
Frogs of Borneo. Natural History Publications
(Borneo) Sdn. Bhd., Sabah, Malaysia. 205 pp.
Inger, R. F., N. Orlov and H. Darevsky. 1999. Frogs of
Vietnam: a report on new collections. Fieldiana
Zoology N.S. 92: 1-J6.
Jiang, S, S. Q. Hu and E. M. Zhao. 1987. The approach
of the phylogenetic relationships and the supraspe-
cific classification of 14 Chinese species of
treefrogs (Rhacophoridae). Acta Herpetologica
Sinica 6: 27-42.
Liem, S. S. 1970. The morphology, systematics, and
evolution of the Old World treefrogs
(Rhacophoridae and Hyperoliidae). Fieldiana
Zoology 57: 1-145.
Liu, C. C. and S. Q. Hu. 1961. Tailless from China.
Beijing, Science Press. 364 pp.
Liu, C. C. and S. Q. Hu. 1959. Preliminary report of
amphibian from southern Yunnan. Acta Zoologica
Sinica 11(4): 509-533.
92
Asiatic Herpetological Research, Vol. 1 1
2008
Malkmus, R., U. Manthey, G. Vogel, R Hoffmann and J.
Kosuch. 2002. Pp 175-217, In: Amphibians and
Reptiles of Mount Kinabalu (North Borneo).
A.R.G. Gantner verlag K.G.
Matsui, M. and S, Panha. 2006. A new species of
Rhacophorus from Eastern Thailand (Anura:
Rhacophoridae). Zoological Science 23: 477-481.
Matsui, M. and N. L. Orlov. 2004. A new species of
Chirixalus from Vietnam (Anura: Rhacophoridae).
Zoological Science 21: 671-676.
Mo, Y. M. and Z. M. Xie. 2005. On diversity and faunal
characteristics of amphibians and reptiles in
Cenwanglaoshan Nature Reserve. Herpetologica
Sinica 10: 82-88.
Ohler, A. and M. Delorme. 2006. Well known does not
mean well studied: Morphological and molecular
support for existence of sibling species in the
Javanese gliding frog Rhacophorus reinwardtii
(Amphibia, Anura). Comptes Rendus Biologies
329: 86-97.
Orlov, N. L., A.Lathrop, R. W. Murphy and H. T. Cue.
2001. Frogs of the family Rhacophoridae (Anura:
Amphibia) in the northern Hoang Lien Mountains
(Mount Fan Si Pan, Sa Pa District, Lao Cai
Province), Vietnam. Russian Journal of
Herpetology 8 (1): 17-44.
Rao, D. Q., J. A. Wilhinson and H. N. Liu. 2006. A new
species of Rhacophorus (Anura: Rhacophoridae)
from Guangxi Province, China. Zootaxa 1258:
17-31.
Wilkinson, J. A., R. C. Drewes and O. L. Tatum. 2002.
A molecular phylogenetic analysis of the family
Rhacophoridae with an emphasis on the Asian and
African genera. Molecular Phylogenetics and
Evolution 24: 265-273.
Zhao, E. M. and K. Adler. 1993. Herpetology of China.
SSAR Oxford, Ohio. 522 pp.
Zhao, E. M., L. J. Wang, H. T. S hi, G. F. Wu and H.
Zhao. 2005. Chinese rhacophorid frogs and descrip-
tion of a new species of Rhacophorus. Sichuan
Journal of Zoology 24(3): 297-330.
Zug, G. R., A. E. Leviton, J. V. Vindum, G. O. U. Wogan
and M. S. Koo. 2003. Comp, checklist of the
Myanmar Herpeto Fauna from Myanmar
Herpetological Survey Project. Website.
http://www.calacademy.org/research/herpetol-
ogy/myanmar/.
Sichuan Institute of Biology (Hu, S. Q., L. Fei , C. Y. Ye
and G. F. Wu). 1977. A survey of amphibians in
Xizang. Acta Zoologica Sinica 23(1): 54-63.
Stuart, B. L. 1999. Amphibians and Reptiles. Pp. 43-67,
In: Duchworth, J. W., R. E. Salter, and K.
Khounboline (Compilers), wildlife in Lao PDR:
1 999 status report.
Taylor, E. H. 1962. The amphibian fauna of
Thailand. Univ. Kansas Sci. Bull. 43:
265-599.
Tian, W. S. and Y. M. Jiang. 1986. Identification Manual
of Chinese Amphibians and Reptiles. Beijing:
Science Press. 1 64 pp.
Submitted: 28 November 2006
Accepted: 22 September 2007
2008
Asiatic Herpetological Research, Vol. 1 1
pp. 93-97
The Life History of Triturus vittatus vittatus (Urodela)
in Various Habitats
Oren Pearlson1’2’3 and Gad Degani1’2’*
{MIGAL-Galilee Technology Center, P.O. Box 831, Kiryat Shmona 11016, Israel,
2 School of Science and Technology, Tel ITai Academic College, Galilee, Israel,
3 Institute of Evolution, Faculty of Sciences and Science Education, University of Haifa, Israel.
* Corresponding author E-mail: [email protected]
Abstract.- The life cycle of Triturus v. vittatus at localities of various altitudes in Israel, ranging from 212 to 740 m
above sea level (ASL), were studied. Mature newts were observed only around winter rain pools, where they arrived
before the pools filled with water. The males left the ponds after spawning, while females left after eggs were
oviposited on plants and other substrata, according to the conditions of the ponds. Males (9-1 1 cm long, weighing
4. 3-5. 3 g) were slightly bigger than females (8.5-10 cm long, weighing 3. 1-4.3 g) Females laid 18-68 eggs each.
Fifteen to 30 days after oviposition, larvae hatched and from April to July, remained in the ponds to develop. Various
anuran larvae were found in the same breeding sites, including Hyla savignyi, Bufo viridis, Rana bedriagae and
Pelobates syriacus. Larval and adult Salamandra infraimmaculata were found to inhabit several of the rain pools
simultaneously, although the period during which both stages existed together was brief. Although temperature and
oxygen levels in the pools were not significantly different between breeding sites in the various habitats, development
took longer to complete at the more elevated sites.
Keywords.- Newt, larvae, Triturus v. vittatus , winter pool, Israel, life cycle.
Introduction
The life cycle and ecological conditions necessary for
the banded newt ( Triturus vittatus) have not been well
studied, although some aspects of the biology and life
cycle of the subspecies T. v. vittatus have been docu-
mented in Israel, Europe and the Mediterranean region
(Raxworthy, 1989; Olgun et al., 1997). Three subspecies
of the banded newt are currently recognized: T. v. vitta-
tus, found along the eastern edge of the Mediterranean,
ranging from Turkey to Israel; T. v. cilicensis, found in
areas bordering the east and northeast of the
Mediterranean; and T. v. ophryticus, located in the
Caucasus to the east and south of the Black Sea.
In Israel, Triturus v. vittatus is found from the north
to the central coastal plains, where conditions are most
extreme. The biology and life cycle of the populations in
northern Israel and Upper Galilee have been previously
described (Degani, 1986; Degani and Mendelssohn,
1983). Throughout their adult aquatic phase and larval
periods, T. v. vittatus mainly inhabits winter pools that
sometimes disappear at the beginning of summer
(Degani and Kaplan, 1999). The terrestrial adults reach
the pond at the beginning of the rainy season before the
ponds fill with water, and when the ponds are filled,
enter them for their aquatic phase.
Materials and Methods
In order to locate Triturus v. vittatus, all of the main
types of aquatic habitats inhabited by amphibian larvae
in northern Israel were investigated. The procedure fol-
lowed was that described by Degani and Kaplan (1999).
The various Triturus v. vittatus populations around
winter rain ponds and rock pools in northern Israel were
studied during four consecutive years (2001-2005) (Fig.
1). The elevations of these habitats ranged from 212 to
740 m ASL and represented a number of extreme eco-
logical and physical conditions. Water parameters were
measured every two weeks during the time the pools
were filled. In situ temperature and dissolved oxygen
data were obtained by a hand-held oxygen meter (WTW,
Oxi330 set, Germany). Water parameters were analyzed
by one-way analysis of variance (ANOVA), followed by
the Student-Newman-Keuls (SNK) test, for which
Graph-Pad Prism software (Graph Pad, San Diego, CA)
was used. The level of significance between groups was
set at p < 0.05.
Larvae were collected with a hand net (Degani and
Mendelssohn, 1983), identified to species and grouped
by specific water body.
© 2008 by Asiatic Herpetological Research
94
Asiatic Herpetological Research, Vol. 1 1
2008
Golan
Heights
Mount
Hermon
LEBANON
T. v. cilisensis
T. v. vittatus
Naharia #
Mount
Meiron
Haifa
Lake
Kinneret
Mount
Carmel
Nazareth
SYRIA
Figure 1. Various ponds in Israel colonized with newts examined in the study.
Results
The life cycle of Triturus v. vittatus is presented in
Figure 2. Males and females arrived at the dried ponds
before the beginning of the heavy rains in October and
November and entered them when they were filled.
Male newts (9-11 cm long and weighing 4. 3-5. 3 g)
were found to be slightly bigger than females (8.5-10
cm long and weighing 3. 1-4.3 g), with no significant
difference in size detected for either sex between ponds
(Fig. 3).
After mating, the males left the ponds while the
females remained in the water to deposit between 18-68
eggs on plants or rock surfaces. The larvae hatched 19-
29 days later and remained in the rain pool for 30 to 75
days. Hatching time and duration spent in the pool was
dependent on water temperature (Fig. 4), with develop-
ment being slower at higher altitudes.
Various anuran larvae were found in the same
breeding sites, including Hyla savignyi, Bufo viridis,
Rana bedriagae, and Pelobates syriacus. Larval and
adult Salamandra infraimmaculata were found to inhab-
2008
Asiatic Herpetological Research, Vol. 1 1
95
Figure 2. Life cycle of T. v. vittatus: Terrestrial (A) and
aquatic females (B), eggs on plants in the pond few days
after spawning (C), larvae one day before hatching (D)
and 2 days after hatching (E), and developing larvae (F).
it several of the rain pools simultaneously, although the
period during which both stages existed together was
brief. The eggs and larvae developed in the ponds only
when temperatures rose above 1 8°C, the threshold tem-
perature also necessary for metamorphosis in S. infraim-
maculata.
From winter to spring temperatures rose from 5°C
to 30°C (Fig. 4). No significant differences in tempera-
ture were observed between the various ponds [p > 0.05,
F-value = 0.1766-1.186) during the periods when the
newt larvae were present, although temperatures in
Dovev pond were lower at the beginning of the growth
period during the years 2001-2002, 2003-2004 and
most of the growth period in 2004-2005. Dissolved oxy-
gen concentrations did not vary between sites {p > 0.05,
F-value = 0.3489-2.326), ranging between 2-27 mg/L;
concentrations stayed between 5-10 mg/L for most of
the growth period. High oxygen concentrations were
detected during the larval growth period and during
completion of metamorphosis (Fig. 4).
Discussion
Since newt larval development is dependent on an
aquatic habitat, the locations of breeding sites changed
from year to year depending on water availability. This
site flexibility is an important environmental adaptation
in a semi-arid country such as Israel. The data obtained
from the five different newt populations examined in
this study were consistent with those data obtained in
previous studies on the same subspecies in Upper
Galilee (Degani and Kaplan, 1999; Degani and
Mendelssohn, 1983) and the coastal plains of Israel
(Geffen et al., 1987), supporting observations that T. v.
vittatus is present in water in Israel between December
and April. Adults of T. v. ophryticus in northern Turkey
differ in that they are usually found in the water from
%
§
i-i
3
"S3
£
n Matityahu Q. pond a Dovev pond a Pharaa pond
m Amiad waterholes ^Nahalit pond
Figure 3. The measurements of mature females (N = 27) and males (N =15) from various populations.
96
Asiatic Herpetological Research, Vol. 1 1
2008
2001-2002
Temperature
2003-2004
T em perature
Oxygen
Amiad
Pharaa
Matityahu
Nahalit
Dovev
Q.
2004-2005
Temperature
Oxygen
■Amiad
■ Pharaa
Figure 4. Water temperatures and oxygen concentration of various breeding sites where T. v. vittatus newts were pres-
ent during winter and spring 2001 to 2005.
2008
Asiatic Herpetological Research, Vol. 11
97
early March to late Octoberor November, depending on
the climate and altitude (Kutrup, 2005b). We suggest
that the differences between the two subspecies are due
to regional climate differences.
Kutrup et al. (2005a) studied the food of the banded
newt, Triturus v. ophryticus, at different sites in Trabzon
in northern Turkey and discovered that the newts con-
sume a wide variety of invertebrates during their aquatic
phase. In Israel, the Salamandra infraimmaculata and T.
v. vittatus have a very similar diet, composed of various
invertebrates (Degani and Mendelssohn, 1978; Geffen et
al, 1987).
In summary, the present study examined the life
cycle of Triturus v. vittatus in northern Israel, which was
found to vary depending on the unpredictable presence
of rain pools necessary for juvenile development.
Among the different ponds, large variations were found
in the length of the larval growth period, as well as in the
time required for completion of metamorphosis. In con-
trast, no differences were observed in the ecological
parameters and water quality of the ponds during the lar-
val growth period.
Literature Cited
Degani, G. 1986. Growth and behavior of six species of
amphibian larvae in winter ponds in Israel.
Hydrobiologia. 140: 5-10.
Degani, G. and D. Kaplan. 1999. Distribution of
amphibian larvae in Israeli habitats with change-
able water availability. Hydrobiologia 405: 49-56.
Degani, G. and H. Mendelssohn. 1978. The food of
Salamandra salamandra (L.) tadpoles in Israel in
different habitats. Israel Journal of Ecology
C.19-C.45.
Kutrup, B., U. Bulbul and N. Yilmaz. 2005b. Age struc-
ture in two populations of Triturus vittatus ophryti-
cus at different altitudes. Amphibia-Reptilia 26:
49-54.
Olgun, K., V. Tok, J. Amtzen and O. Turkozan. 1997.
The taxonomic status of the banded newt ( Triturus
vittatus) in southern Turkey. The Herpetological
Journal 7: 169-171.
Raxworthy, C. 1989. Courtship, fighting and sexual
dimorphism of the banded newt, Triturus vittatus
ophryticus. Ethology 81: 148-170.
Degani, G. and H. Mendelssohn. 1983. The habitats,
distribution and life history of Triturus vittatus vit-
tatus (Jenyns) in the Mount Meron area (Upper
Galilee, Israel). British Journal of Herpetology 6:
317-319.
Geffen, E., S. Gafny and A. Gasith. 1987. Contribution
to the knowledge of the biology of the banded newt,
Triturus vittatus vittatus , in rainpools in Israel.
Israel Journal of Zoology 34: 213-223.
Kutrup, B., E. Akir and N. Yilmaz. 2005a. Food of the
banded newt, Triturus vittatus ophryticus
(Berthold, 1846), at different sites in Trabzon.
Turkish Journal of Zoology 29: 83-89.
Submitted: 08 Januaty 2007
Accepted: 22 September 2007
pp. 98-104
Asiatic Herpetological Research, Vol. 11
2008
Sexual Dimorphism and Female Reproduction in
Lacerta vivipara in Northeast China
Peng Liu, Wen Ge Zhao*, Zhi Tao Liu, Bing Jun Dong and Hui Chen
Department of Biology, Institute of Life and Environment Sciences,
Harbin Normal University, Harbin, 150025, China.
* Corresponding author E-mail: [email protected]
Abstract.- Lacerta vivipara is a small lacertid lizard that inhabits much of Europe and northern Asia. From the end
ot May to the beginning of October in 2003, these common lizards were collected from a population in Heilongjiang
Province (northeast China) in order to study sexual dimorphism and female reproductive traits. Through the exami-
nation of external morphological traits, such as snout-vent length, head length, head width, head height, tail length,
body weight, rows of ventral and mid-dorsals scales, ventral color, tail base and femoral pores, analyses revealed the
presence of a distinct sexual dimorphism. Males possessed a bulging tail base, a salmon-pink venter and a thorn in
the femoral pore. Females had significantly more rows of ventral scales and fewer mid-dorsal scales than males. Adult
males were larger in head size and had a longer tail, whereas adult females were larger in body size and weight. Male
juveniles and neonates were larger in head size than females of the same age and female neonates were larger in body
size than male neonates. The rates at which head length, head width and head height increased with increasing SVL
(snout-vent length) was allometric in females.
Females produced a single clutch every breeding season, with 3-12 young per clutch. While clutch size and
neonate mass were not positively correlated with maternal SVF, clutch mass was, suggesting that sexual dimorphism
in this species is due (in part) to differences in reproductive investment between the sexes. The larger head of males
is likely an adaptation for male-male combat while the larger relative body length of females is a result of selection
for higher fecundity.
Keywords.- Sexual dimorphism, female reproductive adaptations, allometry, Facertidae, Lacerta vivipara.
Introduction
Sexual dimorphism in body size, body shape, and col-
oration is widespread in many Chinese lizards, includ-
ing Takydromus septentrionalis, Sphenomorphus indi-
cus, Eremias argus, Gekko japonicus, Plestiodon ele-
gans , Plestiodon chinensis, Erendas brenchleyi,
Phrynocephalus vlangalii and Eremias multiocellata
(Du and Ji, 2001; Ji and Du, 2000; Fin and Ji, 2000; Fi
et al., 2006; Xu and Ji, 2003; Zhang et ah, 2005).
Previous studies strongly suggest that sexual dimor-
phism results from a balance between numerous selec-
tive pressures differing in influence between the sexes
(Shine, 1989; Schoener et ah, 1982; Vitt and Cooper,
1985). Consequently, various hypotheses have been pro-
posed to explain sexual dimorphism, including, female
choice in mate selection, male aggressive behavior
(Andersson, 1994; Cooper and Vitt, 1993), fecundity
selection (a selection leading to larger body-cavity size
in females) (Griffith, 1990), differential mortality due to
differences in longevity (Shine et ah, 2002), and food-
niche divergence (Fin and Ji, 2000). Because reproduc-
tive output is associated with numerous morphological
traits in lizards, data on female physiology and repro-
duction are crucial to understanding the origin of sexual
dimorphism in the group (Du and Ji, 2001; Ji and Du,
2000; Fin and Ji, 2000; Fi et ah, 2006; Zhang et ah,
2005).
The common lizard, Lacerta vivipara Jacquin,
1787, has the largest geographic range of any terrestrial
squamate reptile, extending across Eurasia from western
Europe to Japan. In China, it is found in Heilongjiang
Province, Xijiang Province and Inner Mongolia. It is a
small (approximately 4-5 g), diurnal, non-territorial
lizard typically found in open spaces surrounded by
pine-broadleaf mixed forest (Zhao et ah, 2006).
Due to both its abundance in nature and unique dual
oviparous and ovoviviparous reproductive modes,
Lacerta vivipara has been the focus of numerous mor-
phological studies (Guillaume, 2006; Smajda and
Majlath, 1999; Fecomte et ah, 1992; Wermuth, 1955).
Despite this abundance of detailed quantitative exami-
nation (Dong, et ah 2004; Fang and Tang, 1983; Zhao et
ah, 2006), however, details on Chinese populations of
the species and the relationship between its reproductive
ecology and morphometry remains poorly understood .
To examine the relationships between sexually dimor-
phic, morphometric traits in males and females (from
adults to neonates), and their relationships to offspring
© 2008 by Asiatic Herpetological Research
2008
Asiatic Herpetological Research, Vol. 1 1
99
Figure 1. The tail base and ventral color of a male (top)
and female (bottom) Lacerta vivipara.
number and mass, we studied a population of L. vivipara
in Sunwu County, Heilongjiang Province, in northeast
China (49° 39' 19.2" N, 127° 34' 10.1" E; elevation 304
m). Morphological measurements were taken from
lizards collected in the field. Females gave birth to
young under simulated field conditions. Particular atten-
tion was paid to examining (1) sexual dimorphism in
ecologically important morphological traits and (2) the
relationship between female size and offspring size and
number. The results demonstrate that increased male
head size is an adaptation for combat and increased
female body length is an adaptation for higher fecundity.
Materials and Methods
Specimen collection and housing.- From the end of
May to the beginning of October in 2003, 183 lizards
(121 females, 62 males) were collected and analyzed. It
was assumed that the lizards were collected randomly,
thereby making the sample representative of the popula-
tion as a whole. Most of the males sampled were used
only for the collection of morphological data and were
released immediately following measurement; all
females were retained for subsequent analysis. The
retained lizards were transported to a nearby field station
and housed in a 7.5 x 1.8 x 1.0 (length x width x height)
m3 enclosure on the ground. The bottom of the enclosure
was covered with grass, branches and stones to simulate
the lizards’ natural habitat. Food (insects and spiders)
and water in small dishes were provided ad libitum. A
humid environment was maintained by spraying the sub-
strate with water daily. The lizards were marked by toe
clipping and back-painting.
Morphometry.- For each lizard collected, the following
five variables were measured with digital calipers to the
nearest 0.01 mm: snout-vent length (SVF; from the tip
Sid. Dev = 1.03
Mean = 23
N =62.00
o
<-
o
Zj
cr
o
s-
U.
24 25 26 27 28 29
Ventral s
Std Dev = 1.17
Mean = 26
N =121.00
Figure 2. Frequency distribution of rows of ventral scales
in males and females.
of the snout to the anterior margin of the cloacal lips);
head length (HF; from the tip of the snout to the poste-
rior margin of the skull); head width (HW; the largest
width of the head); head height (HH; the largest height
of the head ); tail length (TL; from the anterior margin of
the cloacal lips to the tip of the tail; specimens with
regenerated tails were excluded); body weight (BW),
number of ventral and mid-dorsals scale rows. Femoral
pores, venter color and tail base width were used to sex
individuals. Specimens with a SVL of 47 mm or more
were considered to be sexually mature adults (139 spec-
imens total); specimens with a SVF of 36-47 mm were
considered juveniles (30 specimens); specimens with a
SVF of less than 36 mm were considered neonates (14
specimens). .
Female reproduction.- Gravid females were separated
from each other in 30 x 25 x 25 (length x width x depth)
cm3 cages in order to accurately associate newborns with
their mothers. Enclosures were checked at least once a
day for neonates, which were immediately measured
and weighed after birth. Postpartum females were indi-
vidually weighed and measured for SVL. Clutches
Asiatic Herpetological Research, Vol. 1 1
2008
100
"O
0
i_
03
Q.
E
o
o
T3
c
03
If
=3
E
x
03
E
I
E
13
E
CD
03
c
03
i
TO
C
03
LU
( / )
+1
c
03
CD
E
C/3
03 W
"O ^
CD 2
C/3 rj)
in
0 C
9- w
® ro
£ £
03 X3
to 5
03
03
a
E
E
c
03
C
6 2
C 03
8 1
§
> -C
S 03
c
CD
03
tr
CD
o
03
-J
0
TO
O TO
>
O
C/3
TO
O
0
TO ~
O if)
03 ^3
O _J
O >
O
E $
'o LL^
0 ^
s $
o
TO O
" z
0 d
> TO
c
.9- TO
o
o
d
V
o
C/3
0
a
0
-Q
.03
O
C3
V
S Q-
-It
-«-» *
C/)
0 lO
2 °
03 °
C V
C/3 Q_
=3 *
v fC
TO 03
E I,
C
0
=3
T3
<
<2 5!
TO
II
C
lo
0
_0
'E
0
>
13
_0
TO
E
0
Ll_
0
TO
LO
m C33
0
0
TO
C
o
0
_a) lo
TO II
^ c
TO
d
+1
03
CO
00
LO
00
CO
+1
CO
00
LO
Is-
+i
co
LO
d
co
o
co
+i
o
co
t —
CO
*
*
-1C
o
co
03
I
o
M-
CO
o
o
LO
Is-
o
d
LO
I
LO
o
Is-
LO
LO
CM
±! T
CO
Is-
CM
C\i
CO
cm
LO
CM
+i
co
03
Is-
Is-
+i
M-
co
CM
CO
00
o
d
CM
00
CO
LO
N T-t-
+| T
03 1
o
00
CO
03
o
00
+1
Is-
Is-
cb
LO
■'t
CO
d
+1
M"
Is-
LO
CO
•*
*
LO
LO
00
h-
LO
CO
d
CO
d
>
C/5
m
I
X
2008
Asiatic Herpetological Research, Vol. 11
101
Snout-vent length (mm)
Figure 3. Linear regressions of head length, head width
and head height with SVL in Lacerta vivipara. The
regression equation is indicated in the figure. See text for
statistical analyses. Solid dots and lines: females; open
dots and dashed lines: males.
Snout-vent length (mm)
Figure 4. Linear regression of litter mass on female SVL
in Lacerta vivipara. The regression equation is indicated
in the figure. See text for statistical analyses.
including dead young, stillboms, or unfertilized eggs
were excluded from statistical analyses. Clutch mass
(RLM) was calculated by dividing litter mass by post-
partum female mass (Shine, 1992). Relative fecundity
was calculated by using the residuals derived from the
regression of litter size on maternal SVL (Olsson and
Shine, 1997).
Statistical analysis.- Whenever parametric statistics
were applied, a normal distribution was verified using
the Kolmogorov-Smimov test. Homoscedasticity was
verified using Levene's Test for Equality of Variances.
For significant departures from normality or
homoscedasticity, data were loge-transformed before
analysis. To test for sexual dimorphism in the data,
absolute values of morphometric measurements were
compared between sexes using a linear regression analy-
sis, one-way analysis of variance (ANOVA) and one-
way analysis of covariance (ANCOVA) with SVL as the
co variate.
All statistical analyses were performed using SPSS
(Statistical Package for the Social Science) vll.5 for
Windows. Homogeneity of slopes was checked prior to
testing for differences between adjusted means. Values
are presented as mean ± standard error and the signifi-
cance level in set at p < 0.05 for all statistical tests.
Table 2. Slope (b), intercept (a) and adjusted R square (r2) estimated from reduced major axis regressions for each
trait against SVL in female neonates, juveniles, and adults.
102
Asiatic Herpetological Research, Vol. 1 1
2008
Table 3. Descriptive statistics of female reproductive
traits and snout-vent length of Lacerta vivipara (n = 26).
Results
Sexual dimorphism.- In males, the base of the tail
bulged because of the presence of the hemipenes and the
venter of the tail was salmon pink. In females, the base
of the tail was slender and the venter had a saffron-yel-
low to off-white tint (Fig. 1). Femoral pores (8-12) were
small and black in females and neonates while it was
accompanied by a thorn in adult male. There were more
vertical scale rows in females (24—29) than in males
(21-25) (Mann- Whitney Test, Z = -10.377, p < 0.01;
Fig. 2), and males had more mid-dorsal scales
(31.63±1.46) than females (30.6 l=tl .48) (Mann-
Whitney Test, Z = -3.514 , /? < 0.01).
The largest male and female were 59.07 and 71.40
mm SVL, respectively. The mean SVL was larger in
adult females (58.69±5.44 mm) than in adult males
(51.86±3.13 mm) (t = -9.304, p < 0.001). Body weight
was greater in adult females (t = -3.710, p < 0.001) and
tail length was larger in adult males (^ = 2.519,/? < 0.01).
An ANCOVA test controlling for SVL found that adult
males had a larger head size (head length, head width
and head height) compared to adult females of the same
SVL (ANCOVA; HL, F = 140.145, p < 0.001; HW,
F= 48.800,/? < 0.001; HH, F= 50.035, P< 0.001). Head
length and head width were larger in juvenile males than
in juvenile females (ANCOVA; HL, F = 11.380,
p < 0.0 1 ; HW, F= 12.134,/? < 0.01) and head length was
larger in neonate males than in neonate females (ANCO-
VA; HL, F= 18.515,/? < 0.01). Body length was larger
in neonate females than in neonate males (t = -3.073,
p < 0.01) (Table 1).
The rates at which head length, head width, and
head height increased with increasing SVL were all
greater in males than in females (Fig. 3). Although the
rates of increase were the same in adult males as they
were for juvenile and neonate males (ANCOVA; HL,
F = 2.972, p = 0.059 > 0.05; HW, F = 0.476,
p = 0.624 > 0.05; HH, F = 5.091, p = 0.09 > 0.05), this
was not the case for females (ANCOVA; HL, F 8. 1 75,
p < 0.001; HW, F = 5.586, p = 0.005 < 0.01; HH,
F = 6.143, p = 0.03 < 0.05). In female neonates, head
length and width did not increase proportionally to SVL
(b < 0) and rate of head width was greater in female
juveniles than in female adults (b = 0.163 vs. b = 0.051)
(Table 2).
Female reproductive traits.- Female Lacerta vivipara
produced a single clutch of 3-12 young every breeding
season (Table 3). Clutch mass was positively correlated
with maternal SVL (r = 0.55, F = 5.43, p < 0.0 1 ; Fig. 4),
whereas clutch size (r = 0.38, F = 3.75, p = 0.06) and
neonate mass (r = 0.37, F = 3.38, p = 0.06) were not.
Neonate mass was independent of relative fecundity
(r = 0.15, F= 0.56,/?= 0.46).
Discussion
Consistent with previous studies of European popula-
tions of Lacerta vivipara (Gvozdik and Damme, 2003;
Kratochvil et al., 2003; Smajda and Majlath, 1999;
Wermuth, 1955), the present study found that sexual
dimorphism in head size, abdomen length, and tail
length was widespread in Chinese populations, suggest-
ing that these sexually dimorphic traits evolved a very
long time ago and has remained in the species as it dis-
persed across Asia. Lacerta vivipara is similar to other
lizards (e.g., Plestiodon laticeps, Plestiodon elegans,
Phrynocephalus vlangalii, Takydromus septentrionalis,
Tropidurus torquatus) (Du and Ji, 2001; Vitt and
Cooper, 1985; Zhang and Ji, 2000; Zhang et al., 2005) in
that the males have a larger head and longer tail while
females have a longer snout-vent length, increased body
weight a longer abdomen, and more rows of ventral
scales.
Sexual differences in head size are common within
the Lacertidae (Huang, 1998; Molina-Boija et al., 1998).
Since long periods of evolutionary time are often
required to manifest these differences (Kratochvil et al.,
2003), proximate environmental factors can be less
important determinants of sexual dimorphism in head
size than ultimate ones, such as phylogenetic history.
Sexual dimorphism may simply be the result of phylo-
genetic history and is maintained through competition
over mates (intra- and inter-sexual selection)
(Kratochvil et al., 2003; Shine, 1989).
According to most speculation, variations in allom-
etry in Lacerta vivipara are adaptive responses related to
differences in both the ecology and reproductive behav-
ior of the two sexes (Kratochvil et al., 2003). Although
it has been reported that a larger head is a male adapta-
tion to feeding on larger prey (Schoener et al., 1982),
there is little intersexual dietary divergence in L. vivipa-
2008
Asiatic Herpetological Research, Vol. 1 1
103
ra (Zhao et al., 2006). In contrast, the present study sup-
ports the conclusion that larger male heads are an adap-
tation for intersexual combat (Gvozdik and Damme,
2003). There is also evidence to support the possibility
that a longer male tail provides armament in combat and
improves the male’s ability to escape (Barbadilloo and
Bauwens, 1997; Barbadilloo et al., 1995; Brana, 1996;
Herrel et al., 2001). Color dimorphism is hormonal in
origin, becoming noticeable at the onset of sexual matu-
rity; this dimorphism apparently aids in sexual identifi-
cation and maintaining social hierarchy (Adriana, 2005).
Females have a considerably larger number of
transverse rows of scales covering the venter of the
abdomen and have a relatively large abdomen compared
to males of the same size. The present data showed that
maternal size is the main determinant of reproductive
output in Lacerta vivipara, with larger females produc-
ing heavier clutches. This offers strong evidence to sup-
port the hypothesis that selection for higher fecundity
results in the evolution of a longer trunk.
In other species of lizards such as Takydromus
septentrionalis, Podarcis muralis, Gekko japonicus,
Plestiodon chinensis and Sphenomorphus indicus, sexu-
al dimorphism in head size occurs at earlier ontogenetic
stages (Zhang et al., 2005). Our results reveal a similar
pattern in Lacerta vivipara, in that changes in allometry
vary at different ontogenetic stages between the sexes,
resulting in a distinct dimorphism. The neonates have
larger heads to obtain more foods to increase the trunk,
so that the sex individuals have no significant difference
in the size. With the growth of the body, the rate growth
of the head slows in female and head length and head
width is decreased, and quickly increased in juveniles
till the adults. Adult females of L. vivipara sacrifice head
and tail growth for increased abdomen (and body cavity)
length in order to achieve a greater reproductive output.
In conclusion, Lacerta vivipara exhibits a sexual dimor-
phism in size, color, and shape that can be linked to sex-
ual selection. In females, characteristics allowing for
higher reproductive output are selected for in females,
resulting in larger bodies and energy allocation directed
to early reproduction instead of growth. In males, char-
acteristics selecting for increased numbers of copula-
tions are selected for.
Acknowledgments
We are deeply indebted to Yu-guo Xia, Feng Zhao and
Zhi-gang Xie for collecting, housing and measuring
specimens in the field. Thanks also are given to Chun-
zhu Xu, Lin-lin Liu, Dian-wei Li and Zhi-ying Zhang
for dealing with the data. The Heilongjiang Provincial
Bureau of Education for scientific research funded this
work.
Literature Cited
Adriana, C. S. P., C. W. Helga and R. C. Guarino. 2005.
Sexual dimorphism in the Neotropical lizard,
Tropidurus torquatus (Squamata, Tropiduridae).
Amphibia-Reptilia 26: 127-137.
Andrews, R. M. and J. A. Stamps. 1994. Temporal vari-
ation in sexual size dimorphism of Anolis limifrons
in Panama. Copeia 1994: 613-622.
Barbadilloo, L. J. and D. Bauwens. 1997. Sexual
Dimorphism of tail length in lacertid lizards: test of
a morphological constraint hypothesis. Journal of
Zoology (London) 242: 473-482.
Barbadilloo, L. J., D. Bauwens, F. Barahona and N. J.
Sanchez-Herraiz. 1995. Sexual differences in cau-
dal morphology and its relation to tail autotomy in
lacertid lizards. Journal of Zoology (London) 236:
83-93.
Brana, F. 1996. Sexual dimorphism in lacertid lizards:
male head increase vs. female abdomen increase?
Oikos 75: 511-523.
Cooper, W. E. Jr., and L. J. Vitt. 1993. Female mate
choice of large broad-headed skinks. Animal
Behaviour 45: 683-693.
Dong, B. J., W. G. Zhao, Z. T. Liu and P. Liu. 2004.
[Study on the behavior of breeding and strategy of
reproduction of Lacerta vivipara ]. Natural Sciences
Journal of Harbin Normal University 20(1): 74-78.
(In Chinese)
Du, W. G. and X. Ji. 2001. [Growth, sexual size dimor-
phism and female reproduction of blue tailed
skinks, Eumeces elegans ]. Zoological Research
22(4): 279-286. (In Chinese)
Fang, J. J., and X. R. Tang. 1983. [Distribution and mor-
phology of Lacerta vivipara in China and observa-
tions of behavior]. Acta Herpetologica Sinica 9(2):
51-55. (In Chinese)
Griffith, H. 1990. Miniaturization and Elongation in
Eumeces (Sauria: Scincidae). Copeia 1990: 751-
758.
Guillaume, C. P., B. Heulin, I. Ya. Pavlinov, D. V.
Semenov, A. Bea, N. Vogrin and Y. Surget-Groba.
2006. Morphological variations in the common
104
Asiatic Herpetological Research, Vol. 1 1
2008
lizard, Lacerta ( Zootoca ) vivipara. Russian Journal
of Herpetology 13 (1): 1-10.
Gvozdik, L. and R. V. Damme. 2003. Evolutionary
maintenance of sexual dimorphism in head size in
the lizard Zootoca vivipara : a test of two hypothe-
ses. Journal of Zoology (London) 259: 7-13.
Herrel, A., R. V. Damme, B. Vanhooydonck and F. V.
De. 2001. The implication of bite performance for
diet in two species of lacertid lizards. Canadian
Journal of Zoology 79: 662-670.
Huang, W. S. 1998. Sexual size dimorphism and micro-
habitat use of two sympatric lizards,
Sphenomorphus taiwanensis and Takydromus
hsuehshanensis, from the central highlands of
Taiwan. Zoology Study 37: 302-308.
Ji, X. and W. G. Du. 2000. [Sexual dimorphism in body
size and head size and female reproduction in a
viviparous skink, Sphenomorplus indicus\.
Zoological Research 21(3): 349-350. (In Chinese)
Kratochvil, L., M. Fokt, L. Rehak and D. Frynta. 2003.
Misinterpretation of character scaling: a tale of sex-
ual dimorphism in body shape of common lizards.
Canadian Journal of Zoology 81: 1112-1117.
Lecomte, J., J. Clobert and M. Massot. 1992. Sex iden-
tification in juveniles of Lacerta vivipara.
Amphibia-Reptilia 13: 21-25.
Li, H., X. Ji, Y. F. Qu, J. F. Gao and L. Zhang. 2006.
[Sexual dimorphism and female reproduction in the
multi-ocellated racerunner Eremias multiocellata
(Lacertidae)]. Acta Zoologica Sinica 52 (2): 250-
255.
Lin, Z. H. and X. Ji. 2000. [Foodhabits, sexual dimor-
phism and female reproduction in the skink
(. Eumeces chinensis ) from a Lishui population in
Zhejiang]. Acta Ecologica Sinica 20(2): 304-310.
(In Chinese)
Molina-Borja, M., M. Padron-Fumero and M. T.
Alfonso-Martin. 1998. Morphological and behav-
ioural traits affecting the intensity and outcome of
male contests in Gallotia galloti galloti (family
Lacertidae). Ethology 104: 314-322.
Olsson, M. and R. Shine. 1997. The limits to reproduc-
tive output: offspring size versus number in the
sand lizard Lacerta agilis. American Naturalist 149:
179-188.
Schoener, T. W., J. B. Slade and C. H. Stinson. 1982.
Diet and sexual dimorphism in the very catholic
lizard genus Leiocephalus of the Bahamas.
Oecologia 53: 160-169.
Shine, R, R. N. Reed, S. Shetty and G. H. Gogger. 2002.
Relationships between sexual dimorphism and
niche partitioning within a clade of sea snakes
(Laticaudinae). Oecologia 133: 419-461.
Shine, R. 1989. Ecological causes for the evolution of
sexual dimorphism: a review of the evidence.
Quarterly Review of Biology 64: 419^-61.
Shine, R. 1992. Relative clutch mass and body shape in
lizards and snakes: its reproductive investment con-
strained of optimized? Evolution 46: 828-833.
Smajda, B. and I. Majlath. 1999. Variability of some
morphological traits of the common lizard {Lacerta
vivipara) in Slovakia. Biologia 54: 585-589.
Vitt, L. J. and W. E. Cooper, Jr.. 1985. The evolution of
sexual dimorphism in the skink Eumeces laticeps :
an example of sexual selection. Canadian Journal of
Zoology 63: 995-1002.
Wermuth, H. 1955. Biometrische Studied on Lacerta
vivipara Jacquin. Abhandlungen und Berichte des
Museums fur Naturkunde und Vorgeschichte 9:
221-235.
Xu, X. F. and X. Ji. 2003. [Ontogenetic shifts in sexual
dimorphism in head size and food habits of Erendas
brenchleyi]. Chinese Journal of Applied Ecology
14(4): 557-561. (In Chinese)
Zhang, X. D., X. Ji, L. G. Luo, J. F. Gao and L. Zhang.
2005. Sexual dimorphism and female reproduction
in the Qinghai toadheaded lizard Phynocephalus
vlangalii. Acta Zoologica Sinica 51(6): 1006-1012.
Zhang, Y. P. and X. Ji. 2000. [Ontogenetic changes of
sexual dimorphism in head size and food habit in
grass lizard Takydromus septentrionalis ].
Zoological Research 21: 181-186. (In Chinese)
Zhao, W. G., B. J. Dong, P. Liu and Z. T. Liu. 2006.
[Predatory behavior and feeding behaviour in
Lacerta vivipara ]. Chinese Journal of Ecology
25(12): 1520-1523. (In Chinese)
Submitted: 31 October 2006
Accepted: 22 September 2007
2008
Asiatic Herpetological Research, Vol. 1 1
pp. 105-109
Sperm Morphology of Five Rhacophorus (Amphibia: Anura:
Rhacophoridae) Species from China
Li Mei Qin1’2, Zhong Hua Zheng1’*, Jian Ping Jiang1, Feng Xie1 and Yun Ming Mo3
1 Chengdu Institute of Biology, Chinese Academy of Sciences, Chengdu, 61 0041, China,
2 Postgraduate university of Chinese academy of sciences, Beijing, 100049, China,
3 Natural History Museum of Guangxi, Nanning, 530023, China.
* Corresponding author E-mail: [email protected]
Abstract.- Sperm shape and size of five species of the genus Rhacophorus from China were investigated in the present
study. Our results reveal the presence of two possible monophyletic lineages: the first is composed of R. chenfui, R.
dugritei and R. omeimontis, has relatively small spermatozoa with a with a coiled head and a thin tail, while the sec-
ond, composed of R. mutus and R. megacephalus, have spermatozoa that are longer with a straight head and filiform
shape.
Keywords.- Amphibian, Rhacophoridae, Rhacophorus , Polypedates, spermatozoa, morphology.
Introduction
The genus Rhacophorus {sensu lato) is a member of the
family Rhacophoridae and contains approximately 80
species worldwide, 24 of which are found in China (Fei
et al., 2005). Rhacophorids are predominantly arboreal,
sharing with basal ranids expanded digital pads and
mantellids the intercalary phalangeal elements (Frost et
al., 2006). These frogs are distributed in the tropical and
sub-tropical regions of eastern and southern Asia; in
China, they inhabit southern areas north to Qinling.
Phylogenetic and taxonomic relationships within this
genus are still conjectural and controversial. For
instance, the genus Polypedates is valid according to
Frost et al. (2007), but it is absent in Fei et al. (2005).
Furthermore, Frost et al. (2007) placed R. chenfui , R.
dugritei , R. omeimontis in Rhacohporus , while R. mutus
and R. megacephalus were placed in the genus
Polypedates by Fei et al. (2005).
Previous studies have revealed that some morpho-
logical characters of the spermatozoa were unique to
given taxa in the Anura (Kuramoto and Joshy, 2000;
Kuramoto, 1996; Zheng et al., 2000a, 2000b, 2002). For
example, the spermatozoa of most Rana species are
characterized by a cylindrical head and a thin tail, while
spiral and corkscrew-shaped sperm head and waved tail
are typical of spermatozoa in the family Megophryidae
(Zheng et al., 2002), and fusiform-shaped spermatozoa
are unique to the family Bombinatoridae (Zheng et al.,
2000a). These studies make it evident that sperm mor-
phology is not only variable between taxa, but can be
useful for elucidating taxonomic relationships
(Kuramoto and Joshy, 2000). In this study, the shape and
size of spermatozoa in Rhacophorus chenfui, R.
dugritei, R. omeimontis, R. megacephalus and R. mutus
were examined for the purpose of resolving their cryptic
phylogenetic relationships.
Materials and Methods
Collecting localities are listed in Table 1 . All specimens
were collected during their breeding seasons, (i.e., May
to July) from 1998 to 2005.
Frogs were euthanized by inserting a medical nee-
dle through the occipital ostium to destroy the spinal
cord. Next, the testes were removed and immediately
fixed with 10% formaldehyde, squashed and macerated
with a clean toothpick; sperm were suspended on slides,
air-dried and stained with acid carmine for 40 seconds.
Slides were examined on a ZEISS Axioplan2 light
microscope (LM). Other testes were fixed with 3% glu-
taraldehyde for about two hours and centrifuged at 3000
rpm for 30 s; the supernatant was discarded and the pel-
let rinsed with double distilled water. A drop of the
resulting sperm suspension was placed on a cover slip,
air-dried, coated with gold, and observed on a JEOL
JSM-5900LV scanning electron microscope (SEM).
Spermatozoan pictures were shot by ZEISS
AxioVision 4.0. Sperm length was measured by soft-
ware Arc View GIS 3.2. Sperm length data were ana-
lyzed with SPSS 11.5. The length of sperm head of
Rhacophorus chenfui , R. dugritei, R. omeimontis were
calculated by the formulate L=Nl7t (L: the length of
sperm head, tt = 3. 14, 1 = the diameter of helix, N = the
number of turns in the helix).
© 2008 by Asiatic Herpetological Research
106
Asiatic Herpetological Research, Vol. 1 1
2008
Figure 1. Spermatozoa of five tree frogs, a: Rhacophorus chenfui ; b: R. dugritei; c: R. omeimontis ; d: R. mutus ; e: R.
megacephalus; f: detail of the sperm head of R. mutus. A: acrosome; H: head; T: tail.
Figure 2. The total length of spermatozoa in different pop-
ulations of Rhacophorus mutus and R. megacephalus.
Units: pm.
Results
The spermatozoa of all five species consisted of two por-
tions, the head and the tail. The sperm head of
Rhacophorus chenfui (Fig. la) was shaped like a coiled
spiral, the tail was thin and wavy (shared with character-
istic shared with R. dugritei (Fig. lb) and R. omeimontis
(Fig. lc)), and the slightly-coiled apical section was
likely the acrosome. The shape of the sperm in R. mutus
(Fig. Id) was filiform, consisting of a straight, thick
head and a thin wavy tail. A thinner section (Fig. If, see
arrow) at the tip of sperm head was likely the acrosome
(Fig. If, a). Bends and waves could usually be observed
from the midpoint of the sperm.
Spermatozoa measurements are shown in Table 1.
Total sperm length in Rhacophorus chenfui and R.
dugritei is much shorter than those measured for R.
megacephalus and R. mutus; the sperm of R. omeimontis
was of intermediate length.
The sperm head of Rhacophorus dugritei was the
shortest and thinnest, and the head of R. omeimontis was
longer than that of R. dugritei , and thinner than those of
all other four species. Head length in R. chenfui was also
relatively short, and it was also slightly thicker than that
of R. dugritei. R. megacephalus had the largest sperm
head among all five species, with the head of R. mutus
being only slightly smaller.
The coiled head of Rhacophorus chenfui , R. omei-
montis and R. dugritei were largely similar. However,
the sperm head of R. chenfui was longer than the tail ,
with the ratio of sperm head to total sperm length being
1:0.86.
Sperm size of Rhacophorus megacephalus and R.
mutus differed remarkably between populations. The
spermatozoa of R. megacephalus in Sichuan population
were longer than those in the Guangxi population, and
those of R. mutus were longer than those in the Yunnan
population compared to the Guangxi population (Table
1; Fig. 2).
2008
Asiatic Herpetological Research, Vol. 1 1
107
Table 1 . Sperm measurements of Rhacophorus species.
Unit: pm. N: number of spermatozoa;
Discussion
Spermatozoa morphology.- The morphology of the
sperm observed here for Rhacophorus chenfui, R.
dugritei and R. omeimontis appeared to be very similar
to that reported by Mizuhira et al. (1986) for R. arboreus
and R. schlegelii, as well as that reported by Kuramoto
(1996) for R. viridis amamiensis, R. owstoni and R.
moltrechti. The sperm heads of latter species, however,
while coiled, did not appear to have the two twisted sub-
coils characteristic of the former three species.
Conversely, the shape of the spermatozoa in R. mutus
and R. megacephalus were very similar to those seen in
Polypedcites leucomystax, P. megacephalus (Kuramoto,
1996) and P. maculatus (Kuramoto and Joshy, 2000),
where the head is linear (not coiled) and no fibers in the
tail. Based on the variation of sperm morphology
observed here, the five species examined can be divided
into two groups: tthe first group (consisting of R. chen-
fui, R. dugritei and R. omeimontis) is characterized by a
helical sperm head and a thin sperm tail, and the second
group (consisting of R. mutus and R. megacephalus) is
characterized by a thread-like sperm head and a thin tail.
Sperm size differ remarkably between species, also
between populations. The average length of spermato-
zoa in Rhacophorus chenfui was 123.45±8.60pm, while
that of R. megacephalus was 230. 25±1 9.81 pm, a differ-
ence of statistical significance (P < 0.01, n = 20, one-
way analysis of variance). In the different populations of
R. megacephalus , total spermatozoa length in the
Sichuan, Yunnan, Guangxi and Taipei populations was
241.16 pm, 230.65 pm, 222.04 pm, 213.1 pm
(Kuramoto, 1996), respectively, illustrating a reduction
in length towards the Pacific Ocean (Fig. 3). This phe-
nomenon was also observed in R. mutus (average length
228.84 pm in the Yunnan population and 202.9 pm in
the Guangxi population).
The implications for taxonomy from sperm atological
data.- On the basis of skeletal characters, Liem (1970)
placed Rhacophorus dugritei and R. omeimontis into the
genus Polypedates. Uncertain as to the limits of these
two genera, Fei (1999) and Fei et al. (2005) tentatively
treated all Polypedates as Rhacophorus. Based on
molecular evidence, however. Frost et al. (2007) placed
R. chenfui, R. dugritei and R. omeimontis in
Rhacohporus, and placed R. mutus and R. megacephalus
in Polypedates. In view of the spermatological data pre-
sented here, the latter hypothesis presented by Frost et
al. (2007) appears to be best supported.
108
Asiatic Herpetological Research, Vol. 1 1
2008
'■
(W
Sichuan
rA . f*"\!
• Yunnan
i <
J ^
)
--VN
s
nr
"S
/
"i <
Vs/\ }
CJ
$Guangxi
# Taipei
.^C)c
,e^
V^c
VW
Figure 3. Map of collection localities.
Acknowledgments
This research was funded by grants from National
Natural Science Foundation of China, No.30570195
Literature Cited
Fei L. 1999. Pp. 161-175. In: Atlas of amphibians of
China. Henan publishing house of science and tech-
nology, Zhengzhou. (In Chinese).
Fei, L., C. Y. Ye, J. P. Jiang, F. Xie and Y. Z. Huang.
2005. Pp. 169-175. In: [An illustrated key to
Chinese amphibians]. Sichuan publishing group,
Sichuan publishing house of science and technolo-
gy, Chengdu. (In Chinese)
Frost, D. R., T. Grant, J. Faivovich, R. H. Bain, A. Haas,
C. B. Haddad, R.O. De Sa, A. Channing, M.
Wilkingson, S. C. Donnellan, C. J. Raxworthy, J. A.
Campbell, B. L. Blotto, P. Moler, P. C. Drewes, R.
A. Nussbaum, J. D. Lynch, D. M. Green, and W.C.
Wheeler 2006. Pp. 243-247. in: The amphibian tree
of life. American Museum of Natural History,
Library-Scientific publication, New York.
Kuramoto, M. 1996. Generic differentiation of sperm
morphology in tree frogs from Japan and Taiwan.
Journal of Herpetology 30(3): 437^143.
Kuramoto, M. and S. H. Joshy. 2000. Sperm morpholo-
gy of some Indian frogs as revealed by SEM.
Current Herpetology 19: 63-70.
Liem, S. S. 1970. The morphology, systematics, and
evolution of the Old World treefrogs
(Rhacophoridae and Hyperoliidae). Fieldiana:
Zoology 57: 1-145.
Mizuhira, V., Y. Futaesaku, M. Ono, M. Ueno, J.
Yokofujita and T. Oka. 1986. The fine structure of
the spermatozoa of two species of Rhacophorus
( arboreus , schlegelii ). I. Phase-contrast microscope,
scanning electron microscope, and cytochemical
observations of the head piece. Journal of
Ultrastructure and Molecular Research 96: 41-53.
2008
Asiatic Herpetological Research, Vol. 1 1
109
Zheng, Z. H, L. Fei, and C. Y. Ye. 2002a. [Study of the
morphology of spermatozoa of the genus Bombina ].
Cultum Herpetologica Sinica 8: 222-227 . (In
Chinese)
Zheng, Z. H., L. Fei, and C. Y. Ye. 2000b. [Study on the
morphology of the spermatozoa of Megophrys
(Amphibia: Pelobatidae) from China]. Journal of
Applied and Environmental Biology 6(2): 161-165.
(In Chinese)
Zheng, Z. H., L. Fei, C.Y. Ye, F. Xie and J. P. Jiang.
2002. [Comparative study of the sperm morphology
of Chinese Megophryinae and its taxonomical
implications (Amphibia: Pelobatidae)]. Acta
Zootaxonomica Sinica 27(1): 167-172. (In
Chinese)
Submitted: 07 December 2006
Accepted: 13 March 2007
pp.110-131
Asiatic Herpetological Research, Vol. 1 1
2008
The Herpetofauna of Nallamala Hills, Eastern Ghats, India: An
Annotated Checklist, With Remarks on Nomenclature, Taxonomy,
Habitat Use, Adaptive Types and Biogeography
C. Srinivasulu1 and Indraneil Das2’*
1 Wildlife Biology Section, Department of Zoology,
Osmania University, Hyderabad 500 007, Andhra Pradesh, India,
2 Institute of Biodiversity and Environmental Conservation,
Universiti Malaysia Sarawak, 94300 Kota Samarahan, Sarawak, Malaysia.
* Corresponding author E-mail: [email protected]; [email protected]
Abstract- We present an inventory of the herpetofauna of the Nallamala Hills, Eastern Ghats, south-eastern India. The
fauna, as currently known, includes 20 species of amphibians belonging to 14 genera in six families and 64 species
of reptiles belonging to 42 genera in 15 families. Divided in habitat types, the herpetofauna can be classified into
species tolerant of disturbed habitats; exclusively scrub species (and for reptiles, from rocky biotopes); scrub and bor-
dering agricultural fields; and exclusively mesic forest species. For one species, lack of ecological information pre-
cludes its allocation to a specific habitat category. Significant diversity of squamates (including gekkonids, scincids,
and colubrids) are known from these ranges, several of which endemic or largely restricted to scrub forests of
Peninsular India. Mesic forests remain poorly explored, and support hitherto undescribed species among the herpeto-
fauna. Adaptations seen amongst the herpetofauna of the Nallamala Hills include a diversity of dietary and habitat
types, including, among amphibians, ant specialists; predators of small vertebrates; folivores; fossorial; terrestrial;
aquatic or aquatic-margin; and arboreal forms. Amongst reptiles, adaptive types includes ant- and worm-eaters; pred-
ator of crop pests; predator of small or medium-sized vertebrate prey; egg-predators; fish-eaters; frog- and toad-
eaters; and one near-exclusive snake-eater. In terms of habitat usage, reptiles exceed amphibians in species richness,
on account of their greater capacity of surviving in relatively arid regions.
The Eastern Ghats contributes significantly to both species richness and endemicity of the Indian region, includ-
ing representatives of endemic genera and species. Nonetheless, these hills continue to receive less attention for con-
servation compared to the relatively better-known Western Ghats.
Keywords.- Amphibians, reptiles, biodiversity, ecology, Nallamala Hills, Eastern Ghats, India.
Introduction
Nallamala Hills (14° 26' - 16° 31' N and 78° 30' - 80° 10'
E) are a group of low hill ranges with an average altitude
of ca. 500 m in the central Eastern Ghats complex in the
state of Andhra Pradesh, south-eastern India (Fig. 1).
From the Palnad Basin in the north to the Tirupati Basin
in the south, the Nallamala Hills runs for a distance of
ca. 430 km with an average width of 30 km (Anon,
1965; Srinivasulu and Nagulu, 2002). An unbroken
chain of rugged hills with precipitous cliffs covering an
area of ca. 7,640 km2, it encompasses six districts
(Nalgonda, Mahbubnagar, Kurnool, Cuddapah,
Prakasam and Guntur) in Andhra Pradesh State.
Running parallel to it in the south-eastern side is the
Balapalli and Palakonda Ranges, while on the western
side, towards the north, are the Erramala Range. The
vegetation is typically of the southern tropical dry decid-
uous and southern tropical moist deciduous forest types
intermingled with scrub (Champion and Seth, 1968),
although the Nallamalas show representatives of many
vegetation types known from the Eastern Ghats, includ-
ing dry deciduous, moist deciduous, dry evergreen,
riverine and scrub forest (see R. K. Rao, 1998; R. S.
Rao, 1998). Dry deciduous forests are dominant.
Common species found here include Antidesma acidum,
Canthium parviflorum , Cerisoides turgida, Cissus palli-
da, Cochlospermum religiosum , Colebrookea oppositi-
folia, Dalbergia lanceolaris , Dalbergia paniculatum,
Diospyros melanoxylon, Ehretai laevis, Lagerstroemia
parviflora, Pterocarpus marsupium, Syzygium alterni-
folium, and Tamilnadia uliginosa. A forest type with
Boswellia serrata and Chloroxylon swietenia as the
dominant species occurs near Chalama, a Terminalia
coriacea and Anogeisus latifolia type occur in eastern
Nallamala, a Phoenix type with Phoenix loureivie as the
dominant species forming a pure stand on rocky substra-
ta occur between Ramannapenta and Gundla
Brahmeshwaram Metta Wildlife Sanctuary (GBM).
Moist deciduous forests are restricted to sheltered sites
with high rainfall such as GBM, upper Ahobilam and
Iskagundam; common species include: Careya arborea ,
© 2008 by Asiatic Herpetological Research
2008
Asiatic Herpetological Research, Vol. 1 1
17
16
- 15
14'
78'
79
80°
Figure 1. Maps showing the location of the Nallamala Hills, Andhra Pradesh, south-eastern India. On top left, map of
India, showing Andhra Pradesh State; on bottom left, map of Andhra Pradesh, showing location of Nallamala Hills; and
on right, the Nallamala Hills, with localities mentioned in the text.
Dillenia pentagyna. Ficus hispida, Barleria strigosa,
Adiantum lunulatum , Oroxylona indicum , Trema orien-
talis and Pimpinella wallichiana. The Nallamalas are
home to many endemic species of Eastern Ghats includ-
ing: Andrographis nallamalayana, Ericaulon lushing-
tonii, Dicliptera beddomei , Premna hamiltonii,
Euphorbia linearifolia var. nallamalayana ,
Rostellularia vahlii, Andrographis beddomei,
Rostellularia vahlii var. rupicola, Boswellia ovalifoliata,
Cycas beddomei, Chaemaesyce linearifolia,
Chaemaesyce senguptae, Crotalaria madurensis,
Cro talar ia paniculata nagarjunakondensis, Indigofer a
barberi, Pterocarpus santalinus, Albizia sikharamensis ,
and Eriolaena lushingtonii. Pterocarpus marsupium and
Cycas beddomii are well known endemics. Another
interesting feature of the flora is the exhibition of gigan-
tism as exemplified by the shrubby climber Marsdenia
tenacissima, the leaves of which measure up to 32 cm.
Other climbers such as Bauhinia vahlii and Enteda
pursetha are dominant over other vegetation. The cli-
mate is generally hot and dry with temperatures rising
up to 43-45°C during May and dropping to 8-12°C in
December. The Nallamala Hills receive on an average
900-1,000 mm rainfall annually.
The Nallamala Hill Range has been conveniently
divided into three zones (Fig. 1): i.) the Northern
Nallamala Hills (the expanse of hill ranges between the
Palnad Basin and the River Krishna that flows approxi-
mately 130 km through the hills); ii.) the Central
Nallamala Hills (the expanse of hill ranges between the
River Krishna and the British railway track between
Nandyal and Guntur passing through Chalama, Bogada.
and Diguvametta); and iii.) the Southern Nallamala Hills
(the expanse of hills between the British railway track
and the Tirupati basin near Rajampet (14 1 T N and 79°
10’ E). Two contiguous protected areas, the
Nagarjunasagar Srisailam Tiger Reserve and the Gundla
Brahmeshwaram Metta Wildlife Sanctuary (with a col-
lective area of 4,762 km2) have been set aside to con-
serve the rich biodiversity of this tract.
The first of the faunal surveys conducted in the
Nallamala Hills dates back to 1930 when the ornitholo-
gist, Salim Ali (1896-1987), of the Bombay Natural
History Society, collected bird specimens from
Mannanur and Farahabad on the Amrabad Plateau in the
Northern Nallamala Hills during the Hyderabad State
Ornithological Survey (see Lozupone et al., 2004, for a
gazetteer of localities; Srinivasulu and Nagulu, 2002).
112
Asiatic Herpetological Research, Vol. 1 1
2008
Subsequently, the Zoological Survey of India conducted
two faunistic surveys to collect vertebrate fauna in the
vicinity of the area in the Northern Nallamala Hills that
was to be submerged due to the construction of the
Nagarjunasagar Dam on River Krishna. Between 1980
to present date many surveys and other studies (Agrawal
and Bhattacharyya, 1976; Bhushan 1986, 1994;Murthy,
1968, 1986; Nagulu et al., 1998; Rao et ah, 1997; Rao et
al. 1999; Rao et ah, 2005; Rao et al., 2004a, b,c,d; Reddy
et al., 2004; Sharma, 1969, 1971, 1976; Srinivasulu and
Nagulu, 2002; Srinivasulu and Rao, 1999; Srinivasulu
and Rao, 2000; Srinivasulu, 2001b, 2002, 2003) have
been conducted documenting the faunal elements found
in the Nallamala Hills.
History of Herpetofaunal Studies
The earliest zoological collections from these hill ranges
were made by Thomas Claverhill Jerdon (1811-1872), a
member of the Asiatic Society, and also an important
contributor to mammalogy, ornithology, and herpetol-
ogy (see Das, 2004, for a brief biographic account).
Jerdon’s papers were published in the Journal of the
Asiatic Society of Bengal. As Civil Surgeon of Nellore
in 1842, Jerdon collected extensively in the then poorly-
known region between Madras and Nellore, discovering
many novelties amongst the vertebrate fauna, and most
famously, the Jerdon's courser, Rhinoptilus bitorquatus
(see an account in Bhushan, 2003). As a result of his col-
lections during the time, the following now familiar her-
petological species were described by Jerdon himself:
Microhyla rubra (Jerdon, 1854), Hoplobatrachus cras-
sus (Jerdon, 1854), Hemidactylus subtriedrus Jerdon,
1853, and Oligodon taeniolatus (Jerdon, 1853).
The Zoological Survey of India undertook the first
herpetological survey of the Nallamala Hills, between
1962 and 1963 (reported by Murthy, 1968; Sharma,
1969; 1971; 1976). As part of the Eastern Ghats
Herpetological Survey, Dr. Hem Singh Pruthi (7-1953),
Plant Protection Adviser to the Government of India and
entomologist with the ZSI (see Lai, 1954, for an obitu-
ary), collected herpetofauna from the Nallamala Hills in
1929 which were identified by Dr. Malcolm Arthur
Smith. Under the State Faunal Diversity Documentation
Project, initiated by the Survey, additional specimens
were collected from localities in the Nallamala Hills
(Murthy, 1986; Sanyal et al., 1993; Sarkar et al., 1993).
The first author of the present report made observa-
tions on the herpetofauna of Northern and Central
Nallamala Hills between late 1995 and early 2000. A
research team from the Department of Zoology,
Osmania University, Hyderabad, also documented the
herpetofaunal diversity while executing an Andhra
Pradesh Forest Department-sponsored project on the
effects of man-made barriers on wildlife in Gundla
Brahmeshwaram Metta Wildlife Sanctuary in the
Central Nallamala Hills, between 1998 and 2000.
Observations on the herpetofaunal diversity made dur-
ing these two studies between 1995 and 2000 have been
listed in an unpublished document (Srinivasulu, 2001a).
The Andhra Pradesh Forest Department, in collaboration
with Department of Botany, Sri Krishnadevaraya
University, Anantapur (for flora) and Department of
Zoology, Osmania University, Hyderabad (for fauna)
initiated All Taxa Biodiversity Inventorization Project in
2001 (Rao et al., 2004e) in which the first author was
involved. Voucher specimens of amphibians and reptiles
collected during this project have been deposited in the
State Forest Department’s Eco-Resource Monitoring
Lab, located in Sunnipenta, Kumool District. Between 3
- 16 June 2003, CS along with a research scholar from
Zoological Survey of India, Hyderabad, and other vol-
unteers visited Nagarjunasagar Srisailam Tiger Reserve
to study the voucher specimens of the herpetofauna in
Eco-Resource Monitoring Lab, Sunnipenta and collect
fresh voucher specimens to be deposited in the National
Zoological Collection housed at the Freshwater
Biological Station of the Zoological Survey of India,
Hyderabad, India (Srinivasulu et al., 2006).
Materials and Methods
Literature review and faunistic surveys by the first
author for acquiring voucher specimens, both for the
Andhra Pradesh Forest Department (January 2001 to
June 2003) and the Zoological Survey of India (June
2003), and records of observations made by the first
author between December 1995 to December 2004 in
the Nallamala Hills form the basis of the diversity of
herpetofauna reported here. Voucher specimens collect-
ed following techniques detailed in Heyer et al. (1994),
including collections along 100-200 m transects and
sampling within 50 sq m quadrats, at elevations between
150-570 m ASL. Vegetation in the area of sampling is
dry deciduous and scrub forest types. Several moist
decidous forest patches were also surveyed, including
along seasonal streams, particularly for amphibians.
Specimens were preserved and were deposited both at
the State Forest Department Collection housed at ERM
Labs, Sunnipenta, Kumool District and the National
Zoological Collection at the Freshwater Biological
Station, Zoological Survey of India, Hyderabad. Certain
large-growing (and threatened/protected) species con-
sidered easily-identifiable in the field (e.g., Crocodylus
palustris and Python molurus) were not collected.
Photographic vouchers were deposited in the Natural
History Museum at the Department of Zoology,
Osmania University, Hyderabad. All records from the
southern Nallamala Hills are based on sight records.
2008
Asiatic Herpetological Research, Vol. 1 1
113
The annotated lists of amphibians and reptiles pro-
vided below include information on their distribution in
the Nallamala Hills, their habitat and qualitative impres-
sions of abundance. Details of the vouchers are also pro-
vided. It the voucher specimen/s and/or photographic
voucher are present, they are indicated by [S] or [P] fol-
lowed by abbreviation of the place where housed.
Abbreviations used include: ZSIK (National Zoological
Collection, Zoological Survey of India, Kolkata), ZSIH
(National Zoological Collection, Freshwater Biological
Station, Zoological Survey of India, Hyderabad), ERM
(Eco-Resource Monitoring Lab, Andhra Pradesh Forest
Department, Sunnipenta), and NHMOU (Natural
History Museum, Department of Zoology, Osmania
University, Hyderabad). Nomenclatural remarks con-
cerning species are for those names that are different
from that generally prevailing in the literature in Indian
herpetology, especially the Fauna of British India vol-
umes by Smith (1931-43).
Results
The herpetofauna of the Nallamala Hills, as currently
known, includes 20 species of amphibians belonging to
12 genera in four families and 64 species of reptiles
belonging to 42 genera in 1 5 families. Recently, Rao et
al. (2005) published an account of herpetofauna of the
Nallamala Hills putting on record about 66 species of
herpetofauna (including 1 8 species of amphibians in 1 1
genera in 4 families and 48 species of reptiles in 34 gen-
era in 12 families) based on collections made from 16
locations between 15° 35'N (Isukagundam) to 16° 37' N
(Vijayapuri) and 78° 39'E (Saileshwaram) to 79° 17' E
(Vijayapuri) between November 2001 and September
2004. Rao et al.’s (2005) paper suffers from numerous
problems (including misidentifications and erroneous
nomenclature, in addition to dubious first record
claims), and grossly under-represents the herpetofauna
of the region, while ignoring to emphasize the endemic
reptiles of the Nagaijunasagar area.
Of the herpetofaunal species listed in this work,
voucher specimens of 76 species are either at the
National Zoological Collection of the Zoological Survey
of India, at Kolkata (48 species) and Hyderabad (20
species) or in the Eco-Resource Monitoring Laboratory,
Sunnipenta (62 species). Vouchers of 1 1 species are at
Kolkata, and 14 are at Sunnipenta. Eight taxa listed in
this report are either based on literature reports or on
sightings.
Annotated List of Amphibians
Order: Anura
Family: Bufonidae
1. Bufo stomaticus Liitken, 1862
Bufo stomaticus C. F. Liitken. 1862. Vidensk. Meddr.
Danske Naturh. Foren. 1862: 305.
Northern (Sarkar et al., 1993; Srinivasulu et al., 2006),
Central (Srinivasulu et al., 2006) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ZSIK (A1844, Al 141), ZSIH
(ZSI/FBS/N/1 148, 1150-1153).
2. Bufo scaber Schneider, 1799
Bufo scaber J. G. Schneider. 1799. Hist. Nat. Amph.:
222.
Northern (Srinivasulu et al., 2006), Central (Rao et al.,
2005; Srinivasulu et al., 2006) and Southern Nallamala
Hills. Scrub, open forests and near agricultural fields.
Uncommon. [S] ERM (ERMA-5a); [P] NHMOU
(NHMOU. Amph. P. 1-03).
Remarks: First record claim from the region by Rao et
al. (2005) is erroneous as it has been already reported
from the Nallamala Hills by Subba Rao et al. (1994).
Dubois and Ohler (1999) showed that Bufo scaber
Schneider, 1799 has priority over Bufo fergusonii
Boulenger, 1892.
3. Duttaphrynus melanostictus (Schneider, 1799):
Bufo melanostictus J. G. Schneider. 1799. Hist. Nat.
Amph.: 216.
Northern (Rao et al., 2005; Sarkar et al., 1993;
Srinivasulu et al., 2006), Central (Rao et al., 2005;
Sarkar et al., 1993; Srinivasulu et al., 2006) and
Southern Nallamala Hills. Scrub, open forests and near
agricultural fields. Abundant. [S] ZSIK (A 1144, A1145,
Al 845, A1997-98, A8373-75, A8377-81), ERM
(ERMA-1 a).
Family: Dicroglossidae
4. Euphylyctis cyanophlyctis (Schneider, 1799)
Rana cyanophlyctis J. G. Schneider. 1799. Hist. Nat.
Amph.: 137.
Northern (Rao et al., 2005; Sarkar et al., 1993;
Srinivasulu et al., 2006), Central (Rao et al., 2005;
Sarkar et al., 1993; Srinivasulu et al., 2006) and
Southern Nallamala Hills. Scrub, open forests and near
agricultural fields. Abundant. [S] ZSIK (A6941, A6943,
A 1948, A8424-26, Al 108-13, A1130, A1989, A7810-
11, A6947, Al 131-32, A1830-34, A1838, A1941-47),
114
Asiatic Herpetological Research, Vol. 1 1
2008
ERM (ERMA-3a); [P] NHMOU (NHMOU.Amph.P.7-
03).
Remarks: Euphlyctis Fitzinger, 1843 was revived from
synonymy of Rana Linnaeus, 1758 by Dubois (1992).
5. Euphylyctis hexadactylus (Lesson, 1834)
Rana hexadactyla R. P. Lesson. 1834. Voyage Indes-
Orient.: 331.
Northern (Rao et al., 2005; Srinivasulu et al., 2006),
Central (Rao et al., 2005; Srinivasulu et al., 2006) and
Southern Nallamala Hills. Scrub, open forests and near
agricultural fields. Abundant. [S] ERM (ERMA-1 0a);
[P] NHMOU (NHMOU. Amph. P.8-03).
6. Fejervarya cf. limnocharis (Gravenhorst, 1829)
Rana limnocharis J. L. C. Gravenhorst. 1829. Rept.
Mus. Zool. Vratis. Delic. Mus. Zool: 42.
Northern (Sarkar et al., 1993; Srinivasulu et al., 2006),
Central (Rao et al., 2005; Srinivasulu et al., 2006) and
Southern Nallamala Hills. Scrub, open forests and near
agricultural fields. Common. [S] ZSIK (A8438-40,
A7813-14, A1990, A6946), ERM (ERMA-1 7a); [P]
NHMOU (NHMOU. Amph. P.9-03).
Remarks: Fejervarya Bolkay, 1915 was recognized as a
subgenus of Rana Linnaeus, 1758 by Dubois (1992),
and as a genus by Iskandar (1998).
7. Hoplobatrachus crassus (Jerdon, 1854) Jerdon’s
Bull Frog
Rana crassa T. C. Jerdon. 1854. J. Asiatic Soc. Bengal
22(5): 531.
Northern (Sanyal et al., 1993; Srinivasulu et al., 2006),
Central (Rao et al., 2005) and Southern Nallamala Hills.
Scrub, open forests and near agricultural fields.
Abundant. [S] ZSIK (A1843, A6945, A8409-14), ERM
(ERMA-1 3a); [P] NHMOU (NHMOU. Amph.P. 10-03).
Remarks: Hoplobatrachus Peters, 1863 was revived
from synonymy of Rana Linnaeus, 1758 by Dubois
(1992). See also Grosjean et al. (2004).
8. Hoplobatrachus tigerinus (Daudin, 1803)
Rana tigerina F.-M. Daudin. 1803. Hist. Nat.: 64; PI.
XX.
Northern (Sanyal et al., 1993; Srinivasulu et al., 2006),
Central (Rao et al., 2005; Sanyal et al., 1993;
Srinivasulu et al., 2006) and Southern Nallamala Hills.
Scrub, open forests and near agricultural fields.
Abundant. [S] ZSIK (A6944, A8443^5, Al 138-39,
A 1995), ZSIH (ZSI/FBS/N/1 145), ERM (ERMA-1 5a).
9. Sphaerotheca breviceps (Schneider, 1799)
Rana breviceps J. G. Schneider. 1799. Hist. Nat. Amph.:
140.
Northern (Srinivasulu et al., 2006), Central (Rao et al.,
2005; Sanyal et al., 1993; Srinivasulu et al., 2006) and
Southern Nallamala Hills. Scrub, open forests and near
agricultural fields. Abundant. [S] ZSIK (A8400, A8448,
A 1940), ZSIH (ZSI/FBS/N/1 143, 1144, 11461, 1147,
1155-58), ERM (ERMA-12a); [P] NHMOU
(NHMOU.Amph.P. 11-03).
Remarks: Rao et al. (2005) included an erroneously
identified photograph (image 13 at www.zoosprint.org/),
which is, in fact, that of Sphaerotheca dobsoni, a taxon
that also is present in the Nallamala Hills (see below). In
support of long-separated evolutionary lineages, repre-
senting distinct monophyletic radiations of the Africa,
Madagascar and southern Asia, Vences et al. (2000)
argued for the partition of Tomopterna into three lineag-
es. Thus, the earliest available name for the Asian
species is Sphaerotheca.
10. Sphaerotheca dobsonii (Boulenger, 1882)
Rana dobsonii G. A. Boulenger. 1882. Cat. Bat. British
Mus.: 32; PI. 3, Fig. 1.
Northern (Srinivasulu et al., 2006), Central (Srinivasulu
et al., 2006) and Southern Nallamala Hills. Scrub, open
forests and near agricultural fields. Uncommon. [P]
NHMOU (NHMOU.Amph.P. 12-03).
11. Sphaerotheca rolandae (Dubois, 1983)
Rana ( Tomopterna ) rolandae A. Dubois. 1983. Alytes:
2(4): 163.
Northern (Srinivasulu et al., 2006), Nallamala Hills.
Open forests. Rare. [P] NHMOU
(NHMOU.Amph.P. 1 3-03).
Remarks: Rao et al.’s (2005) claim of this taxon (as
Tomopterna rolandae) as the first record from Andhra
Pradesh is based on erroneous identification. The vouch-
er specimen and the photograph included in the report
are that of Sphaerotheca breviceps (image 14 at
www.zocsprint.org /).
Family: Microhylidae
12. Kaloula taprobanica Parker, 1934
Kaloula pulchra taprobanica H. W. Parker. 1934.
Monogr. Frogs. Microhylidae: 86.
Northern (Rao et al., 2005) and Central (Rao et al.,
2005; Srinivasulu et al., 2006) Nallamala Hills. Open
forests and scrub areas. Uncommon. [S] ZSIH
(ZSI/FBS/N/1 159), ERM (ERMA^la); [P] NHMOU
(NHMOU. Amph. P.2-03).
Remarks: The first record of its occurrence in Andhra
Pradesh reported by Rao et al. (2005) is erroneous, as
Sivakumar et al. (2003) had reported its occurrence in
the State from Sriharikota Island Nellore District. Rao et
al. (in review, a) puts on record for its occurrence in the
Nallamala Hills.
2008
Asiatic Herpetological Research, Vol. 1 1
115
13. Microhyla ornata (Dumeril and Bibron, 1841)
Engystoma ornatum A.-M.-C. Dumeril & G. Bibron.
1841. Erp. Gen. 8: 745.
Northern (Sarkar et al., 1993; Srinivasulu et al., 2006),
Central (Rao et al., 2005; Sarkar et al., 1993; Srinivasulu
et al., 2006) and Southern Nallamala Hills. Scrub, open
lorests and near agricultural fields. Common. [S] ZSIK
(Al 846-M-8, A7817, A8451, A1140, A1996), ZSIH
(ZSI/FBS/N/1 141, 1160), ERM (ERMA-8a); [P]
NHMOU (NHMOU.Amph. P.3-03).
14. Microhyla rubra (Jerdon, 1854)
Engystoma rubrum T. C. Jerdon. 1854. J. Asiatic Soc.
Bengal 22(2): 534.
Northern (Srinivasulu et al., 2006), Central (Rao et al.,
2005; Sarkar et al., 1993; Srinivasulu et al., 2006) and
Southern Nallamala Hills. Scrub, open forests and near
agricultural fields. Uncommon. [S] ZSIK (A8463-64),
ERM (ERMA-6a); [P] NHMOU (NHMOU.Amph.P.4-
03).
15. Ramanella variegata (Stoliczka, 1872)
Callula variegata F. Stoliczka. 1872. Proc. Asiatic Soc.
Bengal 1872(6): 111.
Central (Srinivasulu et al., 2006) and Southern
Nallamala Hills. Scrub and open to close forests.
Uncommon. No vouchers, based on sightings.
16. Uperodon globulosus (Gunther, 1864)
Cacopus globulosus A. C. L. G. Gunther. 1864. Reptiles
British India: 416.
Central (Rao et al., 2005; Srinivasulu et al., 2006;
Srinivasulu et al., 2006) Nallamala Hills. Scrub and
open forests. Rare. [S] ZSIH (ZSI/FBS/N/1 138), ERM
(ERMA-7a); [P] NHMOU (NHMOU.Amph.P.5-03).
17. Uperodon systoma (Schneider, 1799)
Rana systoma J. G. Schneider. 1799. Hist. Nat. Amph.:
144.
Northern (Rao et al., 2005; Srinivasulu et al., 2006),
Central (Rao et al., 2005; Srinivasulu et al., 2006) and
Southern Nallamala Hills. Scrub, open forests and near
agricultural fields. Common. [S] ZSIH
(ZSI/FBS/N/1 142, 1149, 1154), ERM (ERMA-2a); [P]
NHMOU (NHMOU. Amph. P.6-03).
Family: Petropedetidae
18. Indirana leithii (Boulenger, 1888)
Rana leithii G. A. Boulenger. 1888. Ann. & Mag. nat.
Hist. Ser. 6, 2: 506.
Northern (Srinivasulu et al., 2006) and Central
(Srinivasulu et al., 2006) Nallamala Hills. Scrub forests.
Rare. [S] ERM (ERM/A24).
Remarks: Indirana Laurent, 1986 was revived from syn-
onymy of Rana Linnaeus, 1758 by Dubois (1992). This
species had been sighted on two occasions near
Rollapenta in Central Nallamalla Hills and on one occa-
sion near Ahobilam in Southern Nallamala Hills by the
first author (Srinivasulu et al., 2006), who has also stud-
ied a single specimen in the collection of ERM Labs
(ERM/A24), Sunnipenta that had been identified by
Varad Giri of the BNHS.
Family: Ranidae
19. Hylarana sp.
Central (Rao et al., 2005; Rao et al., in review, b)
Nallamala Hills. Riparian forest. Rare. [S] ERM
(ERMA-14a).
Remarks: The systematic status of the population,
referred to Rana temporalis (Gunther, 1864) by previous
workers, is under study by the second author, who
assigns it to Dubois' (1992) subgenus Sylvirana, elevat-
ed to generic rank in Frost et al. (2006). Currently this
generic name is a synonym of Hylarana (See Frost et al.,
2007).
Family: Rhacophoridae
20. Polypedates maculatus (Gray, 1834)
Hyla maculata J. E. Gray. 1834. 111. Indian Zook: PI.
LXXXII; Fig. 1.
Northern (Rao et al., 2005; Sanyal et al., 1993;
Srinivasulu et al., 2006), Central (Rao et al., 2005;
Sanyal et al., 1993; Srinivasulu et al., 2006) and
Southern Nallamala Hills. Scrub, open forests and near
agricultural fields. Abundant. [S] ZSIK (A8403), ZSIH
(ZSI/FBS/N/1 140, 1161), ERM (ERMA-lla); [P]
NHMOU (NHMOU.Amph.P. 14-03).
Annotated List of Reptiles
Order: Crocodilia
Family: Crocodylidae
1. Crocodylus palustris Lesson, 1831
Crocodylus palustris R. P. Lesson. 1831. Bull. Sci. Nat.
Geol. 25: 121.
Northern Nallamala Hills. Under the Central
Government sponsored crocodile rehabilitation pro-
gramme, some crocodiles were reintroduced both at
backwaters of Nagarjunasagar Reservoir in Vijaypuri
vicinity, Srisailam Reservoir and Ethipothala (described
by Srinivas et al., 1999). Their numbers have dwindled
due to poaching, but some crocodiles do survive in both
these areas. No vouchers, based on the literature and
indirect evidence.
116
Asiatic Herpetological Research, Vol. 1 1
2008
Order: Chelonia
Family: Geoemydidae
2. Melanochelys trijuga (Schweigger, 1812)
Emys trijuga A. F. Schweigger. 1812. Prod. Monogr.
Chel.: 310.
Northern, Central and Southern Nallamala Hills.
Waterbodies, streams and rivers. Uncommon. No vouch-
ers, based on sightings.
Remarks: Assumed, on the basis of locality, to belong to
the nominotypical form.
3. Pangshura tentoria (Gray, 1834)
Emys tentoria J. E. Gray. 1834. Proc. Zool. Soc. London
1834(2): 54.
Northern, Central and Southern Nallamala Hills.
Waterbodies, streams and rivers. Uncommon. No vouch-
ers, based on sightings.
Remarks: Allocated to Pangshura Gray, 1869 rather
than Kachuga Gray, 1856 by Spinks et al. (2004).
Family: Testudinidae: Tortoises
4. Geochelone elegans (Schoepff, 1795)
Testudo elegans J. D. Schoepff. 1795. Hist. Test. 3: 111;
PI. XXV.
Northern (Rao et al., 2005), Central (Rao et al., 2005)
and Southern Nallamala Hills. Scrub forests and near
agricultural fields. Common. [S] ERM (ERMR-5a).
Remarks: First reported from the Nallamala Hills by
Subba Rao et al. (1994).
Family: Trionychidae
5. Nilssonia gangetica (Cuvier, 1825)
Trionyx gangeticus G. L. C. F. D. Cuvier. 1825.
Recherch Ossemens Foss. 5: 203.
Northern Nallamala Hills (Sharma, 1971). Waterbodies,
streams and rivers. Uncommon. [S] ZSIK (R21238).
Remarks: The generic nomen Aspideretes Hay, 1904,
was revived from the synonymy of Trionyx Geoffroy
Saint-Hillaire, 1809 by Meylan (1987). Praschag et al.
(2007) placed Aspideretes in the synonymy of Nilssonia,
but provided an incorrect (feminine) termination of the
species name.
6. Nilssonia leithii (Gray, 1872)
Trionyx Leithii J. E. Gray. 1872. Ann. & Mag. nat. Hist,
ser. 4 10: 334.
Northern (Sharma, 1971; Sanyal et al., 1993) and
Southern Nallamala Hills. Waterbodies, streams and
rivers. Uncommon. [S] ZSIK (R21403).
7. Lissemys punctata (Bonnaterre, 1789)
Testudo punctata M. Bonnaterre. 1789. Tableau Encycl.
Method. Nat.: 30.
Northern (Sanyal et al., 1993), Central and Southern
Nallamala Hills. Waterbodies, streams and rivers.
Common. [S] ZSIK (Specimen not traceable).
Order: Squamata
Family: Agamidae
8. Calotes rouxii (Dumeril & Bibron, 1837)
Calotes rouxii A.-M.-C. Dumeril & G. Bibron. 1837.
Erp. Gen. 4: 407.
Northern (Rao et al., 2005), Central (Rao et al., 2005)
and Southern Nallamala Hills. Rocky outcrops in open
and scrub forests, and agricultural fields. Common. [S]
ZSIH (ZSI/FBS/N/1 172), ERM (ERMR-lOa); [P]
NHMOU (NHMOU. Rep. P. 1-03).
9. Calotes versicolor (Daudin, 1802)
Agama versicolor F.-M. Daudin. 1802. Hist. nat. Rept.
3: 395; PI. XLIV.
Northern (Rao et al., 2005; Sharma, 1971; Sanyal et al.,
1993), Central (Rao et al., 2005) and Southern
Nallamala Hills. Rocky outcrops in open and scrub
forests, and agricultural fields. Abundant. [S] ZSIK
(R20249-60, R20181-85, R21286-88, R21289,
R21431-33, R21367, R21275, R21434-35, R21276,
R2 1422-25, R21277-80, R21368-70, R21281,
R21283-85, R24456, R20293, R20214-15), ZSIH
(ZSI/FBS/N/1 165, 1169), ERM (ERMR-12a).
10. Psammophilus blanfordanus (Stoliczka, 1871)
Charasia blanfordana F. Stoliczka. 1871. Proc. Asiatic
Soc. Bengal 1871(9): 194.
Northern (Sanyal et al., 1993; Sharma, 1971), Central
and Southern Nallamala Hills. Rocky outcrops in open
and scrub forests. Common. [S] ZSIK (R21436,
R24685, R24659).
11. Psammophilus dorsalis (Gray in Griffith &
Pidgeon, 1831)
Agama Dorsalis J. E. Gray in: E. Griffith & E. Pidgeon.
1831. Class Reptilia 9: 56.
Northern (Rao et al., 2005; Sharma, 1971), Central (Rao
et al., 2005) and Southern Nallamala Hills. Rocky out-
crops in open and scrub forests. Common. [S] ZSIK
(R21291, R20295), ERM (ERMR-lla).
12. Sitana ponticeriana Cuvier, 1829
Sit. (= Sitana ) ponticeriana G. J.-L.-N.-F. D. Cuvier.
1829. Reg. Anim. 2: 43.
Northern (Rao et al., 2005; Shanna, 1971; Sanyal et al..
2008
Asiatic Herpetological Research, Vol. 11
117
1993), Central (Rao et al., 2005; Sanyal et al., 1993) and
Southern (Sanyal et al., 1993) Nallamala Hills. Rocky
outcrops in open and scrub forests and agricultural
fields. Abundant. [S] ZSIK (R20284, R21256, R21270,
R21413-15, R2 127-72, R21348-50, R21267, R21257,
R2 1 4 1 9-2 1 , R2 1258-61, R21253-56, R21269,
R21357-64, R24436, R24439, R20178, R20216,
R2 1262-68, R21352, R21416, R21357-62, R24668,
R24455, R24462, R20223, R20294, R24684), ZSIH
(ZSI/FBS/N/1 166, 1170, 1171), ERM (ERMR-9a); [P]
NHMOU (NHMOU. Rep. P.2-03).
Family: Chamaeleonidae
13. Chamaeleo zeylanicus Laurenti, 1768
Chamaeleo zeylanicus J. N. Laurenti. 1768. Syn. Rept.:
46.
Northern (Rao et al., 2005), Central (Rao et al., 2005)
and Southern Nallamala Hills. Open and scrub forests,
and agricultural fields. Common. [S] ERM (ERMR-
13a); [P] NHMOU (NHMOU.Rep.P.1-01).
Family: Gekkonidae
14. Cnemaspis sp.
Remarks: An unidentified species of Cnemaspis was
encountered in Central and Southern Nallamala Hills.
Three specimens that were collected by the first author,
deposited in the Eco-Resources Monitoring Labs,
Sunnipenta in March 2002, were lost due to attack by
ants. Specimens were collected from the leaf litter in a
dry stream near Chinnarutla. Rare. [S] ERM (Lost).
Cnemaspis otai Das and Bauer (2000) is known from
Vellore region, in extreme northern Tamil Nadu State,
adjacent to Andhra Pradesh, and the Nallamala speci-
mens may be either this nominal species, or an unde-
scribed species.
15. Hemidactylus bowringii (Gray, 1845)
Doryura bowringii J. E. Gray. 1845. Cat. Lizards British
Mus.: 156.
Northern (Sanyal et al., 1993) Nallamala Hills. Inhabits
human-altered habitats and other dilapidated man-made
structure. Rare. [S] ZSIK (R24465).
16. Hemidactylus brookii (Gray, 1845)
Hemidactylus brookii J. E. Gray. 1845. Cat. Lizards
British Mus.: 153.
Northern (Rao et al., 2005; Sharma, 1971; Sanyal et al.,
1993), Central (Rao et al., 2005) and Southern
Nallamala Hills. Open forests, old temples, also human
commensal, found in houses and other dilapidated man-
made structures. Abundant. [S] ZSIK (R2 1240-44,
R24669, R2 1404-05, R23237, R24435, R20179,
R23687, R23699), ZSIH (ZSI/FBS/N/1 174), ERM
(ERMR-2a).
17. Hemidactylus flaviviridis Riippell, 1835
Hemidactylus flaviviridis E. Riippell. 1835. Neue
Wirbelth. -Fauna Abyss., Amph. 18: PI. 6; Fig. 2.
Northern, Central (Rao et al., 2005) and Southern
Nallamala Hills. Human commensal, found in houses
and other man-made structures. Uncommon. [S] ZSIH
(ZSI/FBS/N/1 173), ERM (ERMR-3a).
18. Hemidactylus frenatus Dumeril & Bibron, 1836
Hemidactylus frenatus A.-M.-C. Dumeril & G. Bibron.
1836. Erp. Gen. 3: 366.
Northern (Sanyal et al., 1993), Central (Rao et al., 2005)
and Southern Nallamala Hills. Open forests, old tem-
ples, also human commensal, found in houses and other
dilapidated man-made structures. Common. [S] ZSIK
(R23700), ERM (ERMR-30a).
19. Hemidactylus giganteus Stoliczka, 1871
Hemidactylus giganteus F. Stoliczka. 1871. Proc. Asiatic
Soc. Bengal 1871(9): 193.
Northern (Rao et al., 2005; Sanyal et al., 1993), Central
(Rao et al., 2005) and Southern Nallamala Hills. Open
forests, old temples, and other dilapidated man-made
structures. Uncommon. [S] ZSIK (R21411-12), ZSIH
(ZSI/FBS/N/1 167, 1168), ERM (ERMR-la).
20. Hemidactylus leschenaultii Dumeril & Bibron,
1836
Hemidactylus leschenaultii A.-M.-C. Dumeril & G.
Bibron. 1836. Erp. Gen. 3: 364.
Northern (Rao et al., 2005; Sanyal et al., 1993), Central
(Rao et al., 2005) and Southern Nallamala Hills. Open
forests, old temples, also human commensal, found in
houses and other dilapidated man-made structures.
Common. [S] ZSIK (R20180, R23693, R24458,
R24466, R24660, R24510, R24513), ERM (ERMR— 4a).
21. Hemidactylus reticulatus Beddome, 1870
Hemidactylus reticulatus R. H. Beddome. 1870. Madras
Monthly J. Med. Sci. 1: 33.
Northern (Sanyal et al., 1993), Central (Rao et al., 2005)
and Southern Nallamala Hills. Rocky outcrops in open
and scrub forests. Uncommon. [S] ZSIK (R2 1245-46,
R2 1247-53, RR21346, R21343-45, R21406-10,
R23216), ERM (ERMR-17a).
22. Hemidactylus triedrus (Daudin, 1802)
Gecko triedrus F.-M. Daudin. 1802. Hist. nat. Rept. 4:
155.
Northern (Rao et al., 2005; Sanyal et al., 1993), Central
(Rao et al., 2005) and Southern Nallamala Hills. Scrub,
open forests and near agricultural fields. Common. [S]
118
Asiatic Herpetological Research, Vol. 1 1
2008
ZSIK (21239, R24509, R24512), ERM (ERMR-7a).
Family: Lacertidae
23. Ophisops jerdoni (Blyth, 1853)
Ophisops jerdoni E. Blyth. 1853. J. Asiatic Soc. Bengal
22: 653.
Northern (Rao et al., 2005; Sanyal et al., 1993; Sharma,
1971), Central (Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Abundant. [S] ZSIK (R21302-14, R21381-92,
R21440, R24661, R24670), ZSIH (ZSI/FBS/N/1 176-
1178), ERM (ERMR-18a).
24. Ophisops leschenaultii (Milne-Edwards, 1829)
Lacerta leschenaultii H. Milne-Edwards. 1829. Ann.
Sci. nat. 16: 86; PI. VI; Fig. 9.
Northern (Sanyal et al., 1993; Sharma, 1971), Central
(Murthy, 1986) and Southern Nallamala Hills. Scrub,
open forests and near agricultural fields. Uncommon.
[S] ZSIK (R2 1296-97, R21438-39).
25. Ophisops minor (Deraniyagala, 1971)
Cabrita jerdoni minor P. E. P. Deraniyagala. 1971.
Ceylon J. Sci. 32(1): 104; Fig. 1.
Northern (Rao et al., 2005; Sanyal et al., 1993; Sharma,
1971), Central (Rao et al., 2005; Sanyal, et al., 1993)
and Southern Nallamala Hills. Scrub, open forests and
near agricultural fields. Common. [S] ZSIK (R21298-
301, R2 1377-80, R24440, R24459, R24464), ERM
(ERMR-8a).
Remarks: Reviewed by Bohme and Bischoff (1991). See
also nomenclatural remarks in Arnold (1989).
Family: Scincidae
26. Lygosoma ashwamedhi Sharma, 1969
Riopa ashwamedhi R. C. Sharma. 1969. Bull. Syst.
Zook, Calcutta 1(2): 73; Fig. 2.
Endemic to Andhra Pradesh, known only from type
locality. Northern (Sharma, 1969, 1971; Sanyal et al.,
1993) Nallamala Hills. Rocky scrub forests. Rare. [S]
ZSIK (R2 11 73-77, R21179).
27. Lygosoma guentheri (Peters, 1879)
Eumeces guntheri W. C. H. Peters. 1879. S.-Ber. Ges.
Naturf. Freunde Berlin 1879(3): 36.
Central (Rao et al., 2005) Nallamala Hills. Scrub forest.
Rare. [S] ERM (ERMR^13a).
Remarks: Hitherto known only from the Western Ghats,
from Gujarat to Kerala States (Daniel and Shull,
"1963"; 1964; Daniel, 1962; Smith, 1935: 322), this is
the first record of the species from the Eastern Ghats,
28. Lygosoma punctata (Linnaeus, 1758)
Scincus punctatus C. Linnaeus. 1758. Syst. Nat. 10th ed.
1: 209.
Northern (Sanyal et al., 1993; Sharma, 1971), Central
and Southern Nallamala Hills. Scrub, open forests and
near agricultural fields. Common. [S] ZSIK(21294,
R21376, R20327, R20318), ZSIH (ZSI/FBS/N/1175);
[P] NHMOU (NHMOU. Rep. P.3-03).
29. Eutropis carinata (Schneider, 1801)
Scincus carinatus J. G. Schneider. 1801. Hist. Amphib.:
183.
Northern (Rao et al., 2005; Sanyal et al., 1993; Sharma,
1971), Central (Rao et al., 2005; Sanyal et al., 1993) and
Southern Nallamala Hills. Scrub, open forests and near
agricultural fields. Common. [S] ZSIK (R2 1292-93,
R21373-75, R21437, R20313, R21437, R24438,
R24457, R24463, R23694, R24511), ZSIH
(ZSI/FBS/N/1 179, 1180), ERM (ERMR-15a); [P]
NHMOU (NHMOU. Rep. P.4-03).
Remarks: Mausfeld et al. (2002) suggested partitioning
the genus Mabuya Fitzinger, 1826 into several genera,
allocating the Asian species to Eutropis Fitzinger, 1843.
30. Eutropis macularia (Blyth, 1853)
Euprepes macularius E. Blyth. 1853. J. Asiatic Soc.
Bengal 22: 652.
Northern (Sanyal et al., 1993; Rao et al., 2005), Central
(Sanyal et al., 1993; Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ZSIK (R24437, R23701), ERM
(ERMR-16a).
31. Eutropis nagarjuni Sharma, 1969
Mabuya nagarjuni R. C. Sharma. 1969. Bull. Syst.
Zook, Calcutta 1(2): 71; Fig. 1.
Endemic to Andhra Pradesh. Northern (Sanyal et al,
1993; Sharma, 1969, 1971) Nallamala Hills. Rocky
scrub forests. Rare. [S] ZSIK (R2 11 70-72), ZSIH
(ZSI/FBS/N/1 164); [P] NHMOU (NHMOU. Rep. P.5-
03).
Remarks: The photo purported to be of Mabuya bed-
domei (Jerdon, 1870) in Rao et al. (2005; image 30 at
www.zoosprint.org/) is that of Eutropis nagarjuni
(Sharma, 1969), as shown by Srinivasulu et al. (2005).
Family: Varanidae
32. Varanus bengalensis (Daudin, 1802)
Tupinambis bengalensis F.-M. Daudin. 1802. Hist. nat.
Rept. 3: 67.
Northern (Rao et ah, 2005; Sanyal et ah, 1993; Sharma,
1971), Central (Rao et ah, 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
2008
Asiatic Herpetological Research, Vol. 11
119
al fields. Common. [S] ZSIK (R21315, R21441-42),
ERM (ERMR-26a).
Remarks: For a history of the name Varanus monitor
Linnaeus, 1758, a junior synonym of Tupinambis ben-
galensis Daudin, 1802, see Mertens ( 1946; 1956; 1957)
and Sprackland (1982).
Family: Boidae
33. Eryx conicus (Schneider, 1801)
Boa conica J. G. Schneider. 1801. Hist. Amphib. 2: 268.
Northern (Rao et al., 2005; Sanyal et al., 1993; Sharma,
1971), Central (Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ZSIK (R21331), ERM (ERMR-
14a).
34. Eryx johnii (Russell, 1801)
Boa Johnii R Russell. 1801. Continuation Account
Indian Serpents: 18; PI. xvi-xvii.
Northern (Rao et al., 2005; Sanyal et al., 1993; Sharma,
1971), Central (Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ZSIK (R2 1332-33), ERM
(ERMR-22a).
Family: Pythonidae
35. Python molurus (Linnaeus, 1758)
Coluber molurus C. Linnaeus. 1758. Syst. Nat. 10th ed.
1: 225.
Northern, Central (Rao et al., 2005) and Southern
Nallamala Hills. Rocky scrub, open forests and near
agricultural fields. Uncommon. No vouchers collected,
based on sightings.
Family: Colubridae
36. Ahaetulla nasuta (Lacepede, 1789)
Coluber nasuta B.-G.-E. de L. V.-S.-I. Lacepede. 1789.
Hist. Nat. Serp. 1: 100.
Northern, Central and Southern Nallamala Hills. Scrub,
open forests and near agricultural fields. Common. [S]
ERM (ERMR-6a).
Remarks: Rao et al., (2005) did not include this taxon in
their catalogue, but provided its picture (image 42 at
www.zoosprint.org/). In their list they included the sub-
species, Ahaetulla nasutus isabellinus (Wall). The single
specimen based on which the presence is reported by
Rao et al. (2005) requires further studies to confirm the
validity of the so-called subspecies, whose correct termi-
nation of subspecies nomen should be rendered isabelli-
na, to match the gender of the genus.
37. Amphiesma stolatum (Linnaeus, 1758)
Coluber stolatus C. Linnaeus. 1758. Syst. Zool. 10th
ed.: 219.
Northern, Central (Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Uncommon. [S] ERM (ERMR-27a).
Remarks: The gender of Amphiesma Dumeril, Bibron
and Dumeril, 1 854 has been treated erroneously treated
as feminine since it was resurrection by Malnate (1960).
Toriba ( 1 994) showed that the genus is neuter, and the
termination of the species name should therefore be sto-
latum (see also David et al., 1998).
38 . Argyrogena fasciolata (Shaw, 1802)
Coluber fasciolatus G. Shaw. 1802. Gen. Zool.: 528.
Northern, Central (Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ERM (ERMR-28a).
Remarks: Revived from the synonymy of Coluber for C.
fasciolata Shaw, 1802, by Wilson (1967).
39. Atretium schistosum (Daudin, 1803)
Coluber schistosus F.-M. Daudin. 1803. Hist. Nat. Rept.
6: 132.
Northern, Central and Southern Nallamala Hills. Near
waterbodies and paddy fields. Common. No vouchers,
based on sightings.
40. Boiga forsteni (Dumeril, Bibron & Dumeril, 1854)
Triglyphodon forsteni A.-M.-C. Dumeril, G. Bibron &
A.-H.-A. Dumeril. 1854. Erp. Gen. 7: 1077.
Northern, Central (Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Uncommon. [S] ERM (ERMR-20a).
41. Boiga trigonata (Schneider in Bechstein, 1802)
Coluber trigonatus J. G. Schneider in: J. M. Bechstein.
1802. La Cepede’s Nat. Amphib.: 256; PI. 40; Fig. 1.
Northern (Sanyal et al., 1993; Sharma, 1971), Central
(Rao et al., 2005) and Southern Nallamala Hills. Scrub,
open forests and near agricultural fields. Common. [S]
ZSIK (R21457), ERM (ERMR-37a).
42. Coelognathus Helena (Daudin, 1803)
Coluber helena F.-M. Daudin. 1803. Hist. nat. Rept. 6:
277; PI. LXXVI.
Northern (Rao et al., 2005; Sharma, 1971; Sanyal et al.,
1993), Central (Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ZSIK (R21334), ZSIH
(ZSI/FBS/N/ 1181), ERM (ERMR-32a); [P] NHMOU
(NHMOU. Rep. P.6-03).
Remarks: Coelognathus Fitzinger, 1843, was revived
from the synonymy of Elaphe Fitzinger in: Wagler,
120
Asiatic Herpetological Research, Vol. 1 1
2008
1833, by Heltenberger (2001a; b), based on visceral and
vertebrae morphology and allozyme variations.
43. Coluber bholanathi Sharma, 1976
Coluber bholanathi R. C. Sharma. 1976. Comp. Physiol.
Ecol. 1(3): 106; Fig. 1.
Endemic to Andhra Pradesh, known only from type
locality. Northern (Sanyal et al., 1993; Sharma, 1976)
Nallamala Hills. Scrub and open forests. Rare. [S] ZSIK
(R2 1335-37).
44. Dendrelaphis tristis (Daudin, 1803)
Coluber tristis F.-M. Daudin. 1803. Hist. nat. Rept. 6:
430.
Northern (Rao et al., 2005), Central (Rao et al., 2005)
and Southern Nallamala Hills. Scrub, open forests and
near agricultural fields. Common. [S] ERM (ERMR-
25a); [P] NHMOU (NHMOU.Rep.P.2-01).
45. Enhydris enhydris (Schneider, 1799)
Hydrus enhydris J. G. Schneider. 1799. Hist. Amphib. 1:
245.
Northern and Central (Rao et al., 2005) Nallamala Hills.
Scrub, open forests and near agricultural fields.
Uncommon. No vouchers collected, based on sightings.
46. Liopeltis calamaria (Gunther, 1858)
Cyclophis calamaria A. C. L. G. Gunther. 1858. Cat.
Colubrine Snakes British Mus.: 250.
Central (Rao et al., 2005) Nallamala Hills. Scrub and
open forests. Rare. [S] ERM (ERMR-29a).
47. Ly codon aulicus (Linnaeus, 1758)
Coluber aulicus C. Linnaeus. 1758. Syst. Nat. 10th ed 1:
220.
Northern, Central (Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ERM (ERMR-35a).
48. Lycodon striatus (Shaw, 1802)
Coluber striatus G. Shaw. 1802. Gen. Zool.: 527.
Northern, Central (Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Uncommon. [S] ERM (ERMR-44a).
Remarks: First record claim from the region by Rao et
al. (2005) is erroneous as it has been already reported
from the Nallamala Hills by Subba Rao et al. (1994).
49. Lycodon travancoricus (Beddome, 1870)
Cercaspis travancoricus R. H. Beddome. 1870a. Madras
Monthly J. Med. Sci. 1: 169.
Central (Rao et al., 2005) Nallamala Hills. Scrub and
open forests. Rare. [S] ERM (ERMR-38a).
50. Macropisthodon plumbicolor (Cantor, 1839)
Tropidonotus plumbicolor T. Cantor. 1839. Proc. Zool.
Soc. London 1829(7): 54.
Northern, Central (Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ERM (ERMR-36a).
51. Oligodon arnensis (Shaw, 1802)
Coluber arnensis G. Shaw. 1802. Gen. Zool.: 526.
Northern, Central (Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ERM (ERMR-41a).
52. Oligodon taeniolatus (Jerdon, 1853)
Coronella taeniolata T. C. Jerdon. 1853. J. Asiatic Soc.
Bengal 22(6): 528.
Northern (Rao et al., 2005; Sharma, 1971; Sanyal et al.,
1993), Central (Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Uncommon. [S] ZSIK (R2 1450-51, R24460),
ERM (ERMR^42a).
53. Oligodon travancoricus (Beddome, 1877)
Oligodon travancoricum R. H. Beddome. 1877. Proc.
Zool. Soc. London 1877(4): 685.
Northern (Sanyal et al., 1993), Central and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Uncommon. [S] ZSIK (R21338).
54. Ptyas mucosa (Linnaeus, 1758)
Coluber mucosus C. Linnaeus. 1758. Syst. Nat. 10th ed
1: 216.
Northern (Rao et al., 2005; Sharma, 1971; Sanyal et al.,
1993), Central (Rao et al., 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ZSIK (R2 1446-47, R21449),
ERM (ERMR-39a); [P] NHMOU (NHMOU.Rep.P.3-
01).
Remarks: David and Das (2004) showed that the correct
termination of the species nomen should be mucosa ,
rather than mucosus , to match the gender of the generic
nomen.
55. Sibynophis subpunctatus (Dumeril, Bibron &
Dumeril, 1854)
Oligodon subpunctatum A.-M.-C. Dumeril, G. Bibron &
A.-H.-A. Dumeril. 1854. Erp. Gen. 7: 58.
Central Nallamala Hills. Scrub and open forests. Rare.
[S] ERM (ERMR^lOa).
Remarks: The taxon Sibynophis subpunctatus (Dumeril,
Bibron & Dumeril, 1854), has been recently been resur-
rected from the synonymy of Sibynophis sagittaria
(Cantor, 1839) by Captain et al. (2004).
2008
Asiatic Herpetological Research, Vol. 11
121
56. Xenochropis piscator (Schneider, 1799)
Hydrus piscator J. G. Schneider. 1799. Hist. Amphib. 1:
247.
Northern (Sharma, 1971; Rao et al., 2005; Sanyal et ah,
1993), Central (Rao et ah, 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ZSIK (R21339, R21452,
R21454-55).
Family: Elapidae
57. Bungarus caeruleus (Schneider, 1801)
Pseudoboa caerulea J. G. Schneider. 1801. Hist.
Amphib. 2: 284.
Northern (Rao et ah, 2005; Sanyal et ah, 1993; Sharma,
1971), Central (Rao et ah, 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ZSIK (R21458-59), ERM
(ERMR -24a).
58. Calliophis melanurus (Shaw, 1802)
Coluber melanurus G. Shaw. 1802. Gen. Zooh: 552.
Northern (Sanyal et ah, 1993; Sharma, 1971) Nallamala
Hills. Scrub forests. Rare. [S] ZSIK (R21460).
59. Naja naja (Linnaeus, 1758)
Coluber naja C. Linnaeus. 1758. Syst. Nat. 10th ed. 1:
221.
Northern (Rao et ah, 2005; Sanyal et ah, 1993; Sharma,
1971), Central (Rao et ah, 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ZSIK (R21461), ERM (ERMR-
33a); [P] NHMOU.
Family: Typhlopidae
60. Grypotyphlops acutus (Dumeril, Bibron &
Dumeril, 1844)
Onychocephalus acutus A.-M.-C. Dumeril, G. Bibron &
A.-H.-A. Dumeril. 1844. Erp. Gen. 6: 333.
Northern (Sanyal et ah, 1993; Sharma, 1971), Central
and Southern Nallamala Hills. Scrub, open forests and
near agricultural fields. Common. [S] ZSIK (R21330).
Remarks: Wallach (2003) revived Gyptotyphlops Peters,
1881 from the synonymy of Rhinotyphlops Fitzinger,
1832, to accommodate the present species.
61. Ramphotyphlops braminus (Daudin, 1803)
Eryx braminus F.-M. Daudin. 1803. Hist. Nat. Gen.
Rept. 7: 279.
Northern (Sanyal et ah, 1993; Sharma, 1971), Central
(Rao et ah, 2005) and Southern Nallamala Hills. Scrub,
open forests and near agricultural fields. Common. [S]
ZSIK (R2 13 16-20, R2 1327-29, R2 1394-99), ERM
(ERMR- 19a).
Family: Viperidae
62. Daboia russelii (Shaw & Nodder, 1797)
Coluber russelii G. Shaw & F. P. Nodder. 1797. Nat.
Misc. 8: PI. 108.
Northern (Rao et ah, 2005; Sanyal et ah, 1993; Sharma,
1971), Central (Rao et ah, 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ZSIK (R21341), ERM (ERMR-
34a).
Remarks: Although Obst (1983) revived Daboia Gray,
1842 from the synonymy of Vipera Laurenti, 1768, his
concept of the genus included Daboia Gray, 1842,
Macrovipera Reuss, 1927, Pseudocerastes Boulenger,
1896 and the Vipera xanthina (Gray, 1849) complex.
Hermann et ah (1992) separated these genera from each
other, and from Vipera Laurenti, 1768, restricting
Daboia to Vipera russelii Shaw & Nodder, 1797. For
comments on the spelling of the specific name, see
Dowling (1993) and Adler et ah (2000).
63. Echis carinatus (Schneider, 1801)
Pseudoboa carinatus J. G. Schneider. 1801. Hist.
Amphib. 2: 285.
Northern (Sanyal et ah, 1993; Sharma, 1971), Central
(Rao et ah, 2005) and Southern Nallamala Hills. Scrub,
open forests and near agricultural fields. Common. [S]
ZSIK (R21342, R21401-02, R24461) ERM (ERMR-
23a).
64. Trimeresurus gramineus (Shaw, 1802)
Coluber gramineus G. Shaw. 1802. Gen. Zooh: 420.
Northern, Central (Rao et ah, 2005) and Southern
Nallamala Hills. Scrub, open forests and near agricultur-
al fields. Common. [S] ZSIH (ZSI/FBS/N/1182, 1183),
ERM (ERMR-31a).
Erroneous or Doubtful Records
In addition to the records presented in the preceding
pages, the following species have been recorded from
the Nallamala Hills in the literature. These have been
shown to be in error, stemming from the use of incorrect
names or from misidentifications.
Bufo hololius Gunther, 1876, which had been
reportedly collected by Pillai and Murthy (1983) from
Nagarjunasagar area (also cited by Sarkar et ah, 1993),
has not been included in this list as this taxon is known
only from type specimen and all other specimens
assigned to this nomen need reevaluation, according to
Dubois and Older (1999).
122
Asiatic Herpetological Research, Vol. 1 1
2008
Polypedates leucomystax (Gravenhorst, 1829), has
been recorded from the Nallamala Hills by Rao et al.
(2005), and earlier, from the Eastern Ghats, by Pillai and
Murthy (1983). The records possibly refers to either P
maculatus or another member of this complex, since
Gravenhorst's species (type locality: Java) is a mesic
area frog, approaching the present study area only in the
northeast of the country (see Dutta, 1997).
In a series of papers dealing with the ecology and
physiology of squamate reptiles, Subba Rao (1970;
1972) and Subba Rao and Rajabai (1972a; 1972b; 1974)
recorded Calotes nemoricola from Tirupati, and Subba
Rao (1994) recorded this species from the Nallamala
Hills. Whitaker and Das (1990) showed this to be erro-
neous identifications for the widespread Calotes versi-
color (Dmdin, 1802).
Subba Rao et al. (1994) reported Eutropis beddomei
(Jerdon, 1870) from all districts encompassing the
Nallamala Hills range. Recently Rao et al. (2005) also
reported it from Vijayapuri and Mallelatheertham in
Northern Nallamala Hills. This nominal species is
restricted to the Western Ghats of south-western India
and south-central Sri Lanka (Smith, 1943). As men-
tioned earlier, Rao's (2005) image 30 represents
Eutropis nagarjuni Sharma, 1969.
Rao et al. (2005) listed Cerberus rynchops
(Schneider, 1799) from Sundipenta/Sikharam, within
the Nallamala Range. This is an estuarine/coastal
species (see Das, 2002b; Whitaker and Captain, 2004),
and its record in the literature from the Eastern Ghats
Complex (e.g., Pillai and Murthy, 1983) may be from
the plains.
Sibynophis Sagittarius (Cantor, 1839) was reported
by Rao et al. (2005), based on a specimen collected from
Sunnipenta. This taxon was previously reported from the
area southeast of the Nallamala Hills, from Sriharikota
Island, Nellore District, by Rao and Sekar (1993).
Sibynophis subpunctatus (Dumeril, Bibron & Dumeril,
1 854) was recently resurrected from the synonymy of S.
Sagittarius (Cantor, 1839) by Captain et al. (2004) for
this population. A record of this species from East
Godavari District by Sanyal et al. (1993) is erroneous, as
the specimen is from Godaveri (27° 34' N and 85° 22'
E), 10 km southeast of Kathmandu, central Nepal.
Remarks on Habitat Use
Divided in habitat types, the amphibian fauna of
Nallamala Hills can be classified into: 1. Human com-
mensals or otherwise tolerant of disturbed habitats (14
species: Bufo stomaticus, Duttaphrynus melanostictus,
Kaloula taprobanica, Microhyla ornata, M. rubra,
Uperodon globulosus, U. systoma, Ramanella variega-
ta, Euphylyctis cyanophlyctis, E. hexadactylus,
Fejervarya cf. limnocharis, Hoplobatrachus crassus, H.
tigerinus, and Polypedates maculatus)', 2. Exclusively
scrub forest species (four species: Bufo scaber,
Sphaerotheca breviceps, S. dobsonii, and S. rolandae );
and 3. Exclusively mesic forest species (two species:
Hylarana sp. and Indirana leithii ). Corresponding clas-
sification for reptiles include: 1. Human commensals or
taxa otherwise tolerant of disturbed habitats (seven
species: Calotes versicolor, Hemidactylus bowringii, H.
brookii, H . flaviviridis , H . frenatus , H. leschenaultii, and
Ptyas mucosa ); 2. Exclusively scrub forest species or
from rocky biotope (21 species: Geochelone elegans,
Psammophilus blanfordanus, P dorsalis, Sitana pon-
ticeriana, Hemidactylus reticulatus, H. triedrus,
Ophisops jerdoni, O. leschenaultii, O. minor, Lygosoma
ashwamedi, L. guentheri, L. punctata, Eutropis macu-
laria, Varanus bengalensis, Eryx conicus, E. johnii,
Python molurus. Coluber bholanathi, Liopeltis cala-
maria, Sibynophis subpunctatus, and Calliophis mela-
nurus); 3. Scrub and bordering agricultural fields (22
species: Hemidactylus giganteus, Chamaeleo zeylani-
cus, Eutropis carinata, Ahaetulla nasuta, Amphiesma
stolatum, Argyrogena fasciolata, Boiga forsteni, B. trig-
onata, Coelognathus helena, Dendrelaphis tristis,
Lycodon aulicus, L. striatus, Oligodon arnensis, O. tae-
niolatus, O. travancoricus, Bungarus caeruleus, Naja
naja, Grypotyphlops acutus, Ramphotyphlops braminus,
Daboia russelii, Echis carinatus, and Trimeresurus
gramineus ); 4. Exclusively mesic forest species (three
species: Calotes rouxii, Cnemaspis sp., and Lycodon tra-
vancoricus); 5. Wetland species (10 species: Crocodylus
palustris, Melanochelys trijuga, Pangshura tentoria,
Nilssonia gangetica, N. leithii, Lissemys punctata,
Atretium schistosum, Enhydris enhydris,
Macropisthodon plumbicolor, and Xenochropis
piscator)', and 6. Habitat category unknown (one
species: Eutropis nagarjuni).
In summary, all six microhylids, two bufonids, five
ranids, one rhacophorid, in addition to one agamid, five
gekkonids and one colubrid are human commensals.
Human activities may promote creation or maintenance
of certain habitats conducive for these species (e.g.,
perennial water sources, in the form of wells, drainage
areas, etc.). Low amphibian diversity characterize scrub
forests, where community members are such as Bufo
scaber, Sphaerotheca breviceps, S. dobsonii and S.
rolandae show xeric-region and/or fossorial adaptations
(e.g., thickened skins and burrowing adaptations, such
as enlarged metatarsal tubercles on pes) and adaptations
for retaining moisture.
All turtles and crocodilians reported from the
Nallamalla Range are associated with wetlands. The sole
non-aquatic species ( Geochelone elegans) is a scrub for-
est dweller. Significant diversity of gekkonids
( Hemidactylus reticulatus and H. giganteus ), scincids
2008
Asiatic Herpetological Research, Vol. 1 1
123
( Lygosoma ashwamedhi, L. guentheri, L. punctata, and
Eutropis macularia ) and colubrids ( Coluber bholanathi,
Liopeltis calamaria, and Sibynophis sagittaria) are
known from the ranges, several of these endemic ( L .
ashwamedhi and C. bholanathi ) or largely restricted to
scrub forests of Peninsular India. All lacertids ( Ophisops
jerdoni; O. leschenaultii, and O. minor) and all boids
(Eryx conicus, E. johnii, and Python molurus) reported
from the Nallamalla Hills are restricted to this biotope.
Nonetheless, mesic forests remain poorly explored, per-
haps for which reason both unidentified species from the
Nallamala Ranges of amphibian ( Hylarana ) and reptile
( Cnemaspis ) may represent taxa undescribed by science.
Remarks on Adaptive Types
Adaptations seen amongst the amphibians of the
Nallamala Hills include a diversity of dietary and habitat
types. Representatives of ant specialists include all the
microhylid and most bufonid species locally represent-
ed. Additional categories include: predators of small ver-
tebrates ( Polypedates maculatus) and folivores
(Euphlyctis hexadactylus and some E. cyanophlyctis). In
terms of gross habitat usage are the fossorial (Kaloula
taprobanica, Micro hy la ornata, M. rubra, Uperodon
globulosus, and U. systoma), terrestrial ( Duttaphrynus
melanostictus, B. scaber, and B. stomaticus ), aquatic or
aquatic-margin (. Euphlyctis cyanophlyctis, E. hexadacty-
lus, Fejervarya cf. limnocharis, Hoplobatrachus cras-
sus, and H. tigerinus) and arboreal (Polypedates macu-
latus and sometimes Ramanella variegata ) species. At
least three species enter bathrooms of human dwellings
(Ramanella variegata, Kaloula taprobanica, and
Polypedates maculatus) and one (Polypedates macula-
tus) is known to apply a coat of protein on the surface of
its body prior to emerging for foraging, to prevent evap-
orative water loss. Skittering on the water surface is
known for two species (E. cyanophlyctis and juvenile E.
hexadactylus).
Adaptive types among the reptiles, when classified
by diet, include eaters of soft-bodied (e.g., ant- and
worm) prey (Grypotyphlops acutus and
Ramphotyphlops braminus)', predators of crop pests,
such as rodents (Argyrogena fasciolata, Ptyas mucosa,
and Varanus bengalensis)', predator of small or medium-
sized vertebrate prey (Python molurus, Crocodylus
palustris, Ptyas mucosa, Daboia russelii, Trimeresurus
gramineus, and Echis carinata)', egg-predators
(Oligodon arnensis, O. taeniolatus and O. travancori-
cus); primarily fish-eaters (Crocodylus palustris ,
Nils sonia gangetica, N. leithii , Atretium schistosum,
Enhydris enhydris, and Xenochrophis piscator); frog-
and toad-eaters (Macropisthodon plumbicolor and
Dendrelaphis tristis) and near-exclusive snake-eaters
(Bungarus caeruleus and Calliophis melanurus).
In terms of habitat usage, reptiles exceed amphib-
ians in species richness, on account of their greater
capacity of surviving in relatively arid regions. The
regional gekkonid diversity, within the genus
Hemidactylus includes arboreal (H. bowringii, H.
brookii, H. flaviviridis, H. frenatus, and H.
leschenaultii), terrestrial (H. triedrus) and semi-fossori-
al (H. reticulatus) types. Usage of specific habitat types
include walls of houses (Hemidactylus bowringii, H.
brookii, H. flaviviridis, H. frenatus, and H.
leschenaultii), rupicolous habitats such as rocky boul-
ders (Psammophilus blanfordanus and P. dorsalis)', fos-
sorial habits in terms of usage of soft substratum for bur-
rowing (Grypotyphlops acutus and Ramphotyphlops
braminus)', and arboreal species, utilizing trees or some
sort of vegetation (Ahaetulla nasuta, Boiga forsteni, B.
trigonata, Dendrelaphis tristis, Lycodon aulicus,
Calotes rouxii, Chamaeleo zeylanicus, and Lycodon tra-
vancoricus; the typhlopid Ramphotyphlops braminus is
also known to occasionally ascend trees in search of
prey). Other adaptive types shown by the fauna include
vegetation mimics (Chamaeleo zeylanicus and
Ahaetulla nasuta)', Batesian mimicry is shown by
Sibynophis subpunctatus (for which the model presum-
ably is Calliophis melanurus)', bipedal locomotion
(Sitana ponticeriana)', and side-winding (Echis carina-
tus, when moving on sand or other loose substrate).
Biogeography of the Eastern Ghats
The Eastern Ghats remain the poor sister of the more
well-known Western Ghats, a recognized global hotspot
of biological species diversity (e.g., Ward, 2002). Inger
(1999) lamented about the low species richness of the
amphibian fauna of the Eastern Ghats (21 species),
while Das (1996) reported 84 species of reptiles, both
significantly different from the known diversity of the
Western Ghats, which has seen an explosion of new as
well as spectacular species discoveries in recent years
(see Biju, 2001; Biju and Bossuyt, 2003). Nonetheless,
enough documentation exists to reveal a highly diverse
biota of the hill ranges that run approximately parallel to
the east coast of India.
The range itself is a weathered relict of the peninsu-
lar plateau, characterized by a series of low hills that
extend from the Khondmal Hills of Orissa State, south to
the Shevaroys of central Tamil Nadu, where they meet
the Western Ghats in the Nilgiris region (descriptions in
Das, 1996; Mani, 1995). The northern and southern sec-
tions of the Eastern Ghats are separated by the delta of
the River Godavari, which is approximately 130 km in
width. Other important breaks are formed by the
drainages of the rivers Mahanadi and Krishna. The
Biligirirangan Hills, at 1,750 m, is the highest range in
the Eastern Ghats. Moisture regimes show a general gra-
124
Asiatic Herpetological Research, Vol. 1 1
2008
dient, Irom a relatively mesic northern range, with dry
and moist deciduous forests, to a relatively dry southern
subzone, with dry deciduous and thorn scrub (vegeta-
tional analysis in Legris and Meher-Homji, 1983).
Detailed analysis of faunal relationships along these hill
ranges, including comparative diversity of lineages as an
effect of breaks in the continuity of the ranges, humidity,
and elevational effects remain to be conducted.
We adopt Wikramanayake et al.'s (2002) ecoregion-
al approach to interpreting the distribution of the region-
al herpetofauna. These workers have classified the Indo-
Pacific Region (stretching from Afghanistan in the west
to New Guinea and the Solomons to the east), recogniz-
ing 129 ecoregions on the basis of vegetation, geology
and geological history. Within this framework, the
Nallamala Range falls within the Deccan Thom Scrub
zone (Ecoregion 23), abutting (and being influenced by)
Ecoregions 21 (Central Deccan Plateau Dry Deciduous
Forest); Ecoregion 22 (South Deccan Plateau Dry
Deciduous Forest); and Ecoregion 6 (East Deccan Dry-
Evergreen Forest). Although the Nallamala Hills also are
adjacent to Ecoregion 34 (the Godavari-Krishna man-
groves), herpetofaunal influences are absent, on account
of geological-vegetational differences.
The herpetofauna of the Eastern Ghats has a long
history of exploration, commencing with Patrick Russell
(1727-1805), the first Western herpetologist in India,
and medical doctor and naturalist with the British East
India Company, based at Vizagapatam (at present
Visakhapatnam). Russell explored the herpetofauna, pri-
marily snakes, of that region and produced a two volume
folio of water colors of snakes (also including Barkudia
melanosticta (Schneider, 1801), which was published in
1796 and 1801-1802.
Collections for faunistic inventories within the
Eastern Ghats complex have also been made by McCann
(1945), Pillai and Murthy (1983), Daniels and Ishwar
(1993), besides the contributions of the Zoological
Survey of India in the Nallamala Hills referred to earlier.
Rao and Rao (1998) studied the ecology of Barkudia
melanosticta (as B. insularis)\ Bauer and Das (2000)
studied the ecology of Calodactylodes aureus in Vellore;
Das and Chanda (1998) described a new species of
Philautus from the Visakhapatnam region; Dutta (2003)
described a new Philautus from Simlipal Hills; and Das
and Bauer (2000) described two new species of
gekkonid lizards of the genus Cnemaspis from the
Eastern Ghats.
Although less species rich than the more mesic adja-
cent regions, Ecoregion 23 supports a distinctive her-
petofauna, including arid region representatives whose
relatives are Eurasian and Afro-Ethiopian (e.g.,
Chamaeleo, Ophisops, Eryx, and Echis) and the region
also supports lineages that may be termed distinctly
autochthonous (i.e., Indian lineages, such as the genera
Uperodon, Ramanella, Indirana, Sphaerotheca,
Melanochelys, Pangshura, Nilssonia, Psammophilus,
Sitana, Argyrogena, Atretium, and Grypotyphlops ). The
presence of representatives of Indo-Malayan elements
represented here (e.g., Kaloula, Hylarana, Calliophis,
and Trimeresurus ) are explainable using Hora's (1949)
Satpura Hypothesis model, of emigration of the biota of
the Indo-Malayan region westwards. Alternative models
are available to explain the presence of these taxa in the
Eastern Ghats, including a more mesic climate in the
Indian Subcontinent up to the Eocene (van der Hammen,
1983). The climatic changes were perhaps accelerated
by widespread agriculture, specifically through the cul-
tivation of graminaceous crops (Misra, 1983), helping
further in the conversion of what was once tropical sub-
humid and dry deciduous forests into savannas.
Within the Eastern Ghats herpetofauna, endemic
genera include the limbless skinks, Barkudia (with two
species, B. insularis and B. melanostictus; see Das,
2000) and Sepsophis (a monotypic genus, containing S.
punctatus). A number of species hitherto considered
endemic to the Western Ghats have in recent years been
found within the Eastern Ghats complex, including
Indirana leithii (this report), Hylarana malabarica
(Tschudi, 1838) by Daniel and Selukar (1963), a mem-
ber of the genus Hylarana (this report) and Lygosoma
guentheri (Peters, 1879) (this report). Balachandran and
Pittie (2000) reported the occurrence of Draco from
these hills, that they allocated to D. dussumieri Dumeril
& Bibron, 1837, a Western Ghats species. Eastern Ghat
endemics found in the Nallamala Range include
Hemidactylus reticulatus, Eutropis nagarjuni,
Lygosoma ashwamedhi, and Coluber bholanathi. New
species have been described from these ranges in recent
years, including the geckos Cnemaspis otai and C. yer-
caudensis (see Das and Bauer, 2000).
Several species known from the Eastern Ghats have
not (yet) been recorded from the Nallamala Ranges.
Some may be regional endemics or appropriate habitats
may be missing on the site under study, although the
absence of some (e.g., Calodactylodes aureus), that are
known from both north and south of the range here rein-
force the argument for more sampling of the fauna.
Other Eastern Ghat endemics (e.g., Barkudia, with two
species, the monotypic Sepsophis, and
Hemiphyllodactylus aurantiacus ) among the reptiles,
and Philautus terebrans and Ichthyophis peninsularis
occur in adjacent ranges of the Ghats (see Das and
Chanda, 1998; Pillai and Murthy, 1983), and with fur-
ther collection, may prove their presence here, or be rep-
resented by hitherto unknown sister species.
2008
Asiatic Herpetological Research, Vol. 1 1
125
Conservation and Management
Parts of the Nallamala Range are within the Protected
Areas System, the levels of protection for each compo-
nent varying trom Forest Reserves, that lie within the
jurisdiction of the Andhra Pradesh Forest Department, to
National Park, that are gazetted and their protection
implemented by the Central (= Federal) Government.
The most well-known of the protected areas is the
Nagarjunasagar Srisailam Tiger Reserve and the recent-
ly gazetted Gundla Brahmeshwaram Metta Wildlife
Sanctuary.
Conservation of amphibians and reptiles represent
special challenges, for which reason, arguments have
been made to move away from species-based conserva-
tion strategies, to that addresses entire landscapes. Given
the large number of known components of the biodiver-
sity of these Protected Areas, especially non-
homoeothermous members (or non-mammal and bird
species), and the general lack of expertise to identify, let
alone understand, conservation requirements, this is
apparently a safer approach to the conservation of biodi-
versity. The situation is not unique to the Eastern Ghats:
in the Indo-Pacific region, centinelan extinction (or
species loss even before their formal description) is
known for both amphibians and reptiles (Das, 2002a;
Erdelen, 2002).
A handful of the recorded species from the
Nallamala Range are human commensals, or so-called
'weed-species', including, amongst amphibians:
Duttaphrynus melanostictus, B. stomaticus, Kaloula
taprobanica, Micro hy la ornata, M. rubra, Uperodon
globulosus, U. systoma, Ramanella variegata,
Euphylyctis cyanophlyctis, E. hexadactylus, Fejervarya
cf. limnocharis, Hoplobatrachus crassus, H. tigerinus,
and Polypedates maculatus. Scrub species of amphib-
ians include: Bufo scaber, Sphaerotheca breviceps, S.
dobsonii, and S. rolandae). Human-commensals among
the reptiles include: Melanochelys trijuga, Lissemys
punctata, Calotes versicolor, Hemidactylus bowringii,
H. brookii, H. flaviviridis, H. frenatus, H. giganteus, H.
leschenaultii , Lygosoma punctata, Eutropis carinata,
Amphiesma stolatum, Dendrelaphis tristis, Lycodon
aulicus, Ptyas mucosa , Naja naja, and Ramphotyphlops
braminus. Scrub species of reptiles include: Geochelone
elegans , Sitana ponticeriana, Chamaeleo zeylanicus,
Hemidactylus reticulatus , H. triedrus, Ophisops jerdoni,
O. leschenaultii, O. minor, Lygosoma ashwamedhi, L.
guentheri, Eutropis nagarjuni, Coluber bholanathi,
Liopeltis calamaria, Calliophis melanurus, Daboia rus-
selii, and Echis carinatus. Two species are exclusively
rupicolous ( Psammophilus blanfordanus and P dor-
salis). And only two species are considered mesic region
taxa, in that their respective congeners are exclusively
distributed in such areas (e.g., Hylarana and
Cnemaspis ).
Human-commensals generally refer to species tol-
erant of environments altered by humans. However,
many still have life histories intimately dependent on
certain habitat features, such as ponds or other standing
bodies of water, substrates that serve as burrowing refu-
gia, etc. Changes from rural to urban environments are
known to cause local extinction of amphibian species
(including Sphaerotheca ), through the removal of such
habitats, as observed in the Chennai region (Das,
unpubl.).
Three herpetofaunal species from the Nallamala
Hills are recognised as threatened, under the Red List
categories of the IUCN (World Conservation Union; see
Hilton-Taylor, 2000). These include the turtles,
Nilssonia gangetica and N. leithii, and the crocodilian,
Crocodylus palustris (all in the 'Vulnerable' category).
In the end, species protection in countries such as
India, where the pressure on land and water are large,
can only be assured in areas within protected areas. It is
therefore imperative to bring additional areas of these
hills with high diversity and/or faunal endemicity into
the country's protected areas system.
Acknowledgments
The first author thanks the successive Heads of the
Department of Zoology, Osmania University for facili-
ties, and a Research Grant (Award No. 9/132(626)/2002
EMR-I) by Council for Scientific and Industrial
Research, New Delhi. We acknowledge Andhra Pradesh
Forest Department for research and collection permits,
and logistics. The second author is grateful to the
Institute of Biodiversity, Universiti Malaysia Sarawak,
for supporting his researches on the herpetology of Asia.
We also thank M. S. Ravichandran, ZSI Kolkata, for
curatorial assistance, and Genevieve V. A. Gee,
Bhargavi Srinivasulu and an anonymous reviewer for
comments on a draft manuscript.
Literature Cited
Adler, K., H. M. Smith, S. H. Prince, P. David and D.
Chiszar. 2000. Russell’s viper, Daboia russelii, not
Daboia russellii, due to classical Latin rules.
Hamadryad 25(2):83-85.
Agrawal, V. C. and T. P. Bhattacharyya. 1976. Report on
a collection of mammals from Nagarjunasagar,
Andhra Pradesh. Newsletter of the Zoological
Survey of India. 2(5):2 1 2—2 1 6.
Anonymous. 1965. The gazetteer of India. Volume One.
Country and people. Ministry of Information and
Broadcasting, Government of India, Faridabad. 652
126
Asiatic Herpetological Research, Vol. 1 1
2008
pp., folding map.
Arnold, E. N. 1989. Towards a phylogeny and biogeog-
raphy ot the Lacertidae: relationships within an
Old-World family of lizards derived from morphol-
ogy. Bulletin of the British Museum of Natural
History (Zoology) 55:209-257.
Balachandran, S. and A. Pittie. 2000. Occurrence of
Draco or flying lizard Draco dussumieri in Chitoor
District, Andhra Pradesh. Journal of the Bombay
Natural History Society 97(1): 147-148.
Bauer, A. M. and I. Das. 2000. A review of the gekkonid
genus Calodactylodes (Reptilia: Squamata) from
India and Sri Lanka. Journal of South Asian Natural
History 5(1 ):25— 35.
Bhushan, B. 1986. The G.B.M. Plateau Sanctuary.
Hombill 1986(3): 18-22.
Bhushan, B. 1994. Ornithology of the Eastern Ghats.
Unpublished Ph.D. dissertation submitted to
University of Bombay, Bombay.
Bhushan, B. 2003. Rediscovery of the Jerdon's or dou-
ble-banded courser Rhinoptilus bitorquatus (Blyth).
Pp. 67-80; PI. 1. In: J. C. Daniel and G. W. Ugra
(eds.), Petronia. Fifty years of post-independence
ornithology in India. A centenary dedication to Dr.
Salim Ali 1896-1996. Bombay Natural History
Society/Oxford University Press, Mumbai.
Biju, S. D. 2001. A synopsis to the frog fauna of the
Western Ghats, India. Occasional Paper of the
Indian Society for Conservation Biology,
Thiruvanathapuram 1:1-24.
Biju, S. D. and F. Bossuyt. 2003. New frog family from
India reveals an ancient biogeographical link with
the Seychelles. Nature 425:711-714.
Bohme, W. and W. Bischoff. 1991. On the proper
denomination of Cabrita jerdonii Beddome, 1870
(Reptilia: Lacertidae). Amphibia-Reptilia
1 2(2):220— 22 1 .
Captain, A. S., D. J. Gower, P. David and A. M. Bauer.
2004. Taxonomic status of the colubrid snake
Sibynophis subpunctatus (Dumeril, Bibron &
Dumeril, 1854). Hamadryad 28(1 & 2):90-94.
Champion, H. G. and S. K. Seth. 1968. A revised survey
of forest types in India. Manager of Publications,
Government of India, New Delhi. 404 pp.
Daniel, J. C. 1962. Extension of range of the skink
Riopa guentheri (Gray). Journal of the Bombay
Natural History Society 59(3):965.
Daniel, J. C. and T. G. Selukar. 1963. Occurrence of the
fungoid frog Rana malabarica (Bibron) at
Jagdalpur, Bastar District, M. P. Journal of the
Bombay Natural History Society 60(3):743-744.
Daniel, J. C. and E. M. Shull. “1963” 1964. A list of the
reptiles and amphibians of the Surat Dangs, south
Gujarat. Journal of the Bombay Natural History
Society 60(3):737-743.
Daniels, R. J. R and N. M. Ishwar. 1993. Herpetofauna
of the wetlands of the Eastern Ghats- A status sur-
vey. Report to the Asian Wetland Bureau, Kuala
Lumpur. (2) + 50 pp.
Das, I. 1996. Biogeography of the reptiles of South Asia.
Krieger Publishing Company, Malabar, Florida. 1 6
pi. + vii + 87 pp.
Das, I. 2000. Anguis melanostictus Schneider, 1801, a
valid species of Barkudia (Sauria: Scincidae) from
southeastern India. Asiatic Herpetological Research
8:13-17.
Das, I. 2002a. Amphibians of the Indo-Pacific region:
conservation of neglected biodiversity. Pp. 47^49.
In: E. Wikramanayake, E. Dinerstein, C. Loucks, D.
M. Olson, J. Morrisson, J. Lamoreux, M. McKnight
and P. Hedao (eds), Terrestrial ecoregions of the
Indo-Pacific. A conservation assessment. Island
Press, Washington, D.C.
Das, I. 2002b. A photographic guide to the snakes and
other reptiles of India. New Holland Publishers
(U.K.) Ltd., London. 144 pp.
Das, I. 2004. Herpetology of an antique land: the history
of herpetological explorations and knowledge in
India and south Asia. In: Herpetological expeditions
and voyages. A. M. Bauer (ed.), Bonner
Zoologische Beitrage 52(2):2 15-229.
Das, I. and A. M. Bauer. 2000. Two new species of
Cnemaspis (Sauria: Gekkonidae) from Tamil Nadu,
southern India. Russian Journal of Herpetology
7(1): 1 7—28.
Das, I. and S. K. Chanda. 1998. A new species of
Philautus (Anura: Rhacophoridae) from the Eastern
Ghats, south-eastern India. Journal of South Asian
Natural History 3(1): 103-1 12.
2008
Asiatic Herpetological Research, Vol. 1 1
127
David, P. and I. Das. 2004. On the grammar of the gen-
der of Ptyas Fitzinger, 1843 (Serpentes:
Colubridae). Hamadryad 28( 1 &2): 113-116.
David, P., G. Vogel, and O. S. G. Pauwels. 1998.
Amphiesma optatum (Hu & Djao, 1966) (Serpentes,
Colubridae): an addition to the snake fauna of
Vietnam, with a list of the species of the genus
Amphiesma and a note on its type species. Journal
of the Taiwan Museum 5 1 (2):83— 92.
Dowling, H. G. 1993. The name of Russel’s viper.
Amphibia-Reptilia 14:320.
Dubois, A. 1992. Notes sur la classification des Ranidae
(Amphibiens Anoures). Alytes 61(1 0):305— 352.
Dubois, A. and A. Ohler. 1999. Asian and Oriental toads
of the Bufo melanostictus, Bufo scaber and Bufo
stejnegeri groups (Amphibia, Anura): a list of avail-
able names and redescription of some name-bearing
types. Journal of South Asian Natural History
4(2): 133-1 80.
Dutta, S. K. 1997. Amphibians of India and Sri Lanka
(checklist and bibliography). Odyssey Publishing
House, Bhubaneswar. (4) + xiii + 342 + xxii pp.
Dutta, S. K. 2003. A new species of rhacophorid frog
from Simlipal Biosphere Reserve, Orissa, India.
Russian Journal of Herpetology 10(1 ):25— 32.
Erdelen, W. 2002. Reptile diversity in the Indo-Pacific
region. Pp. 49-54. In: E. Wikramanayake, E.
Dinerstein, C. Loucks, D. M. Olson, J. Morrisson, J.
Lamoreux, M. McKnight and P. Hedao (eds.),
Terrestrial ecoregions of the Indo-Pacific. A conser-
vation assessment. Island Press, Washington, D.C.
Frost, D. R. 2007. Amphibian species of the world:
online reference. Version 5.1.
http://research.amnh.org/herpetology/amphibia/The
American Museum of Natural History. Accessed on
14 January 2008.
Frost, D. R., T. Grant, J. Faivovich, R. H. Bain, A. Haas,
C. F. B. Haddad, R. O. De Sa, A. Channing, M.
Wilkinson, S. C. Donnellan, C. J. Raxworthy, J. A.
Campbell, B. L. Blotto, P. Moler, R. C. Drewes, R.
A. Nussbaum, J. D. Lynch, D. M. Green and W. C.
Wheeler. 2006. The amphibian tree of life. Bulletin
of the American Museum of Natural History
(297): 1-370.
Grosjean, S., M. Vences and A. Dubois. 2004.
Evolutionary significance of oral morphology in the
carnivorous tadpoles of tiger frogs, genus
Hoplobatrachus (Ranidae). Biological Journal ol
the Linnean Society 81:171-181.
Helfenberger, N. 2001a. Phylogenetic relationships of
Old World ratsnakes based on visceral organ topog-
raphy, osteology, and allozyme variation.
Unpublished Ph. D. Dissertation, Zoological
Museum, University of Zurich, Zurich. 106 pp.
Helfenberger, N. 2001b. Phylogenetic relationships of
Old World ratsnakes based on visceral organ topog-
raphy, osteology, and allozyme variation. Russian
Journal of Herpetology, Supplement 2001:1-62.
Hermann, H.-W., U. Joger and G. Nilsson. 1992.
Phylogeny and systematics of viperine snakes. III.
Resurrection of the genus Macrovipera (Reuss,
1927) as suggested by biochemical evidence.
Amphibia-Reptilia 13:375-392.
Heyer, W. R., M. A. Donnelly, R. W. McDiarmid, L.-A.
Hayek and M. S. Foster. 1994. Measuring and mon-
itoring biological diversity: standard methods for
amphibians. Smithsonian Institution Press,
Washington, D.C. xix + 364 pp.
Hilton-Taylor, C. 2000. 2000 IUCN Red List of threat-
ened species. IUCN, Gland and Cambridge, xviii +
61 pp.
Hora, S. L. 1949. Satpura Hypothesis of the distribution
of the Malayan fauna and flora to Peninsular India.
Proceedings of the National Institute of Science,
India 15:207-122.
Inger, R. F. 1999. Distribution of amphibians in southern
Asia and adjacent islands. Pp. 445-482. In: W. E.
Duellman (ed.), Patterns of distribution of amphib-
ians. A global perspective. The John Hopkins
University Press, Baltimore and London.
Iskandar, D.T. 1998. Amfibi Jawa dan Bali. Puslitbang
Biologi- LIPI and GEF- Biodiversity Collections
Project, Bogor. xviii + 117 pp; 26 pi. English edi-
tion, 1998, The Amphibians of Java and Bali.
Research and Development Centre for Biology-
LIPI and GEF- Biodiversity Collections Project,
Bogor. xviii + 1 17 pp; 26 pi.
Lai, K. B. 1954. Dr. Hem Singh Pruthi. Current
Science 23(1): 5.
128
Asiatic Herpetological Research, Vol. 1 1
2008
Legris, P. and V. M. Meher-Homji. 1983. The Eastern
Ghats: vegetation and bioclimatic aspects. Pp. 1-17.
In: Proceedings of the National Seminar on
Resource Development and Environment. Eastern
Ghats. Andhra University Press, Waltair.
Lozupone, P, B. M. Beehler, and S. D. Ripley. 2004.
Ornithological gazetteer of the Indian Subcontinent.
Center for Applied Biodiversity Science,
Conservation International, Washington, D.C. (2) +
190 pp.
McCann, C. 1945. Reptiles and amphibians of
Vizagapatam and neighbouring Ghats. Journal of
the Bombay Natural History Society 45:435^436.
Malnate, E. 1960. Systematic division and evolution of
the colubrid snake genus Natrix, with comments on
the subfamily Natricinae. Proceedings of the
Academy of Natural Sciences of Philadelphia
112:41-71.
Mani, M. S. 1995. Biogeography in India. Surya
Publications, Dehra Dun. 130 pp.
Mausfeld, R, A. Schmitz, W. Bohme, B. Misof, D.
Vrcibradic and C. F. D. Rocha. 2002. Phylogenetic
affinities of Mabuya atlantica Schmidt, 1945,
endemic to the Atlantic Ocean Archipelago of
Fernando de Noronha (Brazil): necessity of parti-
tioning the genus Mabuya Fitzinger, 1826
(Scincidae: Lygosominae). Zoologischer Anzeiger
241:281-293.
Mertens, R. 1946. Uber Lacerta monitor Linnaeus.
Senckenbergiana 27 (4/5): 188.
Mertens, R. 1956. Die Gultigkeit der Namen Varanus
bengalensis (Daudin 1802) und Varanus salvator
(Laurentus 1768). Senckenbergiana Biology
37(5/6):395— 398.
Mertens, R. 1957. Opinion 540. Protection under the
plenary powers of the specific names “ bengalensis ”
Daudin (1802) as published in the combination
“ Tupinambis bengalensis ” and “ salvator ” Laurenti
1768, as published in the combination “ Stellio sal-
vator ” (Class Reptilia). Opin. Decl. International
Commission of Zoological Nomenclature 20(7):77-
86.
Meylan, P. A. 1987. The phylogenetic relationships of
soft-shelled turtles (Family Trionychidae). Bulletin
of the American Museum of Natural History
1 86(1): 1— 101 .
Misra, R. 1983. Indian savannas. Pp. 151-166. In: F.
Bourliere (ed.), Ecosystems of the world. 13.
Tropical savannas. Elsevier Scientific Publishing
Company, Amsterdam, Oxford and New York.
Murthy, T. S. N. 1968. Notes on collection of amphib-
ians from Nagarjun Valley (Andhra) with one new
record. Journal of the University of Poona 34:63-
71.
Murthy, T. S. N. 1986. Lizards of Kumool district.
Bulletin of the Maryland Herpetological Society
22(3): 1 34 — 143 .
Murthy, T. S. N. and T. Venkateswarlu. “1979” 1980.
Record of the rock-lizard, Psammophilus blanfor-
danus (Stoliczka) (Sauria: Agamidae) in Araku
Valley, Eastern Ghats (Andhra Pradesh), India.
Journal of the Bombay Natural History Society
76(3):524.
Nagulu, V, V. V. Rao and C. Srinivasulu. 1998.
Biodiversity of select habitats in Eastern Ghat
regions of Andhra Pradesh. Pp. 6-35. In: Anon,
(ed.), The Eastern Ghats: Proceedings of the
National Seminar on Conservation of Eastern
Ghats. Environment Protection Training and
Research Institute, Hyderabad.
Obst, F. J. 1983. Zur Kenntnis der Schlangengattung
Vipera (Reptilia: Serpentes: Viperidae).
Zoologische Abhandlungen Staatliches Museum
Tierkunde, Dresden 38(1 3):229— 235.
Pillai, R. S. and T. S. N. Murthy. 1983. Herpetofauna of
Eastern Ghats. Pp. 81-84. In: Proceedings of the
Seminar on Resources Development and
Environment in the Eastern Ghats. Andhra
University Press, Waltair.
Praschag, R, A., K. Hundsdorfer, A. H. M. A. Reza and
U. Fritz. 2007. Genetic evidence for wild-living
Aspideretes nigricans and a molecular phylogeny of
South Asian softshell turtles (Reptilia:
Trionychidae: Aspideretes, Nilssonia). Zoologica
Scripta 2007:1-10.
Rao, K. T., D. Sudhakar, V. V. Rao, V. Nagulu, and C.
Srinivasulu. 1999. Rusty-spotted cat Prionailurus
rubiginosus (I. Geoffroy Saint-Hillaire, 1871)- A
new record for Nagarjunasagar Srisailam Tiger
Reserve, Andhra Pradesh. Journal of the Bombay
Natural History Society 96(3):463-464.
2008
Asiatic Herpetological Research, Vol. 1 1
129
Rao, K. T., C. Srinivasulu, R. Prudhvi Raju, S. M. M.
Javed and I. Siva Rama Krishna. 2004a. Second
record of Rhinolophus beddomei in Eastern Ghats,
India. Zoos’ Print Journal 19(4): 1446 + web supple-
ment.
Rao, K. T., M. Prudhvi Raju, I. Siva Rama Krishna, S.
M. M. Javed, Manju Siliwal and C. Srinivasulu.
2004b. Record of Poecilotheria regalis Pocock,
1 899 from Nallamala Hills, Eastern Ghats, Andhra
Pradesh. Zoos’ Print Journal 19(10): 1668 + web
supplement.
Rao, K. T., B. E. Yadav, M. Prudhvi Raju, S. M. M.
Javed and I. Siva Rama Krishna. 2004c. Some
species of praying mantids (Insecta: Mantodea)
from Nagarjunasagar-Srisailam Tiger Reserve,
Andhra Pradesh. Zoos’ Print Journal 19(1 1 ): 1 691—
1 692 + web supplement.
Rao, K. T., M. Prudhvi Raju, S. M. M. Javed and I. Siva
Rama Krishna. 2004d. Checklist of butterflies of
Nagarjunasagar Srisailam Tiger Reserve, Andhra
Pradesh. Zoos’ Print Journal 19(12): 171 3-17 15 +
web supplement.
Rao, K. T., M. Prudhvi Raju, I. Siva Rama Krishna, S.
M. M. Javed and C. Srinivasulu. 2004e. Preliminary
report on the status survey of biodiversity of
Nagarjunasagar Srisailam Tiger Reserve, Andhra
Pradesh. Pp. 187-190. In: K. Shankaraiah (ed.),
Proceedings of the National Symposium on
Bioresources, Biotechnology and Bioenterprise,
held at Department of Zoology, Osmania
University, Hyderabad, India between 19-21
November, 2003. Department of Zoology, Osmania
University, Hyderabad.
Rao, K. T., H. V. Ghate, M. Sudhakar, S. M. M. Javed
and I. Siva Rama Krishna. 2005. Herpetofauna of
Nallamala Hills with eleven new records from the
region including ten new records for Andhra
Pradesh. Zoos’ Print Journal 20(1): 1737-1 740 +
web supplement.
Rao, K. T., M. Prudhvi Raju, S. M. M. Javed, I. Siva
Rama Krishna and C. Srinivasulu. In review, a.
Occurrence of painted kaloula Kaloula taprobanica
(Amphibia: Microhylidae) in Nagarjunasagar
Srisailam Tiger Reserve, Andhra Pradesh. Journal
of the Bombay Natural History Society
Rao, K. T., M. Prudhvi Raju, S. M. M. Javed, I. Siva
Rama Krishna and C. Srinivasulu. In review, b. First
record of the bronzed frog Rana ( Hylorana ) tempo-
ralis (Gunther, 1 864) (Amphibia: Ranidae) from
Andhra Pradesh. Journal of the Bombay Natural
History Society
Rao, P. and A. G. Sekar. 1993. Occurrence of Cantor's
blackheaded snake Sibynophis Sagittarius in
Sriharikota, Andhra Pradesh. Journal of the
Bombay Natural History Society 90( 1 ): 1 1 4.
Rao, R. K. 1998. Nallamalai Hills: among world centers
of plant diversity. Pp. 317-321. In: Proceedings of
the National seminar on Conservation of Eastern
Ghats. Environment Protection Training and
Research Institute, Hyderabad.
Rao, R. S. 1998. Vegetation and valuable plant resources
of the Eastern Ghats with specific reference to
Andhra Pradesh and their conservation. Pp. 59-86.
In: Proceedings of the National Seminar on
Conservation of Eastern Ghats. Environment
Protection Training and Research Institute,
Hyderabad.
Rao, V. V., V. Nagulu, M. Anjenuylu, Bhargavi
Srinivasulu, C. Srinivasulu and J. V. Ramana Rao.
1997. Status of avifauna of Rajiv Gandhi National
Park, Andhra Pradesh. Pavo, Indian Journal of
Ornithology 35(1 &2):85— 1 00.
Reddy, H. S., C. Srinivasulu, and K. T. Rao. 2004. Prey
selection by the Indian tiger ( Panthera tigris tigris),
in Nagarjunasagar Srisailam Tiger Reserve, India.
Mammalian Biology 69(6):384 — 39 1 .
Russell, P. 1796. An account of Indian serpents collected
on the coast of Coromandel; containing descriptions
and drawings of each species; together with experi-
ments and remarks on their several poisons. George
Nicol, London, viii + 90 pp + PI. I-XLVI.
Russell, P. 1801, 1802, 1807. A continuation of an
account of Indian serpents; containing descriptions
and figures, from specimens and drawings, trans-
mitted from various parts of India, to the Hon. The
Court of Directors of the East India Company, and
published by their order, under the superintendence
of Patrick Russell, M.D.F.R.S. G. and W. Nicol,
London, v + 53 + (4) + PI. I-XLII.
Sanyal, D. P, B. Dattagupta and N. C. Gayen. 1993.
Reptilia. Pp. 1-63. In: A. K. Ghosh (ed.), Fauna of
Andhra Pradesh, Part 1. (Reptilia, Amphibia,
Fishes). Zoological Survey of India, Calcutta.
130
Asiatic Herpetological Research, Vol. 1 1
2008
Sarkar, A. K., P. K. Chandra and S. Ray. 1993.
Amphibia. Pp. 65-87. In: A. K. Ghosh (ed.), Fauna
of Andhra Pradesh, Part 1. (Reptilia, Amphibia,
Fishes). Zoological Survey of India, Calcutta.
Sharma, R. C. 1969. Two new lizards of the genera
Mabuya Fitzinger and Riopa Gray (Scincidae) from
India. Bulletin of Systematic Zoology, Calcutta
1 (2):7 1— 75.
Sharma, R. C. 1971. The reptile fauna of the
Nagaijunasagar Dam area (Andhra Pradesh, India).
Records of the Zoological Survey of India 63(1—
4):77-93.
Sharma, R. C. 1976. Some observations on ecology and
systematics of Coluber bholanathi, a new species of
snake (Reptilia: Squamata: Colubridae) from India.
Comparative Physiology and Ecology 1(1): 105—
107.
Sivakumar, S., R. Manakadan, And V. Giri. 2003.
Record of the painted kaloula Kaloula taprobanica
in Andhra Pradesh. Journal of the Bombay Natural
History Society 100(2&3):631.
Smith, M. A. 1931. The fauna of British India, including
Ceylon and Burma. Vol. I. Loricata, Testudines.
Taylor and Francis, London, xxviii + 185 pp + 2 pi.
Reprinted 1970 Ralph Curtis Books, Hollywood,
Florida and 1980 Today and Tomorrow’s
Publishers, Dehradun.
Smith, M. A. 1935. The fauna of British India, including
Ceylon and Burma. Reptilia and Amphibia. Vol. II —
Sauria. Taylor and Francis, London, xiii + 440 pp +
1 pi. Reprinted 1970 Ralph Curtis Books,
Hollywood, Florida and 1980 Today and
Tomorrow’s Publishers, Dehradun.
Smith, M. A. 1943. The fauna of British India, Ceylon
and Burma, including the whole of the Indo-
Chinese region. Vol. III. Serpentes. Taylor and
Francis, London, xii + 583 pp. + 1 map. Reprinted
1970 Ralph Curtis Books, Hollywood, Florida and
1980 Today and Tomorrow’s Publishers, Dehradun.
Spinks, P. Q., H. B. Shaffer, J. B. Iverson and W. P.
McCord. 2004. Phylogenetic hypotheses for the tur-
tle family Geoemydidae. Molecular Phylogenetics
and Evolution 32:164—182.
Sprackland, R. G. 1982. Varanus “ monitor ”: an invalid
name for Varanus bengalensis. Herpetological
Review 13(4): 11 7.
Srinivas, B., K. Vara Prasad, and B. C. Choudhury.
1999. Status of crocodiles in Andhra Pradesh. In:
Indian crocodilians. B. C. Choudhury (ed.), Envis.
Wildlife & Protected Areas 2( 1 ):33— 37.
Srinivasulu, C. 2001a. Vertebrate diversity of the
Nallamala Hills- checklists of herpetofauna, birds
and mammals. Unpublished document, Department
of Zoology, Osmania University, Hyderabad.
Srinivasulu, C. 2001b. Chital (Axis axis Erxleben, 1777)
herd composition and sex ratio on the Nallamala
Hills of Eastern Ghats, Andhra Pradesh, India.
Zoos’ Print Journal 16(1 2):655— 658.
Srinivasulu, C. 2002. Sight record of the little pied fly-
catcher Ficedula westermanni Sharpe in Andhra
Pradesh. Journal of the Bombay Natural History
Society 99(3):534.
Srinivasulu, C. 2003. Site records of yellow-throated
bulbul Pycnonotus xantholaemus (Jerdon, 1844) in
the Nallamala Hills, Eastern Ghats, Andhra
Pradesh, India. Zoos’ Print Journal 1 8(3): 1 05 1—
1052.
Srinivasulu, C. and V. Nagulu. 2002. Mammalian and
avian diversity of the Nallamala Hills, Andhra
Pradesh. Zoos’ Print Journal 1 7( 1 ):675 — 684.
Srinivasulu, C. and V. V. Rao. 1999. Butterflies of
Gundla Brahmeshwaram Wildlife Sanctuary of
Andhra Pradesh. Zoos’ Print Journal 14(2):6-7.
Srinivasulu, C. and V. V. Rao. 2000. Occurrence of the
yellowthroated bulbul Hypsipetes indicus (Jerdon)
in the Nallamalla Hills, Andhra Pradesh. Journal of
the Bombay Natural History Society 97(1): 144—
145.
Srinivasulu, C., B. Srinivasulu and C. A. Nageswara
Rao. 2006. Amphibia of Nagarjunasagar Srisailam
Tiger Reserve, Andhra Pradesh. Records of the
Zoological Survey of India, Occasional Paper
Number 245: 1-57; 4 pi.
Srinivasulu, C., B. Srinivasulu and C. A. Nageswara
Rao. 2005. Present status of Eutropis nagarjuni
(Sharma, 1969) (Reptilia: Scincidae) - an endemic
skink from Andhra Pradesh, India. Zoos’ Print
Journal 20(5): 1865-66.
2008
Asiatic Herpetological Research, Vol. 1 1
131
Srinivasulu, C., M. Siliwal, A. Rajesh, P.
Venkateshwarulu, I. Siva Rama Krishna, C. A. N.
Rao and K. Thulsi Rao. 2006. First record of
Uperodon globulosus (Gunther, 1864) (Anura:
Microhylidae) from Andhra Pradesh, India.
Hamadryad 30(1): 197-199.
Subba Rao, M. V. 1970. Studies on the biology of two
selected lizards of Tirupati. British Journal of
Herpetology 4(6): 15 1-1 54.
Subba Rao, M V. 1982. Studies on the population struc-
ture, density and sex-ratio in the garden lizard,
Calotes nemoricola Jerdon. Proceedings of the
Indian Science Congress 59(3):4 1 5 (Abstract.)
Subba Rao, M. V. and B. N. Rao. 1998. Diet of the limb-
less skink, Barkudia insularis Annandale, 1917
(Sauria: Scincidae). Hamadryad 22(2): 120.
Subba Rao, M. V., K. Kameswara Rao, P. Appala Raju,
P. S. Rajashekar, P. V. S. V. Ramachandraiah, A. V.
V. S. Swamy, S. Subba Lakshmi Devi, and V. V.
Subba Rao. 1994. Management and conservation of
herpetofaunal resources of the Eastern Ghats,
Andhra Pradesh. Pp. 173-207. In: M. V. Subba Rao
(ed.), Forest, wildlife and environment, Proceedings
of the National Level Symposium, Andhra
University, Vishakapatnam.
Subba Rao, M. V. and B. S. Rajabai. 1972a. Ecological
aspects of the agamid lizards Sitana ponticeriana
and Calotes nemoricola. Herpetologica 28(3):285-
289.
Subba Rao, M. V. and B. S. Rajabai. 1972b. Circadian
rhythms in the garden lizard Calotes nemoricola.
Proceedings of the International Union of
Physiological Sciences, Sydney 3(2): 180.
Subba Rao, M. V. and B. S. Rajabai. 1974. Influence of
thermal acclimation oxygen consumption in the
agamid lizard, Calotes nemoricola with reference to
size, sex, temperature, season and climatic condi-
tion. Proceedings of the Indian Academy of Science
89( 1): 1— 15.
Toriba, M. 1994. Gender of the genus Amphiesma
Dumeril, Bibron and Dumeril. The Snake
26(2): 145. (In Japanese, with English abstract)
Van der Hammen, T. 1983. The palaeoecology and
palaeogeography of savannas. Pp. 19-35 In: F.
Bourliere (ed.), Ecosystems of the world. 13.
Tropical savannas. Elsevier Scientific Publishing
Company, Amsterdam, Oxford and New York.
Vences, M. F. Glaw, J. Kosuch, I. Das and M. Veith.
2000. Polyphyly of Tomopterna (Amphibia:
Ranidae) based on sequences of the mitochondrial
16S rRNA genes, and ecological biogeography of
Malagasy relict amphibian groups. In: W. R.
Lourenqo & S. M. Goodman (eds.), Diversite et
endemisme a Madagascar. Memoires de la Societe
de Biogeographie: 229-242.
Wallach, V. 2003. Scolecophidia Miscellanea.
Hamadryad 27(2):222-240.
Ward, G. C. 2002. India's Western Ghats. National
Geographic 201(1 ):90- 109.
Whitaker, R. and A. S. Captain. 2004. Snakes of India.
The field guide. Draco Books, Chennai, India, xiv +
481 pp.
Whitaker, R. and I. Das. 1990. Scrubland Calotes
nemoricola ? Hamadryad 15(1 ):29— 30.
Wikramanayake, E., E. Dinerstein, C. Loucks, D. M.
Olson, J. Morrisson, J. Lamoreux, M. McKnight
and P. Hedao (Eds.). 2002. Terrestrial ecoregions of
the Indo-Pacific. A conservation assessment. Island
Press, Washington, D.C.
Wilson, L. D. 1967. Generic reallocation and review of
Coluber fasciolatus Shaw (Serpentes: Colubridae).
Herpetologica 23(4): 260-275.
Submitted: 20 June 2006
Accepted: 23 September 2007
pp. 132-135
Asiatic Herpetological Research, Vol. 1 1
2008
Spermatogenesis Timing in a Population Ophisops elegans
(Sauria: Lacertidae), Western Iran
Farhang Torki1’* and Ahmad Gharzi2
xFarhang Torki Ecology and Herpetology Center for Research (FTEHCR), 68319-16589,
P. O. Box: 68315-139 Nourabad City, Lorestan Province, Iran,
: Department of Biology, Faculty of Science, Lorestan University, 68135 Khorramabad, Iran.
* Corresponding author E-mail: [email protected]
Abstract.- During biological activity, specimens of Ophisops elegans were collected in western Iran, from March to
November. Testis were removed and H&E techniques were used for histological study. The results show three phases
in spermatogenesis timing as follows: (a) active phase, spermatogenesis in all specimens is active, (b) transitional
phase, spermatogenesis in many specimens are active an in other is inactive, and finally (c) inactive phase, spermato-
genesis in all specimens is inactive.
Keywords.- Spermatogenesis timing, testicular cycle, Ophisops elegans , Zagros mountains, western Iran.
Introduction
Lizards show two type of spermatogenesis; continuous
and alternate (Torki, in press a, b). In the continues type,
spermatogenesis is year-round and spermatozoa are
foudn in the lumen of the seminiferous all year (e.g.,
Hemandez-Gallegos et al., 2002; Sherbrooke, 1975;
Vieira et al., 2001). In contrast, the alternate type of
spermatogenesis occurred during a well defined period
in which spermatozoa were not found in the lumen of
seminiferous (Castilla and Bauwens, 1990; Fitch, 1970;
Torki, 2006, in press a, b, c). Continuous spermatogen-
esis occurs in tropical regions (Fitch, 1970; Hemandez-
Gallegos et al., 2002; Vieira et al., 2001), this region
limited by author into ITCZ region (Torki, 2006).
Alternate spermatogenesis occurred in non-tropical
regions, especially in temperate zones (Castilla and
Bauwens, 1 990; Torki, 2006). In the temperate-zone, the
male testicular cycle is divided into two well-defined
phases as follows: (a) the regenerative phase that occurs
in the spring and is characterized by sustained sperm
production, and (b) the degenerative phase, that begins
in late summer, where a break in spermatogenesis is
observed (Castilla and Bauwens, 1990; Fitch, 1970;
Lofts, 1987; Torki, in press b). Likewise, tropical species
in seasonal habitats also display, if less pronounced, a
regenerative phase during the wet (reproductive) season
© 2008 by Asiatic Herpetological Research
2008
Asiatic Herpetological Research, Vol. 1 1
133
DF 1
Figure 1. Shows phase significant during degeneration
period based on DF analysis.
and a degenerative phase during the dry (non-reproduc-
tive) season (Marion and Sexton, 1971; Wilhoft and
Reiter, 1965).
Spermatogenesis of some lizards in Iranian plateau
especially in Zagros Mountains described by author
(Torki, 2006, in press a, b, c), and shows alternation
spermatogenesis in Zagros Mountains. In this study, my
purpose is determination spermatogenesis timing in
Ophisops elegans in Zagros Mountains.
Materials and Methods
Seventy-five mature male specimens of O. elegans were
collected by hand north of Lorestan province. The size
of males O. elegans is between 38.9 < SVL < 47.2 mm.
O. elegans go to hibernation period from Oct. to Feb.
(Torki, 2005). Testis were removed from each individual
by dissection, during each month from after hibernation
to before hibernation. Snout-vent lengths (to the nearest
Figure 2. Show annual period and phase in spermatoge-
nesis of O. elegans in western Iran, central Zagros.
0.5 mm) were measured for each lizard. In each lizard
maximum length and width of the left testis was meas-
ured (with electronic calipers to the nearest 0.01 mm)
and Testis Volume (TV) and estimated TV (0.1 mm3)
using the ellipsoid formula; v = 4/3n abc, where v is vol-
ume, a and c are equal to half testicular height, and b is
half testicular length (Vieira et al., 2001; Torki, 2006).
For histological analysis, testes were fixed and the epi-
didymis was fixed in 3.7% formalin, dehydrated in a
graded series of ethanol, cleared in xylem, and embed-
ded them in paraffin. Sections were stained with hema-
toxylin-eosin (H&E) and were observed with an Zeiss
Axiophoto microscope. For each individual, two char-
acters (pm) were measured: the Lumen of Seminiferous
(LS) diameter, Germinative Seminiferous (GS) diame-
ter. For data collecting, using the mean of twenty trans-
versally oriented tubules at the same section, next to the
core of the testes. Measurements were taken with an
ocular micrometer, to the nearest 1 pm. Same as author
study (Torki, 2006, in press a, b, c), Tukey HSD test and
Canonical Discriminant Functions Analysis (DFA) to
show phases significance were used.
Table 2. Shows Tukey FISD test (a = 0.05) for determina-
134
Asiatic Herpetological Research, Vol. 1 1
2008
Figure 3. Light microscopy shows active phase, histological section of (a) seminiferous, (b) epididymis. LE, Lumen of
Epididymis, E: Epididymis layer, LS: Lumen of Seminiferous, GS: Germinative layer of Seminiferous, S: Spermatozoa,
SI: primary Spermatocytes, S2: secondary Spermatocytes, AM: Amorphous Material, 1C: Interstitial tissue Cell.
follows: phase (1) from Mar. to Jul., phase (2) during
Jun. to Jul., and phase (3) from Aug. to Oct.
Discussion
In this study, there was no significant relationship
between SVL*Month (p > 0.05), because adult speci-
mens were collected. Based on statistical and histologi-
cal study, I presented three phases (Fig. 2) during the
degeneration period in O. elegans; active, transitional
and inactive phase, (a) Active phase: because spermato-
zoa in the lumen of seminiferous and epididymis are
found (Fig. 3), this phase occurred from Mar. to May. (b)
Transitional phase: because spermatozoa in many speci-
mens found in lumen of seminiferous and epididymis
and in other specimens not found, this phase occurred
from Jun. to Jul. (c) Inactive phase: because in all spec-
imens lumen of seminiferous and epididymis is without
spermatozoa, this phase occurred during pre-hibernation
or from Aug to Oct. Same as O. elegans, Trapelus
lessonae show three phases (Torki, 2006, In Press c).
Two species ( O . elegans and T. lessonae) show synchro-
nism in three phases during degeneration period. In both
species (T. lessonae and O. elegans ) spermatogenesis
activity occurred during post-hibernation. In contrast, in
the agama, Laudakia nupta spermatogenesis occurred
after post hibernation in late spring and early summer
(Torki, In Press b). Body length of T. helenae is lowest
than other taxa and body length in L. nupta is biggest
other taxa and O. elegans with T. lessonae is between to
other. Based on timing of spermatogenesis activity and
body length, three types of activities of spermatogenesis
timing in lizards inhabitant Zagros Mountains as fol-
lows: (a) early active spermatogenesis, that occurred in
lowest body length, (b) late spermatogenesis that
occurred in highest body length, and finally normal
active spermatogenesis that occurred in T. lessonae and
O. elegans. Three taxa ( L . nupta, T. lessonae and O. ele-
gans) are sympatric; therefore, divergeny in timing sper-
matogenesis occurred due to body length. This is pro-
nounced confirmed by T. helenae as a lowest body
length. Torki and Rastegar-Pouyani briefly report affects
of body size to timing of spermatogenesis (2006).
However timing of spermatogenesis is many lizards is
different, but histological structure in these lizards is
similar (Gharzi and Torki, 2006 a). Nevertheless, in
many lizards timing of spermatogenesis activity
occurred due to climate condition (e.g., Duvall et ah,
1982; Fitch, 1970; Whittier et al., 1987). Nevertheless,
climate condition and geographic position are two main
factors that strongly regulated spermatogenesis timing in
lizards (Gharzi et al., 2006; Torki, 2005 b, in press a). On
the other hand, geographic variation in timing spermato-
genesis activity occurred due to climate gradient or lati-
tude gradient (Gharzi and Torki, 2006 b; Torki, in press
a). In many lizards such as genus Trapelus divergeny in
spermatogenesis activity occurred in T. lessonae and T.
agilis, is related to climate condition. In additional, spe-
ciation process due to dispersal or vicariance evidence in
two taxon of genus Trapelus are important factors for
the divergeny in timing of spermatogenesis activity
(Torki, 2006).
Literature Cited
Castilla, A. M. and D. Bauwens.1990. Reproductive and
fat body cycles of the lizard, Lacerta lepida, in cen-
tral Spain. Journal of Herpetology 24: 261-266.
2008
Asiatic Herpetological Research, Vol. 1 1
135
Duvall, D., L. J. Guillette (Jr.) and R. E. Jones. 1982.
Environmental control of reptilian reproductive
cycles, p. 20 1-23 1 . In: C. Gans & H. Plough (Eds.),
Biology ot Reptiles. (Vol. 13) New York.
Gharzi, A., H. Moradi and F. Torki. 2006. Cold-climate
and testicular cycle regulation in lizards. Joint
meeting of Ichthyologist and Herpetologist. 12-16
Jul 2006, New Orleans, Abstract. Internet:
http://www.dce.ksu.edu/jointmeeting/archive/2006/
abstractlist.shtml. E-K, pp 41-42.
Gharzi, A. and F. Torki, 2006a. A histological descrip-
tion of testicular tissue in lizards of central Zagros.
14lh Iranian Biology conference and the secondary
International conferences of Biology. Tarbiat-
Modares University, Iran.
http://www.modares.ac.ir/IBC2006/asami 1 .htm
Gharzi, A. and F. Torki. 2006b. The effects of climate
and latitude on reproductive cycle of lizards. 14lh
Iranian Biology conference and the secondary
International conferences of Biology. Tarbiat-
Modares University, Iran.
http://www.modares.ac.ir/IBC2006/asamil.htm
Fitch, H.S. 1970. Reproductive cycles in lizards and
snakes. Miscellaneous Publication of the Museum
of Natural History, University of Kansas 52: 1-247.
Hemandez-Gallegos, O., F. R. Mendez-de la Cruz, M.
Villagran-Santa Cruz, and R. M. Andrews. 2002.
Continuous spermatogenesis in the lizards
Sceloporus bicanthalis (Sauria: Phrynosomatidae)
from high elevation habitat of central mexico.
Herpetologica 58(4): 415^-21.
Lofts, B. 1987. Testicular functions. In: Hormones and
Reproduction in Fishes, Amphibians, and Reptiles,
pp. 283-325. Norris, D.O., Jones, R.E., Eds, New
York, Plenum Press.
Marion, K. R. and C. J. Sexton. 1971. The reproductive
cycle of the lizard Sceloporus malachiticus in Costa
Rica. Copeia 1971: 517-526.
Sherbrooke, W. C. 1975. Reproductive cycle of a tropi-
cal lizard, Neusticurus ecpleopus Cope, in Peru.
Biotropica 7: 194-207.
Torki, F. 2005a. Annual cycle of sexual system of male
Ophisops elegans considering hibernation, mor-
phology, and histological. 5th conference of
Ichthyology and Herpetology. Florida-San Diego,
USA. Internet: http://www.asih.org/meet-
ings/2005/abstracts2005pt4.pdf
Torki, F. 2005b. Relation between climate condition and
reproduction in reptiles. In Farsi, Internet:
http://biologist.edu.tf
Torki, F. 2006. Spermatogenesis of the agama Trapelus
lessonae in the central Zagros Mountains, Iran.
Zoology in the Middle East 38:21-28.
Torki, F. In Press a. Influence of climate gradient on tim-
ing of spermatogenesis in Trapelus lessonae
(Sauria: Agamidae) in the Zagros Mountains, Iran.
Hamadryad.
Torki, F. In Press b. Regeneration of testicular tissue dur-
ing degeneration period of testicular cycle in
Laudakia nupta. Hamadryad.
Torki, F. In Press c. The role of hibernation on testicular
cycle and testicular activation during dormancy in
the hibernate lizard Trapelus lessonae (Reptilia:
Agamidae) in nature. Salamandra.
Torki, F. and N. Rastegar-Pouyani. 2006. Relation
between Body Size and Spermatogenesis Timing in
Hibernate Lizards. 14th Iranian Biology conference
and the secondary International conferences of
Biology. Tarbiat-Modares University, Iran.
http://www.modares.ac.ir/IBC2006/asami 1 .htm
Vieira. G. H. C., H., C. Wiederhecker, G . R. Colli and
S. N. Bao. 2001. Spermiogensis and testicular cycle
of the lizard Tropidurus torquatus (Squamata,
Tropiduridae) in the Cerrado of central Brazil.
Amphibia-Reptilia 22: 217-233.
Whittier, J. M., J. T. Manson, D. Crews and P. Licht.
1987. Role of light and temperature in the regula-
tion of reproduction in the red-sided garter snake,
Thamnophis sirtalis parietalis. Canadian Journal of
Zoology 65: 2090-2097.
Wilhoft, D. C. and E. O. Reiter. 1965. Sexual cycle of
the lizard, Leiolopisma fuscum, a tropical
Australian skink. Journal of Morphology 116:
379-388.
Submitted: 23 June 2006
Accepted: 23 September 2007
pp. 136-142
Asiatic Herpetological Research, Vol. 1 1
2008
An Assessment of Solitary and Arribada Nesting of
Olive Ridley Sea Turtles (Lepidochelys olivacea) at the
Rushikulya Rookery of Orissa, India
Basudev TrIPATHY1’2
1 Department of Environmental Sciences, Andhra University, Visakhapatnam - 530 003, India;
2 Wildlife Institute of India, PO Box 18, Chandrabani, Dehradun - 248 001, Uttraranchal, India.
Corresponding author E-mail: [email protected]
Abstract.- The solitary and arribada population of Olive Ridley Sea Turtles at the Rushikulya rookery of Orissa of
India was monitored for two nesting seasons (2003-04 and 2004-05). Mass nesting population census of turtles was
carried out using standard IUCN/SSC Marine Turtle Specialist Group recommended statistical technique (number of
turtles counted: n = 11024). Curved carapace measurements of egg laying females were recorded (67.16±3.65). There
was a reduction in the size class of nesting females as compare to the data available on turtle morphometry from
Orissa coast in the last decade. The sporadic nesting was documented at the rookery from December to April with a
peak in March and with no major intermediate nesting activities in between. The mass nesting census differs greatly
as compare to the nesting figures projected by the state wildlife authority. While the state wildlife authority projects
a higher figure of nesting turtles, the actual number of turtles that nests during arribada is quite low. Continuous mon-
itoring of the beach for assessment of solitary nesting activities along with accurate methods of mass nesting census
is required for proper assessment of the Olive Ridley Sea Turtle population at the Rushikulya rookery of Orissa.
Keywords.- Lepidochelys olivacea, solitary, arribada, estimation, technique, India.
Introduction
Nesting of Olive Ridley Sea Turtles (Lepidochelys oli-
vacea) takes place either in solitary or in great simulta-
neous aggregations (mass nesting) where upto 100,000
females come onto the beach to lay their eggs also pop-
ularly known as arribada; a Spanish term meaning mass
arrival (Pritchard, 1997). Orissa, a state in India along
the easten coast, harbours three major arribada sites viz.
Gahirmatha, Devi and the Rushikulya rookery (Pandav
et al., 1994; see Fig. 1). Besides solitary nesting all
along the coast of Orissa, more than a hundred thousand
turtles are believed to nest annually at Gahirmatha (Dash
and Kar, 1 990) and tens of thousands nest at other two
locations, i.e. Devi and the Rushikulya rookery (Kar,
1982; Pandav et al., 1994). In spite of its biological
importance, solitary nesting has never been evaluated
adequately in many important nesting rookeries (Castro,
1986). Although some information is available on soli-
tary nesting of L. olivacea at Gahirmatha and Devi rook-
ery (Pandav, 2000), there is little or no information on
solitary nesting activities at the Rushikulya rookery.
Similarly, the mass nesting events at the Rushikulya
rookery have not yet been monitored properly; current
data are from anecdotal accounts (Pandav et al., 1994)
and the imprecise census by the Orissa State Forest
Department due to improper statistical techniques
(Pandav, 2000; Shanker et al., 2003;
http://www.wildlifeorissa.org). The Orissa State Forest
Department have reported mass nesting at this rookery
every year since 2001, but accurate estimates of the
number of nesting turtles in arribadas are not available
in the absence of a standard technique for mass nesting
census (Patnaik et al., 2001; Shanker et al., 2003). The
IUCN/SSC Marine Turtle Specialist Group (MTSG) has
recommended for use of strip transect method for esti-
mating the arribada on mass nesting beaches, on the
basis of successful experiment by Valverde and Gates
(1999).
The Olive Ridley Sea Turtle is an endangered
species according to the protection status of IUCN and
as per CITES prohibited for trade of any kind and also is
included in the schedule I of Indian Wildlife (Protection)
Act (1972) and is legally protected. Flowever, over the
past decade, more than 100,000 dead turtles have been
reported along the Orissa coast due incidental and acci-
dental fishing related casualties in the sea. Whether this
mortality has an impact on the population size of L. oli-
vacea is yet to be known (Pandav and Choudhury,
2000). In this paper, in light of its importance, the spo-
radic nesting and mass nesting census of L. olivacea at
the Rushikulya rookery was evaluated for two season
from November to April (2003-04 and 2004-05) using
standard techniques recommended by the MTSG to
ascertain the actual arribada nesting population of turtles
at this rookery and compare this figure with estimates
from the Orissa State Forest Department.
© 2008 by Asiatic Herpetological Research
2008
Asiatic Herpetological Research, Vol. 1 1
137
INDIA
Map hd t to scale
Figure 1. Map of Orissa coast in India with three arribada sites.
Bay of Bengal
Scale 125.000
Palur canal
Purunabandha*
Figure 2. Map of Rushikulya sea turtle rookery, Orissa.
138
Asiatic Herpetological Research, Vol. 1 1
2008
Table 1 . Sporadic and intermediate nesting of L. olivacea
at the Rushikulya rookery of the Orissa coast.
2003-04 2004-05
Being a migratory species L. olivacea are known to
arrive in the Orissa coast during late October and remain
in the coastal waters until May and thereafter migrate
back to the southern Bay of Bengal and Indian Ocean
area. There are no turtle activities after April/May until
October in Orissa. Therefore, the field work was con-
centrated at Rushikulya between November and May.
The mass nesting beach at the Rushikulya rookery is
located on the sand spit along the northern end of the
Rushikulya River mouth. Rushikulya is situated 320 km
south of Gahirmatha mass nesting beach (Lat. 19° 22' N
and Lon. 85° 02' E). Turtle nesting at Rushikulya takes
place along a stretch of ~5 km immediately north of the
Rushikulya River mouth from the village Purunabandha
(1 km north of the Rushikulya River mouth) to
Kantiagada village (Fig. 2).
For systematic coverage, the entire stretch of nest-
ing beach was divided into 100 m segments and was
marked with wooden poles. To monitor nesting activi-
ties, patrolling was done by foot every night between
1700 and 0700 hr from November to April of 2004 and
2005 (1st November to 30th April for both years). Sea tur-
tles are known to nest along the Rushikulya rookery
towards the end of December (Basudev Tripathy, per-
sonal observation) and therefore the chance of missing
out of some crawls during the nesting season was mini-
mal. Turtle crawls onto the beach were classified into
nesting and non-nesting types based on crawl mark pat-
tern and sign of nest (Schroeder and Murphy, 1999).
There is no standard classification of solitary nesting or
arribada nesting based on the number of nests per night.
However, keeping the beach length of the study area (~5
km) in mind, the author classified night with less than 20
nesters (~4 nests/km) as solitary nesting, nesting densi-
ties of 20 to 99 turtles (<20 nests/km) were considered
intermediate nesting, while those with >100 (> 100/km)
or above turtles as arribada nesting. A modified strip
Table 2. Sea turtle ( L . olivacea) mass nesting census at
the Rushikulya rookery.
transect method was used to estimate the mass nesting at
the Rushikulya rookery (Valverde and Gates, 1999).
This method was effective in arriving at an estimate of
the number of nesting females, with a mean, variance
and confidence intervals that provide rigorous statistical
support for the results. A 20 m strip transect was laid at
every 100 m segment of the nesting beach. Only egg-
laying females (turtles in oviposition) within the strip
were counted on hourly intervals starting with the first
individual ascending the beach in the evening until
morning when there were no nesting activities.
The formula below was used for computation of
the mass nesting data (see Valvarde and Gates, 1999):
Estimate of nesting = — ft * H x N —
Wxtx Lx h
Where:
A
H
N
W
t
L
h
Total available nesting area (in m2)
Duration of arribada (in minutes)
Total of number of egg laying turtles
Width of the transect (in m)
Number of sampling period (in days)
Total of length of all transects (in m)
Average time spent by turtles for egg
laying (in minutes)
Size of female L. olivacea was determined by the
measurement of curved carapace length (CCL) at the
time of egg lying. Each turtle was measured down the
midline from the nuchal notch to the posterior carapace
2008
Asiatic Herpetological Research, Vol. 1 1
139
450
December January February March April
Months
Figure 3. Monthly turtle nesting at Rushikulya for L. oli-
vacea (2003-04 and 2004-05).
tip using a flexible measuring tape. Values were rounded
to the nearest 0.5 cm.
Of the 568 nests observed during the 2003-04 nest-
ing season between December 2003 and April 2004,
45.2% of the nesters were intermediate nesters, with rest
being sporadic nesters (Table 1). Similarly, during the
2004-05 nesting season, intermediate nesting was calcu-
lated to be 33.3% (Table 1). There was a distinct pattern
of solitary nesting observed at Rushikulya rookery, with
a peak in activity during March for both the season (Fig.
3). .
A total of 1 5 and 20 transects with 20 m width and
100 m length were established for counting turtles in
arribadas during 2004 and 2005 respectively (Table 2).
During 2005, the topography of the beach changed dras-
tically and mass nesting was extended from the estuarine
mouth and 2 km northward, and therefore, five more
transects were laid. Although arribada took place twice
during 2004 (February 9-10 and March 10-13), the
February arribada could not monitored due to logistic
constraint and hence the census was done only for the
March 2004 arribada. During four days of peak nesting
in March, a total of 23,461 turtles were estimated to
have nested in arribada. However, the 2005 arribada was
larger and was estimated to be 86,688 nesting individu-
als in two nights when censuses were carried out (Table
3).
Nesting females in arribadas at the Rushikulya
rookery had an average CCL of 67. 163.65 cm (n = 5 1 5;
min: 60.8, max: 73.61), a value slightly greater than that
of the solitary nesters at 66.024.34 cm (n = 335; Mann-
Whitney = 505, p = 0.0004). No significant differences
in CCL existed for arribada of February and March 2004
(Kruskal-Wallis %2= 6.9, p = 0.2412) and also between
2004 and 2005 season (Kruskal-Wallis, 5.80, p =
0.1225).
Solitary nesting emergence of L. olivacea is known
to occur almost every month along rest the Orissa coast
(Dash and Kar, 1990). However, solitary nesting is
found in greater numbers during January to May, indi-
cating that this is the main nesting season for this species
(Pandav and Choudhury, 2000). Although year round
sporadic nesting is not known from the Rushikulya
rookery, this study confirms sporadic nesting of olive
ridley turtles at the rookery between December and
April, with a peak in March and is identical to other sea
turtle rookeries along the Orissa coast. Temperature,
weather condition, physiography of nesting beaches and
the adjacent sea, conditions of tide, temperature and sur-
face current circulation all play an important role in
determining female nest selection (Pandav and
Choudhury, 2000). However, this study could not incor-
porate the above variables at the Rushikulya rookery due
to logistic constraints. Unlike Gahirmatha and Devi
(Basudev Tripathy, personal observation) where spo-
radic nesting is almost continuous for the entire season
(> 10 turtles/night), at Rushikulya rookery, sporadic nest-
ing is irregular, with nesting intensity increasing before
the commencement of the arribada. During the other
nights, there is either no nesting or low sporadic nesting
(<5 turtles/night). However, it is likely that the females
emerging on nights with intermediate levels of nesting
are responding to arribada cues (cue such as southerly
strong wind, cloudy weather and strong wave action in
the sea) and are truly arribada nesters. What actually
comprises solitary or arribada nesting must also be eval-
uated in light of the total population for a given beach
(Dash and Kar, 1990). During the present study, there
was no major intermediate nesting events observed at
the Rushikulya rookery except for nine nights in 2004
February and six nights during 2005 March, when nest-
ing per night was over 100. However, it is likely that
these turtles were early arribada nesters, since the arrib-
ada commenced in the rookery few days later.
At the Rushikulya rookery, although arribadas were
reported for many years, precise mass-nesting censuses
have not been carried out. The Orissa Forest Department
report estimates the number of turtles during the arriba-
da every year, but the methods used are unpublished and
unavailable (estimated by Orissa State Forest
Department; Table 4). Furthermore, it is not clear that
methods are standardized, unbiased and therefore com-
parable. The State Forest Department staff counts all
female turtles that remain on the beach during arribada.
However, during arribada emergence, many turtles do
not deposit their eggs (-30-40%) and hence are not part
of true nesting population. While estimating nesting
arribada population, this factor greatly affects the popu-
lation size estimation and leads to bias. In the past 25
years, a variety of approaches and methods have been
used to estimate female populations at arribada beaches
140
Asiatic Herpetological Research, Vol. 1 1
2008
Table 3. Estimates of arribada (nesting number) for the
2004 and 2005 nesting season.
of Orissa (reviewed by Shanker et al., 2003). The pres-
ent study estimated very low nesting populations during
arribadas (using the standard technique as suggested by
the IUCN/MTSG (Valvarde and Gates, 1999) compared
to the figures projected by the Orissa state forest depart-
ment (Tables 3 and 4). While projection of a large nest-
ing figure attracts attention, particularly to the national
and international media and conservation communities
at large, it may results in the downgrading of this species
in the Indian Wildlife (Protection) Act and IUCN’s Red
List.
In recent years (at least between 1996 and 2000), a
small but significant decrease in curved carapace length
(CCL) of female Olive Ridley Sea Turtles has been doc-
umented (Pandav et al., 1994; Kalb, 1999). Similarly,
the average CCL of females at Gahirmatha from 1978 to
1985 were larger than those measured during
1996-2000 (Dash and Kar, 1990; Pandav and
Choudhury, 2000). The present study found that arribada
nesters are significantly larger than the solitary nesters,
with a mean CCL being 1 . 1 4 cm greater, but was within
the range. The decrease in size class (as compare to
1996-2000) was not detected during the current study,
but this could be due to a small sample size, the lack of
sufficient data, and a less accurate measuring technique
(measuring tape for CCL Vs metallic calipers for SCL).
In conclusion, it is apparent that the solitary and
arribada nesters are not different, but from the same pop-
ulation stock. The genetic study on Olive Ridley Sea
Turtles from Orissa also supports this view (Shanker et
al., 2004). Also, sporadic nests contribute equally to the
population recruitment as that of arribada nesters being
hatching success is higher for the later (Castro, 1986,
also see Tripathy et al., 2003). Olive Ridleys along the
Orissa coast are known to exhibit fidelity to their breed-
ing as well as nesting ground (Dash and Kar 1990,
Pandav et al., 2000). Nesting females are known to
exhibit movement between rookeries in Orissa both
within and between seasons (Tripathy and Pandav, in
press; Pandav and Choudhury 2000). Migration and
inter-rookery movement by females during the breeding
and nesting season along Orissa coast has also been doc-
umented (Pandav and Choudhury, 2006). Hence, knowl-
Table 4. Estimates of arribada at the Rushikulya rookery by the Orissa Forest Department and other researchers
2008
Asiatic Herpetological Research, Vol. 1 1
141
edge ot the location and temporal use of nesting grounds
ot Olive Ridley Sea Turtles in Orissa is important in
view of the habitat loss and large-scale mortality of tur-
tles in the offshore waters. Therefore, along with protec-
tion of arribada nesters, it is necessary to monitor the
beach and safeguard the sporadic nesters and their habi-
tat as well.
Prior to this study, there were no proper estimates of
the number of turtles that nest during arribada at the
Rushikulya rookery. Our estimates show that the num-
ber of turtles could be much less than what is projected
by various governmental agencies. Thus, declaration of
a mass nesting population in broad terms (e.g. hundreds
of thousands) without a proper assessment may result in
the reduction of protection required for L. olivacea in
their breeding ground, which is already meager. Hence,
standard and accurate techniques for mass nesting cen-
sus are urgently required for additional years for moni-
toring the status and nesting trends of L. olivacea at the
in Rushikulya rookery of Orissa. As evidence from the
last decade of sea turtle mortality data from Orissa
(Pandav and Choudhury, 2000), reduction of the size
class of individuals participating in arribadas (Shanker
et al., 2004; Tripathy, 2005), and elimination of the older
females from the breeding stock over a period of time.
However, to confirm this, extensive and accurate meas-
urements of the nesting females and clutch sizes need to
be performed to determine if there is a difference/reduc-
tion in size of L. olivacea over the years at rookeries in
Orissa, and thereby a declining of the Olive Ridley Sea
Turtle population of the Indian Ocean area and or the
rest of the world.
Acknowledgments
This study was part of the author’s doctoral work and he
is thankful to Dr. P. S. Raja Sekhar and the Head of the
Department of Environmental Sciences, Andhra
University, Visakhapatnam for approving the work and
support as well as the Orissa Forest Department for per-
mission to conduct field work. The author is thankful to
field assistants and volunteers of Purunabandha village,
Ganjam for their help in data collection during arribadas.
Literature Cited
Castro, J. C. 1986. Contribucion de las tortugas loras
solitarias, Lepidochelys olivacea , en el manteni-
miento de esta especie. Tesis de Licenciatura.
Universidad de Costa Rica.
Dash, M. C. and C. S. Kar. 1990. The Turtle Paradise:
Gahirmatha. Interprint, New Delhi. 295 pp.
Kalb, H. J. 1999. Behavior and physiology of solitary
and arribada olive ridley sea turtle ( Lepidochelys
olivacea) during the intemesting period. Ph.D.
Dissertation, Texas A & M University, USA. 200
pp.
Kar, C. S. 1982. Discovery of second mass nesting
ground for Pacific ridley sea turtles in Orissa, India.
Marine Turtle Newsletter 23:3.
Orissa State Forest Department, Government of Orissa.
http://www.wildlifeorissa.org.in.
Pandav, B. and B. C. Choudhury.2000. Conservation
and management of olive ridley sea turtle
(Lepidochelys olivacea) in Orissa. Project Final
Report, Wildlife Institute of India. 77 pp.
Pandav, B. 2000. Conservation and management of
olive ridley sea turtle (Lepidochelys olivacea) along
the Orissa coast. Unpublished PhD thesis, Utkal
University, Orissa, India. 148 pp.
Pandav, B. and B.C. Choudhury. 2006. Migration and
movement of Olive Ridley Turtles along the east
coast of India. Pp. 365-379. In: Marine Turtles of
the Indian Subcontinent. B.C. Choudhury and K.
Shanker (eds.). Universities Press, Hyderabad, AP,
India, 415 pp.
Pandav, B., K. Banugopan, D.Sutaria, and
B.C. Choudhury. 2000. Fidelity of male Olive
Ridley Turtles to a breeding ground. Marine Turtle
Newsletter 87: 9-10.
Pandav, B., B. C. Choudhury and C. S. Kar. 1994. A sta-
tus survey of olive ridley sea turtle (Lepidochelys
olivacea) and their nesting beaches along the Orissa
coast, India. Wildlife Institute of India, Dehradun,
India. 48 pp.
Pattanaik, S. K., C. S. Kar and S. K. Kar. 2001. A quarter
century of sea turtle conservation in Orissa.
Publication of wildlife wing of forest department,
Government of Orissa publication, Bhubaneswar
34 pp.
Pritchard, P. C. H. 1997. Evolution, phylogeny and cur-
rent status. Pp. 1-28. In\ P.F. Futz and J. A. Musick
(Eds.). The Biology of Sea Turtles. Boca Raton,
Florida, CRC Press, 432 pp.
Schroeder, B. A. and S. Murphy 1999. Population sur-
veys (ground and aerial) on nesting beaches. In:
142
Asiatic Herpetological Research, Vol. 1 1
2008
Research and management techniques for the con-
servation of sea turtles. K. L. Eckert, K. A.
Bjomdal, F. A. Abreu-Grobois and M. Donnelly
(eds). IUCN Marine Turtle Specialist Group
Publication # 4, CGC, Blanchard, Pennsylvania,
USA. 235 pp.
Shanker, K., B. Pandav and B. C. Choudhury. 2003. An
assessment of the olive ridley turtle ( Lepidochelys
olivacea ) nesting population in Orissa, India.
Biological Conservation 115, 149-160.
Shanker, K., R. K. Aggarwal, J. Rama Devi, B. C.
Choudhury, and L. Singh. 2004. Phylogeography of
olive ridley turtles ( Lepidochelys olivacea) on the
east coast of India: implications for conservation
theory. Molecular Ecology 13:1899-1909.
Tripathy, B. 2002. Is Gahirmatha the world’s largest sea
turtle rookery?. Current Science 83 (11): 1299.
Tripathy, B. 2005. A study on the ecology and
conservation of Olive Ridley Sea Turtle
(. Lepidochelys olivacea) at the Rushikulya rookery
of Orissa coast, India. Unpublished PhD Thesis.
Andhra University, Visakhapatnam, India. 168 pp.
Tripathy, B. and B. Pandav. In Press. Beach fidelity and
inter-nesting movement of olive ridleys
( Lepidochelys olivacea) at Rushikulya, India.
Herpetological Conservation and Biology.
Tripathy, B., B. Pandav and R. C. Panigrahy. 2003.
Hatching success and orientation of Lepidochelys
olivacea (Eschscholtz, 1829) at Rushikulya rook-
ery, Orissa, India. Hamadryad 27(2): 185-1 92.
Valvarde, R. A. and C. E. Gates. 1999. Population sur-
veys on mass nesting beaches. Pp. 56-60. In: K.L.
Eckert, K. A. Bjomdal, F. A. Abrell-Grobois and M.
Donnelly (Editors), Research and management
technique for conservation of sea turtles. IUCN
Marine Turtle Specialist Group Publication # 4,
CGC, Blanchard, Pennsylvania, USA. 235 pp.
Submitted: 19 October 2006
Accepted: 23 September 2007
2008
Asiatic Herpetological Research, Vol. 1 1
pp. 143-146
Effects of Starvation on Urinary Nitrogen Composition of Juvenile
Chinese Three-keeled Pond Turtles (Chinemys reevesii)
Jie Wang and Cuijuan Niu*
Ministry of Education Key Laboratory of Biodiversity Science and Ecological Engineering, College of Life
Sciences, Beijing Normal University, Beijing, 100875, People’s Republic of China.
* Corresponding author E-mail: [email protected]
Abstract.- We investigated the effect of starvation on urinary nitrogen composition in the juvenile Chinese three-
keeled pond turtle ( Chinemys reevesii). Under normal conditions, ammonia, urea, and uric acid constitute 2.3, 95.8
and 1.9% ot total urinary nitrogen, respectively. During starvation periods of one to four weeks, the concentration of
urea changed little, while that of ammonia rose sharply and that of uric acid fell significantly. After feeding was
resumed tor four weeks, the levels of ammonia and uric acid returned to control levels. Changes in urinary nitrogen
composition during starvation may be related to the anti-oxidative function of uric acid during periods of stress.
Keywords.- Pond turtle, Chinemys reevesii , bladder urine content, stress, uric acid.
Introduction
The nature of an animal’s nitrogenous waste, including
ammonia, urea and uric acid, is dependent on the envi-
ronment in which it lives (Delaunay, 1931).
Furthermore, the spatial distribution of nitrogenous end
products in the body provides important data on how
that animal responds physiologically to that environ-
ment. The highly diverse excretory function of the
Reptilia has been well-documented (Campbell, 1995),
and although aquatic and semiaquatic turtles are prima-
rily ureotelic, a number of exceptions are known where
the predominant form of nitrogenous waste is ammonia
(Lee et ah, 2007).
The first objective of this study was to determine
the composition of excretory nitrogen in the bladder of
the Chinese Three-keeled pond turtle Chinemys reevesii.
This research will add to the body of literature on nitro-
gen excretion in freshwater turtles, which is currently
very limited (Lee et al., 2007; Singer, 2003).
Nitrogenous end-products have diverse physiologi-
cal functions in different animal groups, including acid-
base regulation, osmoregulation, etc. (Wright, 1995). In
turtles, two of the major factors affecting nitrogen excre-
tion are availability of water and amount of dietary
nitrogen ingested (Singer, 2003), which are of course
highly influenced by starvation and dehydration, which
turtles have developed a magnificent physiological
capability to resist. The aquatic Sonoran mud turtle
(Kinosternon sonoriense ), for example, can aestivate for
1 1 weeks without food or water; during the initial period
of deprivation, urine in the bladder is apparently used
for osmoregulation (Peterson and Stone, 2000). While
ammonia is quite toxic, more inert forms of excretory
nitrogen (e.g. urea and uric acid) are more costly to syn-
thesize (in ATP equivalents; Baze, 1970), making
ammonia the most frequently produced form of waste in
aquatic reptiles because they can lose this waste rapidly
to the environment (Cragg et ah, 1961). Uric acid is con-
sidered to be an endogenous antioxidant, and as such,
might play a role in the clearance of free radicals that are
produced during starvation (Zhu et ah, 2005). The sec-
ond objective of the present work is to investigate how
Chinemys reevesii changes its nitrogen metabolism dur-
ing starvation.
Materials and methods
Experimental animals and diet.- Juvenile turtles were
obtined from a turtle farm in Guangzhou, China and
acclimated to a fixed photoperiod of 12L:12D at a tem-
perature of 29±°C for three weeks in December 2004.
Each of the three turtles were placed in a glass tank with
the dimension of 19 * 23 * 27 cm. Turtles were fed to
apparent satiation twice a day on a commercial formu-
lated feed powder (composition as percentage of dry
matter: crude protein 41.66%, crude lipid 5.84%, ash
18.24%, and water 8.62% of total weight), which was
added to water and extruded to strip pellets before usage.
Each turtle was marked by sawing one to three notches
at the edge of its carapace.
Experimental procedure.- Before the experiment, 108
healthy turtles with a mean body mass of 13.58±1.84 g
(mean ±SD) were chosen, randomly divided into five
groups (C [control], SI, S2, S3 and S4), and placed into
a total of 36 tanks. This experiment lasted eight weeks,
with a period of starvation interrupting periods when the
© 2008 by Asiatic Herpetological Research
Table 1 . Percentage of urine in body weight, nitrogen concentration (mmohL1) and partition (percent) formed as ammonia, urea and uric acid in the bladder of fresh-
water turtles ( Chinemys reevesii) at the end of fasting and after feeding for four weeks. Data expressed as Mean ± SE. Different letters denote significant differences
within the same column, p <0.05.
Gioup C was the control group. Group SI was starved during the fourth week; group S2 was starved during the third and fourth weeks; group S3 was starved from
the second to the fourth week; group S4 was starved for the first four weeks.
144
Asiatic Herpetological Research, Vol. 1 1
2008
c
0)
03
O
TO
o
c
o
n
CO
CL
O
E
E
c
o
to
c
TO
O
c
o
O
■g
'o
co
o
TO
'c
o
E
E
<
TO
CD
TO
,o
■g
‘o
co
o
TO
'c
o
E
E
<
TO
CD
& C £
S5 - O)
-2 CD 0
C C >
CD '£= >
O D >»
£°1
CL
=3
o
5
03
c
— *
c/3
CO
"O
c
CD
CD
o
+1
CM
CM
d
co
CD
CM
+1
LO
CM
d
CM
CO
CO
Is-
00
o
o
o
o
LO
o
©
o
CO CM LO CD CD
u w w w w
03
r-
o
CO
to
LO
LO
CM
o
o
o
CO o
o ^
T- ©
co d
CO CM
Is- to
T- CO
LO LO
T- Is-
03
d d
LL Q.
CO
CD
CD
=3
o
CO
c
d
0
0
0
<
o
CM
LO
CM
O CM
V- CNJ
° d
d d
0- to
•sf CO
CO T-
X
TO
Is-
d
+1
cd
X
o
X
CD
00
O pq
w to CM
+1
XI
00
+1
CO <9 00
CD
03
+1 +1
CO M- CM
^ CD
o
CO
CM
CO
LO CM
CM CM
©
o
CD CM
0- LO
0- LO
d d
00 CM
CO CD
■>— CO
Is-
h-
o
CM
o
d
CD
CO
CD lO CD N N
LL Q.
n ^ cm co ^
u (/)(/) W (/)
2008
Asiatic Herpetological Research, Vol. 1 1
145
turtles were fully fed. The C group included eight tanks
where the turtles were always fed to satiation. The SI,
S2, S3 and S4 groups included seven tanks each. The S4
group was starved in the first four weeks of the experi-
ment. The S3 group was fed in the first week and then
starved tor three weeks. The S2 group was fed for two
weeks and then starved for two weeks. The SI group
was fed for three weeks and then starved for one week.
All groups were fed to satiation from the fifth to eighth
weeks.
Analytical methods.- One turtle was sampled randomly
from every tank at the end of the fourth and eighth
weeks, starved for 24 hours to empty the gut, toweled
off, weighed to within 0.01 g with an electronic balance,
placed in a plastic bag and euthanized at a temperature
of -80°C.
The turtles were dissected and the urinary bladders,
which contained frozen urine, were extracted and
weighed. Urine samples were centrifuged and diluted
twenty times with 0.9% NaCl. Urea and uric acid con-
centrations were determined using a Roche Diagnostics
Cobas INTEGRA 400. The concentration of ammonia
was measured using Roche Modular-P and Integra sys-
tems.
Data processing.- All statistical analyses were per-
formed using the SPSS 13.0 software package. The
Kolmogorov-Smimov test revealed that the data (includ-
ing percentages) followed a normal distribution. A one-
way ANOVA was employed to assess the effects of star-
vation. The Tukey HSD or Games-Howell test was used
for making multiple comparisons between the means of
different groups; p < 0.05 was taken as the level of sig-
nificance.
Results
Table 1 shows the changes in percentage of urine, total
excretory nitrogen concentration, and the proportion of
ammonia, urea, and uric acid among the different groups
at the end of the fasting and refeeding periods.
After fasting, significant differences between the
control and deprived groups were found in the concen-
trations of ammonia (F419= 3.103, p = 0.040)and uric
acid (F4J8= 25.559, p = 0.000), and in the composition of
total excretory nitrogen (F4.l8 = 5.015, p = 0.007;
p4 = 4.789, p = 0.008). Ammonia concentration and its
relative concentration showed a positive relationship
with increading periods of starvation, while those of uric
acid showed the reverse trend. Excretory urea did not
appear to be significantly affected by starvation
(p >0.05).
After feeding for four weeks, urea concentration
and total excretory nitrogen of SI were found to be sig-
nificantly higher in groups S3 and S4, while there were
no clear differences between the other groups for these
two parameters. Furthermore, all groups did not differ
clearly in other parameters measured ip > 0.05). Urinary
nitrogen composition was approximately 2.3% ammo-
nia, 95.8% urea, and 1 .9% uric acid in the control group.
Discussion
In our study, Chinemys reevesii was found to be prima-
rily ureogenic like other freshwater turtles, but it exhib-
ited a relatively higher proportion of urea (about 95.8%)
in excretory nitrogen compared to that of other freshwa-
ter turtles such as Trachemys scripta (about 70%, urine
in ureter; Dantzler and Schmidt-Nielson, 1966) and
Pelodiscus sinensis (54%, water samples; Lee et al.,
2007). Schmidt-Nielsen and Skadhauge (1967) reported
that ureotelic fresh water turtles excreted 45-95% of
their waste nitrogen in the form of urea, comparable to
the results found here.
During food deprivation, the concentration of uric
acid in the turtle’s bladder fell significantly ip = 0.000)
while that of ammonia clearly rose ip = 0.040), even
though they constitute only a small proportion of total
nitrogenous end products. Rapatz and Musacchia (1957)
found that the fasted fresh water turtle Chiysemys picta
(fasted for 6-8 weeks at 22°C) showed characteristic
biochemical properties in decreased liver total fatty
acids, decreased blood glucose and increased urine uric
acid levels. Meanwhile, specimens in cold torpor (4—8
weeks at 4°C) had increased liver total fatty acids, a sig-
nificant increase in liver glycogenolysis and increased
urine uric acid levels. Zhu et al. (2005) found that
Chinemys reevesii retained higher uric acid in its bladder
during cold torpor, but these contents rapidly decreased
when exposed to air because of oxidation. They pre-
sumed that retention of uric acid in the bladder during
cold toipor (they induced hibernation for about one
year) might have a benificial function during long peri-
ods of food deprivation, as uric acid or urate is known to
have antioxidative properties similar to those of vitamin
C and E. This may be the cause of the observed decrease
of uric acid in the bladder during starvation in the pres-
ent study. Conflicting results observed between this and
previous studies may be due to differences in rearing
conditions, the use of a different species iChinemys
reevesii vs. Chiysemys picta ) or ontogenetic differences
(juvenile vs. adult). The increase of ammonia in the
bladder of the turtles may be the result of increased
activity in innate protein catabolism during starvation.
Further research on nitrogen metabolism in stressful
146
Asiatic Herpetological Research, Vol. 1 1
2008
environments should be conducted.
The concentration of total urinary nitrogen and urea
in our experiment did not significantly change with star-
vation, conflicting with prior experiments (Zhu et al.,
2005). This conflict may be due to differences in nitro-
gen metabolism when hibernation is not induced.
Acknowledgments
We thank our colleague Miss Chen-Xi Huang and Dr.
Zhi-Gang Xie for their valuable comments. We are also
grateful to Professor Quan-zhong Shan and Miss Ou Liu
for their help in nitrogen analysis. This research was
supported by the National Natural Science Foundation
of China (No. 30271014, No. 30671598).
Literature Cited
Baze, W. B. and F. R. Home. 1970. Ureogenesis in
chelonian. Comparative Biochemistry and
Physiology 34A: 91-100.
Campbell, J. W. 1995. Excretory nitrogen metabolism in
reptiles and birds. Pp 147-178. In: Walsh P. J. and
P. A. Wright (eds.), Nitrogen metabolism and
excretion. CRC Press, Boca Raton. Cragg, M. M, J.
B. Balinsky and E. Baldwin. 1961. A comparative
study of nitrogen excretion in some amphibia and
reptiles. Comparative Biochemistry and Physiology
3A: 227-235.
Dantzler W. H. and B. Schmidt-Nielsen 1966. Excretion
in fresh-water turtle ( Pseudemys scripta) and desert
tortoise ( Gopherus agassizii ). American Journal of
Physiology 210: 198-210.
Delaunay H. 1931. L’ excretion azotee des invertebres.
Biological Review 6: 265-301.
Lee, S. M. L., W. P. Wong, A. M. Loong, K. C. Hiong,
S. F. Chew and Y. K. Ip. 2007. Postprandial
increases in nitrogenous excretion and urea
synthesis in the Chinese soft-shelled turtle,
Pelodiscus sinensis. Journal of Comparative
Physiology Part B 177: 19-29.
Peterson C. C. and P. A. Stone. 2000. Physiological
capacity for estivation of the Sonoran Mud Turtle,
Kinosternon sonoriense. Copeia 3: 684-700.
Singer M. A. 2003. Do mammals, birds, reptiles and fish
have similar nitrogen conserving systems?
Comparative Biochemistry and Physiology Part B
134: 543-558.
Rapatz G. L. and X. J. Musacchia 1957. Metabolism of
Chrysemys picta during fasting and during cold
torpor. Animal Journal of Physiology 188:
456-J60.
Schmidt-Nielsen B. and E. Skadhauge 1967. Function
of the excretory system of the crocodile
{Crocodylus acutus). Animal Journal of Physiology
212(5): 973-980.
Wright P. A. 1995. Nitrogen excretion: three end
products, many physiological roles. The Journal of
Experimental Biology 198: 273-281.
Zhu Z. R., D. Xiang, Y. Y. Liao, Y. Deng, X. H. Wang
and D. Z. Yin. 2005. Biological characters and bio-
chemical analysis of urine-associated liquid from a
hibernating turtle, Chinemys reevesii. Journal of
Natural Science of Hunan Normal University 28(3):
62-67 . (in Chinese)
Submitted: 01 November 2006
Accepted: 22 September 2007
2008
Asiatic Herpetological Research, Vol. 1 1
pp. 147-1 52 1
Survival and Metabolic Responses to Freezing Temperature in the
Northeast Forest Frog Rana dybowskii
Xianghong Xiao*, Dong Zheng, Cuijun Yang and Longhui Chai
Division of Physiology, Northeast Forestry University, Harbin 15004, China.
* Corresponding author E-mail: [email protected] 1 .com
Abstract.- Dynamic changes in water content, crude oil, general proteins, blood sugar and hepatic glycogen during
freezing temperatures in the Northeast forest frog ( Rana dybowskii Gunther, 1 876) were investigated by establishing
frog freeze-tolerant models. Chemical and biochemical analyses showed that a temperature drop from 4°C to -3°C
resulted in (1) increase in integrative water content and decrease in in vivo moisture and dissociative water contents;
(2) decrease in hepatic glycogen and crude oil and significant increase in blood sugar; (3) significant increase
{p > 0.05) in general protein content; (4) mortality below temperatures of -1°C; (5) and increase in blood sugar and
glucose levels in skeletal muscle following injection of glucose at 4°C and -2°C (hepatic glycogen levels showed sim-
ilar increases in test groups injected with 650 mmol/L and 1500 mmol/L glucose-PBS, but not in groups injected with
2000 mmol/L glucose-PBS). These physiological and metabolic responses suggest that the Northeast forest frog
adopts a positive freeze-tolerant strategy in which glucose serves as the primary mechanism by which damage due to
freezing is prevented.
Keywords.- Freezing tolerance, moisture contents, blood sugar, crude oil, general proteins.
Introduction
The Northeast forest frog (Ranidae: Raninae: Rana
dybowskii Gunther, 1876), formerly classified as a
northeastern population of Rana chensinensis David,
1875 (Xie et al., 1999), is found throughout eastern
Asia, with records from Heilongjiang Province, Jilin
Province, Liaoning Province, the northeast of the Inner
Mongolia Autonomous Region, as well as the Russian
Far East, eastern Mongolia, the Republic of Korea, and
Tsushima island (Japan) (Fei et al., 2005). The climate
in the northern province of Heilongjiang, the region
from which research material was collected, is typified
by intermediate and frigid-temperature zones with a
continental monsoon climate. From November to
March, the average temperature is usually less than 0°C,
while in January, temperatures reach -15°C to -30°C.
Due to climatic factors such as west-wind circumflu-
ence, Siberian air mass, Mongolia high pressure and
Baikal cyclone, winters in Heilongjiang Province are
often dry and without snow.
As is typical of northern amphibians facing freez-
ing temperatures, the Northeast forest frog hibernates to
subtly adjust its physiological functions and metabolism
to survive the winter. Although little physiological and
biochemical investigations have been made on this
species, various freeze-tolerant strategies have been
examined in species with similar biochemical metabo-
lisms, including Rana sylvatica LeConte, 1825, Hyla
versicolor LeConte, 1825, Hyla chrysoscelis and Rana
ridibunda Pallas, 1771 (Storey and Storey, 1986;
Voituron et al., 2000). These have included studies on
ecological behavior, genetic characteristics (Jiang and
Zhou, 2001; Yang et al., 2001; Xia et al., 2006), classifi-
cation (Jiang and Zhou, 2001; Xie et al., 1999; Yang et
al., 2001), artificial breeding and reproduction (Wei et
al., 2005) and biochemical composition (Xiao et al.,
2005). To further explore freeze-tolerant mechanisms
and cryobiology in the Amphibia, we here examine the
moisture, crude oil, proteins, blood sugar and glycogen
contents of the Northeast forest frog when subjected to
freezing temperatures.
Materials and Methods
Materials and freeze-tolerant models - Adult male
frogs weighing 20 to 22 g were collected from the
Yichun area of Heilongjiang Province in September.
Following one week of acclimation to room temperature
(25°C), ten randomly-selected frogs were placed into
separate glass boxes (40 * 40 * 40 cm) and transferred
to digitally-controlled refrigerators. Temperature
dropped at a rate of 1°C every 12 h and was held at 4°C
for up to 60 d. One third of the water in each box was
exchanged with pre-cooled fresh water (4°C) every two
days.
Freeze temperature impacting survival ratios.- To
investigate survival ratios at different temperatures, six
test groups (held at 2°C, 1°C, 0°C, -1°C, -2°C, and -3°C,
© 2008 by Asiatic Herpetological Research
148
Asiatic Herpetological Research, Vol. 1 1
2008
respectively) and one control group (25°C) were estab-
lished with ten frogs per group. For each test group,
water temperature was lowered from 4°C to the target
temperatures specified above at a rate of 2°C per day.
Frogs in those test groups with target temperatures less
than -1°C were placed on water-soaked sponges.
Survivorship was checked once daily and PT100 ther-
mo-sensors were used to monitor temperatures.
Following 10 d of freezing stress, each test group was
returned to room temperature (25°C) for 24 hrs and sur-
vivorship examined, followed by euthanasia and bio-
chemical analysis. Each test was repeated three times.
Measurement of moisture content, crude oil, general
proteins, blood sugar and glycogen.- The drying
method outlined by Han et al. (2005) was used to meas-
ure dissociative and integrative water content: three 10 g
samples from each frog (recorded as fVw) were incubat-
ed at 70°C for 6 or 7 hrs until the semi-dry samples
reached a constant weight (recorded as W70). ; the semi-
dried samples were incubated at 105°C for 5 or 6hrs
until the samples again reached a constant weight
(recorded as Wl05). Calculated dissociative and integra-
tive water percentages were calculated as follows:
W
Dissociative water (%) =100 — x 100
W
VT w
w - w
Integrative water (%) = — 100
W
VT w
The Soxhlet extraction method was used for meas-
uring crude oil (Wei et al., 2004): for each group, 10 dry,
1 g samples (recorded as W(.d) were placed into the
Soxhlet extraction flask and degreased with low-melt-
point aether/petroleum; samples were packaged and
incubated at 105°C for lhr until the weight again
became constant (recorded as Wfat). Crude oil percent-
age was calculated using the following equation:
Wr - W'r
Crude oil (%) = — x 100
Wfat
General protein content was determined by the
Kjeldahl nitrogen determination method: for each group,
semi-dried 0.5 g samples were transferred into a diges-
tion tube; 2.5 g Na2S04, 0.13 g CuS04, and 10 ml H2S04
were added and digested at 400°C for 3 h until the solu-
tion color changed to pea green; the tubes were then
placed on the Kjeldahl nitrogen determination apparatus
for distillation; 15 ml 1% H3B03 were added to the
Erlenmeyer flask and connected to the condensator exit;
20 ml saturated NaOH was added to the reaction and
methyl red/bromocresol green indicator was added until
the solution turned grey; the solution was finally titrated
with HC1 standard buffer until the solution color
changed from grey to blue. General proteins percentages
were calculated with following equation:
Vs is the volume of HC1 standard buffer added to
adjust the distilled sample solution, V0 is the volume of
General proteins (%) = — - — ' °^-x 0.01 x 0.014 x 6.25 x 100
HC1 standard buffer needed to adjust the control solu-
tion, and W is the dry weight of sample.
The ortho-toluidine o-toloidine colorimetry method
and the anthrone colorimetry method were used for
measuring blood sugar and glycogen, respectively (He
et al., 2004): after 24 h of freezing-temperature stress,
blood sugar was measured from heart tissue (immediate-
ly treated with heparin from phlebotomized specimens
within each group); 1 g of liver tissue was used to meas-
ure glycogen; tissue was homogenated and centrifuged,
the supernatant was collected and added to an equal vol-
ume of ethanol; the solution was centrifuged, and 100
ml of distilled water was added to the precipitated
glycogen, which was then measured.
Exogenous glucose intervention assay.- The method
described by Costanzo et al. (1991) was used to detect
the effects of exogenous glucose on glucose metabolism
in frog liver and muscle tissue, and to demonstrate
whether glucose was involved in any freeze-tolerance
mechanisms. For each target temperature (4°C or -2°C),
ten frogs in three test groups and one control group
(25°C) were examined. For the control group, approxi-
mately 2. 3-2. 5 ml 115 mmol/L PBS was injected into
the dorsal lymph bursa, comprising approximately 6.7 %
of total volume in the bursa. (For the three test groups,
different concentrations (650, 1500, 2000 mmol/L,
respectively) of glucose-PBS (pH 7.4) were injected to
again comprise approximately 6.7% of total bursa vol-
ume. All frogs were euthanized following 72 hrs of
freezing temperatures. One gram of blood, liver and
muscle were immediately collected to analyze glucose
contents by the same methods described above.
Statistical analysis.- SPSS (ver.15.0) software was used
for statistic analysis. Confidence intervals were set to
0.05. Data were presented as means±standard error (SE)
and analyzed using a one-way AN OVA; these results
were subsequently analyzed using the Tukey test.
Results
Freezing temperatures and their impact on survival
ratios - During the temperature decrease from 4°C to
-1°C, ice crystals became visible on the skin of the frogs.
After ten days, mortality was observed only below -1°C
(see Fig. 1).
2008
Asiatic Herpetological Research, Vol. 1 1
149
o
\
-* — -4oc.0qc.-1qc
■X--- -2oq
-C-- -3°q
X>._
V - --
1 day 2 days 3 days 4 days 5-10 days
Figure 1. Impact of freeze temperatures and their dura-
tion on survival ratios of Rana dybowskii. Y-axis is sur-
vival ratios in percentage, X-axis is duration. The contin-
uous line with empty triangles represents data from the
test groups at 4°C, 0°C and -1°C. The dotted line with
crosses is for the test groups at -2°C. The dashed line
with empty diamonds is for the test groups at -3°C.
Changes of moisture contents in vivo, crude oils , gen-
eral proteins and glycogen.- Following the temperature
decrease from 4°C to -3°C, moisture contents in vivo
and dissociative water contents decreased gradually,
whereas integrative water was found to increase; fur-
thermore, blood sugar was found to increase while
hepatic glycogen and crude oil decreased significantly.
During freezing-temperature stress, general proteins
were found to decrease slightly with decreases in tem-
perature (p > 0.05) (see Table 1).
Changes in blood sugar and glycogen levels with addi-
tion of exogenous glucose under freezing-tempera-
tures.- At 4°C and -2°C, blood sugar and glucose con-
centrations in skeletal muscle were always found to
increase with the addition of exogenous glucose.
Hepatic glycogen also increased with increasing concen-
trations of exogenous glucose in the test groups injected
with 650 mmol/L and 1 ,500 mmol/L glucose-PBS, how-
ever, it was found to decrease in the test groups injected
with 2,000 mmol/L, particularly at -2°C (p < 0.01) (see
Table 2-3).
Discussion
Since the 1980s, investigators have studied the freezing-
tolerance mechanisms of amphibians, and have found
that species such as Rana sylvatica can precisely regu-
late their metabolic levels in order to tolerate extracellu-
lar ice crystallization (Storey and Storey, 1988), which
plays as key role in survival and evolution.
Investigations on Rana sylvatica , Pseudacris triseriata
and Rana ridibunda (Churchill and Storey, 1995;
Costanzo et al., 1991; Edwards et al., 2004; Layne and
Jones, 2001; Storey and Storey, 1985) illustrate that in at
least some amphibians, endogenous glucose is used as a
protectant during hibernation.
In the present study, it was found that in Rana
dybowskii, freezing temperatures are associated with
dehydration, an increase in blood sugar and a decrease in
hepatic glycogen; temperatures below -1°C are also
associated with increased mortality. Some investigations
have proposed that endogenous water redistribution aids
in the tolerance of freezing temperatures by changing
dissociative water into integrative water, condensing
extra-cellular solutes and promoting intracellular water
trafficking out of cells. This prevents intracellular icing,
lowers the freezing point of the body, induces antifreeze
Table 1. Effects of lowering temperature on percentage of water, crude oil, general proteins and sugar in Rana
dybowskii.
'Different letters in the same column represent significant differences (p < 0.05).
150
Asiatic Herpetological Research, Vol. 1 1
2008
Table 2. Effect of exogenous glucose on blood sugar and
liver glycogen in Rana dybowskii at 4°C.
‘Different letters in the same column represent significant differences
(p < 0.05).
synthesis, and prevents damage to critical organs from
intracellular ice crystallization (Churchill and Storey,
1995; Hermes-Lima and Storey, 1996; Horton, 1996).
Below a certain temperature, however, small ice crystals
enlarge to a point that causes damage to cell membranes
and cellular substructure, thereby causing death.
Stability of the cell membrane would also be compro-
mised, resulting in plasma-membrane fusion, phase
transformation from liquid crystal to gels, membrane
lipids deficiencies, phospholipid separation, etc., and
would destabilize membrane structure (Tong and Nie,
1996). In amphibians glucose is known to function as
antifreeze, lowering the freezing-point of the body,
maintaining cell membranes and stablizing internal
environments (Costanzo and Lee, 1994; Katz, 1989;
King et ai, 1995). In situations involving dehydration,
such as those observed here, hydrogen bond formation
between glucose hydroxyls and the heads of membrane
phospholipids have been found to stabilize lipid bilayers
at the liquid crystalline state, preventing membrane
fusion, phase change, side phase separation, cell leakage
and membrane protein displacement (Tong and Nie,
1996). Simultaneously, freezing temperatures stimulate
the catabolism of hepatic glycogen and crude oils,
increasing blood sugar concentrations, initiating the glu-
cose antifreeze system, stabilize cell membranes, and
enhancing physiological cold-tolerance. These factors
combined provide a physiological and biochemical strat-
egy that the Northeast forest frog uses to survive freez-
ing annual temperatures.
In the present study, it has been illustrated that the
injection of exogenous glucose into the lymph bursa
results in increased levels of blood sugar and skeletal
muscle glucose levels, increasing as higher concentra-
tions of glucose solution are injected, particularly in the
Table 3. Effect of exogenous glucose on blood sugar and
liver glycogen in Rana dybowskii at -2°C.
Skeletal-
Blood sugar Hepatic muScle
(mg %) glycogen (%) glucose (%)
Control 131 .18±0.17a 4.19±0.59a 1.63±0.03a
groups
Test groups 651.69±0.28b 18.43±1.13b 2.54±0.07b
injected with
650 mmol/L
Test groups 7 15.67±2.16c 33.92±1.66c 5.66±0.02c
injected with
1 ,500 mmol/L
Test groups j ,01 2.58±3.90d 20.99±1 ,67b 7.33±0.24d
injected with
2,000 mmol/L
‘Different letters in the same column represent significant differences
(p < 0.05).
test groups kept at -2°C. In comparison, hepatic glyco-
gen levels also showed an increase with higher concen-
tration of the injected glucose solution, although the test
groups injected with 2000 mmol/L glucose-PBS showed
a significant decrease. A possible explanation for this
unexpected result is that extremely high concentrations
of glucose induce diabetes-like symptoms, causing gly-
col-metabolism disorders and decreased glycogen syn-
thesis (Wang and Zhuang, 2001).
Acknowledgments
We thank Liu W. S., Zou Q. and Zeng K.W. for assist-
antship in samples collection. This study was granted by
the Nature Science Fund (C9726) and the Key Projects
of Heilongjiang Province (ZJN0604-02).
Literature Cited
Churchill, T. A. and K. B. Storey. 1995. Metabolic
effects of dehydration on an aquatic frog Rana pip-
iens. The Journal of Experimental Biology 198:
147-154.
Costanzo, J. P. and R. E. Lee. 1994. Biophysical and
physiological responses promoting freeze tolerance
in vertebrates. News in Physiological Sciences 9:
252-256.
Costanzo, J. P, R. E. Lee and M. F. Wright. 1991. Effect
of cooling rate on the survival of frozen wood frogs,
Rana sylvatica. Journal of Comparative Physiology
B 161: 225-229.
2008
Asiatic Herpetological Research, Vol. 1 1
151
Edwards, J. R., J. L. Jenkins and D.L. Swanson. 2004.
Seasonal effects of dehydration on glucose mobi-
lization in freeze-tolerant chorus frogs ( Pseudacris
triseriata) and freeze-intolerant toads (Bufo wood-
housii and B. cognatus). Journal of Experimental
Zoology Part A: Comparative Experimental
Biology 301(6): 521-531.
Fei, L., C. Y. Ye, J. P. Jiang, F. Xie and Y. Z. Huang.
2005. An illustrated key to Chinese
amphibians. Chongdu: Sichuan publishing house of
science and technology. 108 pp. (In Chinese).
Han, R. D„ X. G. Sun, Y. Y. Xu and W. G. Zhang. 2005.
The biochemical mechanism of cold-hardiness in
over wintering larva of Dendrolimus spectabilis
Butler (Lepidoptera: Lasiocampidae). Acta
Ecologica Sinica 25(6): 1352-1356. (In Chinese).
He, X. Z. 2004. Pp 60-64. In Biochemical experiment
technology. Beijing: Chemical Industry Press. (In
Chinese).
Hermes-Lima, M. and K. B. Storey. 1996. Relationship
between anoxia exposure and antioxidant status in
the frog Rana pipiens. The American Journal of
Physiology 271: 918-925.
Horton, D. R. 1996. Reduced cold-hardiness of pear
psylla caused by exposure to external water and
surfactants. The Canadian Entomologist 128(5):
825-830.
Jiang, J. P. and K. Y. Zhou. 2001. Phylogenetic relation-
ships of Chinese Brown Frogs inferred from mito-
chondrial DNA sequence of 12 S ribosome RNA
Gene. Zoological Research 22(1): 27-32. (In
Chinese).
Katz, U. 1989. Strategies of adaptation to osmotic stress
in anuran Amphibia under salt and burrowing con-
ditions. Comparative Biochemistry and Physiology
93(A): 499-503.
King, P. A., M. N. Rosholt and K. B. Storey. 1995.
Seasonal changes in plasma membrane glucose
transport in freeze tolerant wood frogs. Canadian
Journal of Zoology 73: 1-9.
Layne, J. R. Jr. and A. L. Jones. 2001. Freeze tolerance
in the gray tree frog: cryoprotectant mobilization
and organ dehydration. Journal of Experimental
Zoology 290(1): 1-5.
Storey, J. M. and K. B. Storey. 1985. Triggering of cry-
oprotectant synthesis by the initiation of ice nucle-
ation in the freeze tolerant frog, Rana sylvatica.
Comp. Physiological Society, B 156: 191-195.
Storey, K. B. and J. M. Storey. 1986. Freeze tolerance
and intolerance as strategies of winter survival in
terrestrially-hibernating amphibians. Comparative
Biochemistry and Physiology A 83(4): 613-617.
Storey, K. B. and J. M. Storey. 1988. Freeze Tolerance
in Animals. Physiological reviews 68(1): 27-84.
Tong, Q. and S. Q. Nie. 1996. Interaction of sugar with
phosphalipid bilayer-study on the stabiliztion of
liposomes. Progress in Physiological Sciences
27(22): 123-128. (In Chinese).
Voituron, Y., M. Eugene and H. Barre. 2000. Survival
and metabolic responses to freezing by the water
frog (Rana ridibunda). Journal of Experimental
Zoology Part A: Comparative Experimental
Biology 299(2): 118-126.
Wang, C. J. and L. M. Zhuang. 2001. Pp. 16-21. In
Diabetes. Anhui science & Technology Publishing
House. (In Chinese).
Wei, G. Q„ T. F. Wen, F. K. Cai and X. H. Zou. 2005.
Effects of pen rearing condition on morphological
characteristics,body proportion and yield of
Oviducts ranae in the adult of Rana dybowskii.
Journal of Northwest Sci-Tech University of
Agriculture and Forestry 33(12): 17-20. (In
Chinese).
Wei, H., H. J. Zhong and H. Wang. 2004. Improvement
on determination of crude oil by Soxhlet extraction.
China Oils and Fats 29(6): 52-54. (In Chinese).
Xia, Y. G., W. G. Zhao, P. Liu, L. L. Liu, J. Y. Li and Y.
Q. Liu. 2006. The Karyotype of Rana huanrenesis
and R. dybowskii from Huanren, Liaoning
Province. Chinese Journal of Zoology 41(5): 1 03—
106. (In Chinese).
Xiao, X. H., Y. G. Xu and L. H. Chai. 2005. The
Isolation and Extraction of Active Peptides from the
Skin of Rana chensinensis. Journal of Northeast
Forestry University 33(1): 44-^16. (In Chinese).
152
Asiatic Herpetological Research, Vol. 1 1
2008
Xie, F., C. Y. Ye, L. Fei, J. P. Jiang, X. M. Zeng and
Masafumi Matsu. 1999. Taxonomical Studies on
Brown Frogs ( Rana ) From Northeastern China
(Amphbia:Ranidae). Acta Zootaxonomica Sinica.
24(2): 224-231. (In Chinese).
Yang, X. G., Y. Q. Wang, K. Y. Zhou and Z. Q. Liu.
2001. Phylogenetic Relationships of Chinese
Brown Frogs (Rana) Based on Sequence of
Mitochondrial Cytochrome b Gene. Zoological
Research 22(5): 345-350. (In Chinese).
Submitted: 22 November 2006
Accepted: 22 September 2007
2008
Asiatic Herpetological Research, Vol. 11
pp. 153-160
Clone and Sequence Analysis of Sox Genes in Rana tientaiensis
Yan Zhang', Liu Wang Nie1’*, Liang Yan1, Ping Ping Zheng1 and Wen Cheng1
{Life Science College, Anhui Normal University; The Key Laboratory of Biotic Environment
and Ecological Safety in Anhui Province, Wuhu 241000, Anhui, China.
* Corresponding author E-mail: [email protected]
Abstract.- The Sox genes of Rana tientaiensis were amplified and cloned using highly degenerate primers designed
from the conservative motif (HMG-box) of the human SRY gene. The SSCP technique was used to detect different
clones. Seven distinct Sox gene fragments were obtained from both male and female R. tientaiensis ; no sexual differ-
ences were observed. Seven of these fragments (named RtSox3a, RtSox3b, RtSox3c, RtSox4, RtSoxll, RtSoxl2, and
RtSoxl4) exhibited 95%, 95%, 95%, 97%, 98%, 97%, and 97% similarity (respectively) to the corresponding homol-
ogous human SOX genes. The eighth fragment showed 79% and 77% similarity to the human SOX21 and SOX14
genes, as well as varying levels of similarity to other group B Sox genes. The eighth gene, provisionally named
RtSbx514, may be a new member of the Sox gene family or a derivative of an existing Sox gene. Phylogenetic analy-
sis suggests that the RtSox genes are highly conserved members of the SoxB, SoxC and SoxD gene groups. Sequence
analysis further illustrates that the gene Sox3 found in R. tientaiensis are duplicates of those seen in the mammalian
Sox gene family. Amino acid positions 15-19 are characteristic of each group in the Sox family.
Keywords.- Sox genes, SSCP, Rana tientaiensis, subgroup diagnosis.
Introduction
The Y chromosome-linked gene SRY is a dominant
inducer of testis development in mammals (Sinclair et
al., 1990) and a founding member of a gene family with
sequence homology to the High Mobility Group (HMG)
domain (Fawcett and Klymkowsky, 2004). Since dis-
covery of the SRY gene, many members of the SOX/Sox
(SRY- related HMG box) gene family have been found
throughout the vertebrates, showing at least 60% protein
similarity to the SRY HMG domain. Genes in each sub-
group show over 80% similarity. These SOX/Sox genes
have also been found to be involved in physiological
processes such as sex determination and the develop-
ment of the CNS, neural crest and endoderm (Bowles et
al., 2000). Soxl, Sox2, Sox3 and Soxll, for instance, are
expressed mainly in the developing nervous system
(Collignon et al., 1996; Pevny et al., 1998), and Sox 4 is
essential for heart and lymphocyte development
(Schilham et al., 1996). The SOX/Sox genes have been
divided between ten subgroups, named A to J (Table 1 ),
not all of which occur in the same taxa (Bowles et al.,
2000); groups I and J (containing sox31, sox32 and
sox33 ), for instance, are only found in Zebrafish (Girard
et al., 2001; Lunde et al., 2004).
Some amphibians have ZZ/ZW or XX/XY modes
of sex determination, but most species do not have het-
eromorphic chromosomes, making the study of evolu-
tion and the mechanism of sex determination in these
organisms interesting. Rana tientaiensis (2n = 26) is one
of these species without identifiable sex chromosomes
(Guo et al., 1991). In this paper, we describe the cloning
and sequencing of the eight Sox genes in Rana tientaien-
sis with the aim of researching the diversity and evolu-
tion of this gene family. Sequence analysis indicates that
some of these genes in R. tientaiensis are duplicated
Materials and Methods
Two male and two female Rana tientaiensis were cap-
tured from Taolin and Tingxi Anhui Provinces, China.
Genomic DNA was isolated from muscle tissues using
routine protocols. A pair of degenerate primers (snl:
ATGAAYGCNTTYATGGTNTGG; sn2: GGNCGR-
TAYTTRTARTCNGG) were designed using multiple
alignments of the HGM-box sequence of SRY, corre-
sponding to the MNAFMVW and PDYKYRP motifs
found in the HMG boxes of a wide range of Sox pro-
teins.
PCR reactions were 30 pi in volume, including
18.75 pi ddH20 and approximately 100 ng of genomic
DNA, 1.5mM Mg:7, 120 pM dNTP, 0.3 pM/primer and
1.25 pi Taq polymerase. PCR cycling conditions were 1
cycle for 5 minutes at 97°C, followed by 35 cycles with
40 sec. at 94°C, 40 sec. at 53°C, 1 min. at 72°C, and
finally 72°C for 10 minutes to complete the final reac-
tion.
Clones were genetically sequenced to detect the
positive clones with Sox DNA insertions. PCR products
were detected by 1 .5% agarose gels and cloned by pMD
18-T Vector (purchased from TAKARA). Positive
clones were screened by SSCP (single-strand conforma-
© 2008 by Asiatic Herpetological Research
154
Asiatic Herpetological Research, Vol. 1 1
2008
Table 1. Classification of the Sox gene family.
Figure 1. Amplified Sox gene fragments from 1: male
Rana tientaiensis, 2: female R. tientaiensis, 3 : Human; 4:
negative control; M: DL2000 marker (TaKaRa).
tion polymorphism) analysis and sequenced with the
universal sequencing primers on an ABI377 auto-
sequencer. DNA sequences were analyzed using the
BLAST (http://www.ncbi.nlm.nih.gov/BLAST/) and
CLUSTALX programs. Molecular Evolutionary Genetic
Analysis (MEGA) software was used to construct the
phylogenetic tree.
Results and Discussion
A 203 bp fragment of Rana tientaiensis genomic DNA
was obtained using the degenerate PCR primers listed
above. The fragment was identical to that found in the
human genome (Fig. 1), indicating that these fragments
belong to homologous genes.
Of the 113 white clones (i.e., those with insertions),
64 were positive for the Sox insertion, as confirmed
through nucleotide analysis following genomic amplifi-
cation. Eight distinct positive clones were found in both
male and female Rana tientaiensis ; there were no sexual
differences.
Seven of the eight distinct genes were named as fol-
lows: RtSox3a, RtSox3h, RtSox3c, RtSox4, RtSoxll,
RtSoxl2, and RtSoxl4. The amino acid sequences from
these genes had 95%, 95%, 95%, 97%, 98%, 97%, 97%
and 97% similarity (respectively) to homologous SOX
genes in Human. These seven genes belonged to the
SoxB , SoxC and SoxD subgroups, all of which lack
introns (Bowles et al., 2000). The 9th Sox gene was pro-
visionally named RtSoxB14; the amino acid sequences
from this gene had 79% similarity to the Human SOX21
gene, 77% similarity to the Human Soxl4 gene, as well
as varying levels of similarity to other group B Sox
genes. Nucleotide and putative amino acid sequences for
the eight Sox genes are listed (Fig. 2)
The amino acid sequences from the eight clones
were compared to 44 published Sox gene sequences in
GenBank, including sequences from Human ( HomoSRY,
SOX1, 2, 3, 4, 7, 9, 11, 12, 14, 15, 21, 30), Mouse
(. MusSoxl , 2, 3, 4, 7, 9, 11, 12, 14, 15, 21, 30), Gallus
gallus (GallSox 2, 3, 9, 11 , 14, 21), Danio rerio
( DaniSoxl , 2, 4, 11), Xenopus laevis ( XenopusSox2 , 4,
11), Takifugu rubripes {TakifuguSox 1 , 14b) and Eremias
breuchleyi ( EbSox2 , 4, 11, 12, 14 ,21) (Table 2). All
sequences were analyzed using neighbor-joining (NJ)
methods by MEGA 2.0 (Fig. 3).
Amino acid sequences between the RtSox genes
were highly conserved. Representatives of the Sox gene
in other species were also highly conserved with much
similarity between sequences. Gene duplication has
likely caused most of the diversity seen in the HMG box
superfamily, for which the Sox genes show the highest
mutation rate (Laudet et al., 1993). The high similarity
seen between the Rana and human genes in this study
are certainly indicative of gene duplication.
In the case of Soxl2, amino acid sequences were
nearly identical, although the 10th amino acid was N
instead of H in Human and Mouse (Fig. 2). In Sox 4, the
48th amino acid was R instead of Q in Mouse, and in
Soxll, the 48th amino acid was D instead of N in Mouse,
Human and several other species. The high degree of
similarity amongst these genes suggests that they belong
to the same gene family, and may perform similar roles
amongst taxa. For example, the three highly conserved
genes in group C display overlapping expression pat-
terns, and Sox4 and Soxll display overlapping expres-
sion patterns in the mouse embryonic pancreas
(Lioubinski et al., 2003).
According to Laudet et al. (1993), Sox4 is consid-
ered to be an early offshoot of the SRY gene in the Sox
tamily phylogeny. The conservative nature of Sox4
homologues in non-mammalian amniotes is interesting
because in mammals, the SRY gene exhibits rapid evolu-
2008
Asiatic Herpetological Research, Vol. 1 1
155
Table 2. Sox genes sequence in different species
tion, possibly caused by Y-linked inheritance (Tucker
and Lundrigan, 1993). The limited diversity of this gene
in non-mammalian taxa may be due to the retention of
an ancient conserved function.
It is likely that Sox3 is the closest homologue to the
Srv gene based on nucleotide sequence data.
Furthermore, Sox3 is located on the mammalian X chro-
mosome, and is highly similar to SRY (Sinclair et al.,
1990), suggesting that they arose through duplication of
their common ancestral during differentiation of the sex
chromosomes (Collignon et al., 1996; Foster and
Graves, 1994; Stevanovic et al., 1993). This is signifi-
cant because the X and the Y chromosomes are thought
to have arisen from a common “autosome” ancestor in
the lineage that gave rise to mammals (Wright et al.,
1993). Further examination of Sox genes in lower verte-
brates, Prototheria (monotremes) and Metatheria (mar-
supials) will be necessary to establish the evolutionary
origins of Snc The three conservative Sox3 genes (some-
times found within the same species or individual) can
be identified by the following variations in amino acid
sequence: RtSox3a has an F at position 46 and an H at
position 58; RtSox3h has an F at position 46 and an M at
position 58; RtSox3c has an I on position 46 and an M
on position 58.
The RtSoxB14 is unique among the Sox genes in
having the amino acid sequence VITEH at positions 15-
1 9, a K at position 44 and an S at position 50. In the phy-
logenetic tree (Fig. 3), although RtSoxB14 was more
closely related to subgroup B than other groups, the ori-
gin and classification of this gene is ambiguous.
Previously, genes encoding proteins with more than
60% similarity to the SRY FIMG domain have been
named Sox {SRY box) genes, and Sox genes with at least
156
Asiatic Herpetological Research, Vol. 11
2008
Figure 2. (A) Alignment of nucleotide sequences (above), (B) Alignment of amino acid sequences (Opposite page, top),
(C) Percentage amino acid similarity between Rana tientaiensis Sox clones as determined by the sequence identity
matrix function in Bioedit (Opposite page, bottom).
2008
Asiatic Herpetological Research, Vol. 11
157
RtSox3a
RtSox3c
RtSox3b
RtSoxl4
RtSoxBl4
RtSoxl 1
RtSox4
RtSoxl2
MN AF MVWS RG QR RKMA QE NP KIvIHN S E I S KR LG ADWK LLS D AE KR PF I D EA KR LRAVHT KE YP D Y KY R
********************************************** ***********JyJ** *******
^^^^^^^^^^^^^ifc**;***********;!!#:***!***********!^*********
************ *****D***************g*****gY****Y*********C*M**H******
*********V****VI T* H* ****** ***K***Q****G*S**K*****S *****Q*M"7*H******
********KIE***IMEQ$*D**DA*******KR**M*K*S**I***R**E***LK*MAD*******
****** **yj E*** IMEQS*D*Y; *A*******KR****K*;jD*I ***g**E***Lh #141’*******
********QNE***IMDQW*D***A*******RR*Q**Q*S**I**W**E***LK*MAD*******
SoxB
Sox C
SoxD
Figure 2 (continued).
80% similarity have been placed in the same subgroup.
However, as more and more Sox genes are identified, the
ability to accurately classify these genes decreases. For
example, the genes sox30 and Ce-soxj have only 46%
and 48% similarity to Human S7?FHMG. Bowles (2000)
attempted to alternatively diagnose the gene family by
possession of the amino acid sequence “RPMNAF”,
which is highly conserved across genes, however, this
sequence was also found in the taxonomically ubiqui-
tous gene cic, so the sequence “RPMNAFMVW” was
provided as a replacement (Bowles et al., 2000).
Now that a sequence identifying the Sox gene fam-
ily has been identified, can sequences be found to char-
acterize the Sox subgroups? Following analysis of the
available sequences (Figure 4), it appears that positions
15-19 may have be useful for this purpose. The
sequence “MAQE(D)N” may work for group B (except
for HomoSOXS and MusSox3), “IMEQS” for group C,
“IMEQW” (for Soxl2 ) or “ILQAF” (for Sox5, Sox6 and
Sox 13) for group D, “LADQY” for group E, “LAVQN”
(for SoxT) or “LAQQN” (for Soxl7 and SoxlS ) for
group F, “MAQQN” for group G and “LAKAN” for
group H. RtSoxB 14 can be separated from the remaining
Sox genes by the unique sequence VITEH, although in
mammals ( HomoSOX3 and MusSox3) it is changed to
“MALEN”, like the sequence for SRY. This further sup-
ports a close relationship between the SOX3 and SRY
genes.
Several Sox genes appear to have been duplicated
in Rana tientaiensis : RTSox3a, RTSox3b and RTSox3c.
Similar duplications in amphibians are uncommon, but
they are more frequently encountered in teleosts: Soxl,
4, 9 and 14 has been duplicated in the sea bass (Malyka
et al., 2003) and Sox21 has been duplicated in the
Zebrafish (Argenton et al., 2004). The “duplication-
degeneration-complementation” model developed by
Force et al. (1999) suggests that the partition of ancestral
subfunctions is an important mechanism leading to the
preservation of multiple gene copies; this model predicts
that the probability of gene conservation will be higher
in more complex genes with a larger number of subfunc-
tions (Force et al. 1999). Most duplicate genes in Rana
tientaiensis have silent mutations (except RtSox3a ,
which has an encoded amino acid mutation), but it
would appear that the sequences are under selective
pressure and may indeed perform separate subfunctions.
Future studies investigating Sox genes in Rana tientaien-
sis will likely provide much insight into duplicate genes.
Acknowledgments
We are grateful to the reviewers for numerous valuable
suggestions on the manuscript. This research was sup-
ported by National Natural Science Foundation of China
(No. 30640048, No. 30770296), the Natural Science
Foundation of Anhui Education Department
(KJ2007A022).
158
Asiatic Herpetological Research, Vol. 1 1
2008
G5
32
G7
79
7G
61
30
72
77
80
94
51
86
84
85
97
54
99
63
84
97
99
50
82
73
59
53
95
G5
G9
77
77
77
77
99
99
99
- GallusSox2
- XenopusSox2
- EbSox2
- DariioSox2
- HomoSox2
- MusSox2
- HomoSoxI
■ MusSoxI
■ DanioSoxI
- TakifuguSoxI
• GallusSox21
■ EbSox21
• MusSox21
■ HomoSox21
■ RTSoxU
• EbSox14
■ HomoSox14
■ MusSoxI 4
■ GallusSox14
■ TakifuguSox14B
■ XenopusSox3
RTSox3a
■ MusSox3
■ HomoSox3
GallusSox3
RTSox3c
RTSox3b
RTSoxB14
B
incertae
sedis
- HornoSox15
- MusSoxI 5
- HomoSry
- EbSox12
- RTSox12
- HomoSox12
- MusSox12
- MusSox4
- RTSox4
- HomoSox4
- DanioSox4
- EbSox4
- DanioSox1 1
- HomoSox1 1
- MusSox1 1
■ GallusSox1 1
■ XenopusSox1 1
■ RTSoxll
■ EbSoxI 1
• HomoSox7
MusSox7
HomoSox9
MusSox9
GallusSox9
mussox30
homosox30
HomoTcf-1
I G
I A
D
C
F
E
H
Outgroup
Figure 3. Phylogenetic analysis of Sox/SOX gene family
2008
Asiatic Herpetological Research, Vol. 1 1
159
imissox30
hom os ox30
MusSox4
RTS ox4
Horn oSox4
DanioSox4
EbS ox4
HomoSoxl 1
MusSoxl 1
GallusSoxll
XenopusS oxll
RTS oxll
EbS oxll
DanioSoxll
HomoSoxl 2
MusSoxl 2
Homosox22
RTS oxl2
EbS oxl2
MusSoxT
Hom oSox?
Hom osoxT
Homosoxl7
Hom osoxl 8
Hom oSox9
MusSox9
GallusSox9
Hom osoxl 0
MusSox3
Hom oSox3
GallusSox3
RTS ox3 c
RTS ox3 a
RTS ox3b
XenopusS ox3
Hom oSoxl
MusSoxl
DanioSoxl
Taki fuguSoxl
GallusSox2
XenopusS ox2
EbS ox2
Hom oSox£
MusSox2
Dani oSox2
MusSox21
Hom oSox21
EbS ox21
GallusSox21
Hom oSoxl 4
MusSoxl 4
GallusSoxl4
EbS oxl4
RTS oxl4
T ak i fuguSox 1 4B
RTS oxB 1 4
Hom oSoxl 5
MusSoxl 5
Hom oSry
Hom 050x5
Hom osoxl 3
Hom osox6
HomoTcf-!
M HAFMVWARIHRP A LAKANP AANHAEIS VQLGLEWNKLS EEQKKFY YDEAQ KIKEEHREE F PGWVYQ F
M NAFMV'WARIHRP A LAKAN 3 AAHNAEIS VQLGLEWHKLS EEQKKPY YDEAQ KLKEKHREE F PGYYVYQ F
MHAFMVWSQIERRK IMEQS ’DMHHAEISKRLGKRWKLLKDSDHPFIQEAE RLRLKHM AD YPDYKYRP
MNAFMVWSQIERRF IMEQS ’DMYNAEISICRLGKRWKLLKDSDKIPFIQEAERLRLKHMAD YFDYKYRF
MHAFMVWSQIERRF IMEQS ’DMHNAEISKRLGKRWKLLKDSDKIPFIREAE RLRLKHM AD YPDYKYRP
M NAFMVWSQIERRF IMEQS 5 DMHNAEIS KRLGKRWKLLKDSDH FF IREAE RLRLKHM AD Y FDYKYRF
MHAFIVWSRIERRF IMEQS I1 DMHMAEIS KRLGKRWKLLKDSDKIPFIQEAERLRLKHMADIFHYKYRP
M HAFMVWS KIERRH IMEQS 3 DMHNAEIS KRDGKRWKMLK DSEKIPF IREAE RLRLKHM AD Y FDYKYRF
MNAFMVWSKIERRF IMEQS ’DMHNAEISFCRLGKRWKMLKDSEKIFFIREAE RLRLKHM AD YPDYKYRP
M HAFMVWS HERRK IMEQS 1 DMHNAEIS KRLGKRWKMLKDSEKIPF IREAE RLRLKHM AD Y PDYKYRP
MNAFMVWSKIERRF IMEQS 3 DMHNAEIS KRLGKRWKMLKDSEKIPF IREAE RLRLKHM AD YPDYKYRP
M HAFMVWS HERRI IMEQS 3 DMHDAEIS KRLGKRWKMLKDSEKIPF IREAE RLRLKHM AD Y FDYKYRF
MHAFIVWSKIERKf IMEQS ? DMHNAEIS KRLGKRWKMLKDSEHFF IREAE RLRLKHM AD Y PDYKYRP
M HAFMVWS HERRF IMEQS ? DMHMAEIS KRLGKRWKMLKDSEKIFF IREAE RLRLQHM AD Y FDYKYRF
M HAFMVWSQHERR* IMDQW 5 DMHMAEIS KRLGRRWQLLQ DSEKIPF VREAE RLRLKHM AD Y FDYKYRF
M HAFMVWS QHERRF IMDQW 5 DMHNAEIS KRLGRRWQLLQ DSEKIPF VREAE RLRLKHM AD Y PDYKYRP
M HAFMVWS QHERRB IMDQW ? DMHMAEIS KRLGRRWQLLQ DSEKIPF VREAE RLRLKHM AD Y PDYKYRP
M HAFMVWSQHERR! IMDQW ’DMHMAEIS KRLGRRWQLLQ DSEKIPF VKEAE RLRLKHM AD Y PDYKYRP
MNAFIVWSQHERRK IMDQW ? DMHMAEIS KRLGRRWQLLQ DSEKIPF VKEAE RLRLKHM AD Y PDYKYRP
M NAFMVWAKDERKF LAVQH ? DLHHAELS KMLGKSWKALT LSQKRFY VDEAE RLRLQHM QD Y FNYKYRP
MNAFMVWAKDERKF LAVQN ? DLHMAELS KMLGKSWKALT LSQKRPY VDEAE RLRLQHM QD Y FNYKYRP
M HAFMVWAKDERKf LAVQH ? DLHHAELS KMLGKSWKALT LSQKRPY VDEAE RLRLQHM QD YFNYKYRP
MHAFMVWAKDERKI LAQQM ? DLHHAELS KMLGKSWKALT LAEKRPF VEEAE RLRVQHM QD HPMYKYRP
MNAFMVWAKDERKFLAQQN’DLHNAVLSKMLGKAWKELHAAEKRFFVEEAERIRVQHLRI HFHYJCYRP
M HAFMVWAQ AARRK LADQY ? HLHNAELS KTD3KLWRLUIESEKRPF VEEAE RLRVQHKKD HFDYKYQP
M HAFMVWAQAARRK LADQY 3 HLHNAELS KTLGKLWRLLHESEKRPF VEEAE RLRVQHKKD HFDYKYQP
MHAFMVWAQAARRi LADQY 3 HLHNAELS KTLGKLWRLLHESEKRPF VEEAE RLRVQHKKD HFDYKYQP
M HAFMVWAQ AARRi LADQY ? HLHHAELS KTLGKLWRLLNESDKRPFIEEAE RLRMQHKKD HFDYKYQP
M HAFMVWS RGQRRK 9ALEN 1 KMHHSEIS KRLGADWKLLT DAE KRPF IDEAKRLRAVHM KE Y PDYKYRP
M HAFMVWS RGQRRF I1ALEN 3 KMHHSEIS KRIGADWKLLTD AEKRPF IDEAKRLRA'/HMKE Y PDYKYRP
M HAFMVWS RGQRRF 9 AQEN 3 KMHHSEIS KRLGADWKLLS DAEKRPF IDEAKRLRAVHM KE Y PDYKYRP
M HAFMVWS RGQRRF 9 AQEN ? KMHHSEIS KRLGADWKLLS DAEKRPF IDEAKRLRAVHM KE Y PDYKYRP
M HAFMVWS RGQRRF 9AQEN? KMHHSEIS KRLGADWKLLS DAEKRPF IDEAKRLRAVHTFI YPDYKYRP
M HAFMVWS RGQRRK W AQEH 3 KMHHSEIS KRLGADWKLLS DAEKRFI IDEAKRLRAVHM KE Y PDYKYRP
M HAFMVWS RGQRRK 9AQEN ? KMHHSEIS KRLGADWKLLS DSDKRPFIDEAKRLRAVHMKD YPDYKYRP
M HAFMVWS RGQRRK 9 AQEN 5 KMHHSEIS KRLGAEWKVMS E AEKRPF IDEAKRLRALHM KE HPDYKYRP
M HAFMVWS RGQRRF 9AQEN 3 KMHNSEIS KRLGAEWKVMS EAEKRPF IDEAKRLRALHM KEHPDYKYRF
M HAFMVWS RGQRRF 9 AQEN 3 KMHHSEIS KRLGAEWKVMS EAEKRPF IDEAKRLRAMHM KEHPDYKYRF
M HAFMVWS RGQRRF 9 AQEN ? KMHHSEISKRLGAEWKVMT EAE KRPF IDEAKRLRAMHM KE HPDYKYRF
M HAFMV'WS RGQRRF 9 AQEN ’KMHHSEIS KRDGAEWKLLS EAEKRPF IDEAKRLRALHM KEHPDYKYRF
M HAFMVWS RGQRRK 9AQEN 3 KMHNSEIS KRLGAEWKLLS EAEKRPF IDEAKRLRALHM KEHPDYKYRF
M HAFIVWS RGQRRK WAQEH 3 KMHHSEIS KRLGAEWKLLS EAEKRPF IDEAKRLRALHM KE HPNYKYRF
M HAFMVWS RGQRRF WAQEN 3 KMHHSEIS KRLGAEWKLLS ETEKRPF IDEAKRLPALHM KE HPDYKYRF
M HAFMV'WS RGQRRK W AQEH 3KMHHSEISKRLGAEWKLLSETEKRFFIDEAKRLRALHM KEHPDYKYRF
M HAFMVWS RGQRRK WAQEH 3 KMHHSEIS KRLGAEWKLLS ESEKRFFIDEAKRLRALHM KEHPDYKYRF
M HAFMVWS KAQRRK WAQEH 3 KMHNSEIS FCRLGAEWKLLT ESEKRPF IDEAKRLRAMHIW KE HPDYKYRF
M HAFMVWS RAQRRK WAQEH 3 KMHHSEIS KRLGAEWKLLT ESEKRPF IDEAKRLRAMHM KE HPDYKYRF
M HAFIVWS RAQRRK 9AQEH 3 KMHHSEIS KRLGAEWKLLT ESEKRPF IDEAKRLRAMHM FCEHPHYKYRP
M HAFMV'WS RAQRRK 9AQEN PKMHHSEIS KRLGAEWKLLS EAEKRPF IDEAKRLRAMHM KE HPDYKYRP
M HAFMVWS RGQRRK 9 AQEH 3 KMHHSEIS KRLGAEWKLLS EAEKRPYIDEAKRLRAQHM ICE HPDYKYRP
M HAFMV'WS RGQRRF 9AQEH 3 KMHHSEIS KRLGAEWKLLS EAEKRPYIDEAKRLRAQHMKE HPDYKYRP
M HAFMVWS RGQRRK 9 AQEH ’KMHHSEIS KRLGAEWKLLS EAEKRPY IDEAKRLRAQHMKE HPDYKYRP
M HAFMV'WS RGQRRK 9 AQEH 3 KMHHSEIS KRLGAEWKLLS EAEKRPY IDEAKRLRAQHM KE KPHYKYRP
M HAFMVWS RGQRRK 9AQDN 3 KMHHSEIS KRLGAEWKLLS EVEKRPY IDEAKFLRAQHM KE HPDYKYRP
M NAFMVWS RGQRRF 9 AQEH 3 KMHNSEIS KRLGAEWKLLS DSEKRPY IDEAKRLRAQHM KE HPDYKYRP
M HAFMV'WS RVQRRF VITEH 3 KMHHSEIS KKUGAQWKILGDSEKKPF IDESKRLRAQHM VI HPDYKYRP
M HAFMVWSSAQRRC 9AQQH 3 KMHHSEIS KRLGAQWKLLD EDEKRPF VEEAKRLRARHLRD Y PDYKYRP
MHAFMVWSSVqRRC9AQQN3KMHHSEISKRDGAQWKLLGDEEKRPFVEEAKRLRAKHLRD YPDYKYRP
M HAFIVWS RDQRRE WALEN 3 RMRHSEIS KQLGY QWEMLT EAEKWPF FQEAQ KLQAMHREK Y FHYKYRF
M HAFMVWA KDERRK IUQAF 3 DMHHSHIS KIIGS RWKAMT HLEFBPY YEEQARLSKQHLEK Y PDYKYKP
MHAFMVWAKDERRF ILQAF ’DMHNSSISKILGSRWKSMTMQEKQPY YEEQARLSRQHLEKYPDYKYKP
MHAFMVWAKDERRF ILQAF 3 DMHHSHIS KIIjGS RWKSMS HQEKQPY YEEQAFLSKIHLEK YPHYKYKP
M YKETVYS AFH — LLHHYPF PSGAGQHPQFQPF LHKANQ PPHGVPQ LSLYE HFNSPHP TP APADIS QKQV
Figure 4. Characteristic Sox amino acid sequences.
Literature Cited
Bowles, J., G. Schepers, and P. Koopman. 2000.
Phytogeny of the SOX family of developmental
transcription factors based on sequence and struc-
tural indicators. Developmental Biology 227: 239-
255.
deMartino, S., Y. L. Yan, and T. Jowett. 2000.
Expression of Sozll gene duplicates in zebrafish
suggests the reciprocal toss of ancestral gene
expression patterns in development. Developmental
Dynamics 217(3): 279-292.
Fawcett, S. R. and M. W. Klymkowsky 2004.
Embryonic expression of Xenopus laevis S0X7.
Gene Expression Patterns 4(1): 29-33.
Force, A., M. Lynch, F. B. Pickett, A. Amores, Y. L. Yan,
and J. Postlethwait. 1999. Preservation of duplicate
genes by complementary, degenerative mutations.
Genetics 151: 1531-1545.
Foster, J. W. and J. A. Graves. 1994. An SRY-related
sequence on the marsupial X chromosome:
Implications for the evolution of the mammalian
testis-determining gene. Proceedings of the
National Academy of Sciences. USA 91: 1 927—
1931.
Girard, F., F. Gremazy and P. Berta. 2001. Expression
pattern of the Sox 3 1 gene during zebrafish embry-
onic development. Mechanisms of Development
100(1): 71-73.
Guo, C. W., Y. W. Dong and S. H. Zhang. 1991. Studies
on the karyotype and ag-NoRs of Rana tientaiensis
and Microhy la. Hereditas 13(2): 6-8.
Hagiuda, J., Y. Hiraoka, M. Hasegawa, M. Ogawa and S.
Aiso. 2003. A novel Xenopus laevis SRY-related
gene, xSox33. Biochem. Biophys. Acta 1628(2):
140-145.
Laudet, V., D. Stehelin and H. Clevers. 1993. Ancestry
and diversity of the HMG box superfamily. Nucleic
Acids Research 21(10): 2493-2501.
Lioubinski, O., M. Muller, M. Wegner and M. Sander.
2003. Expression of Sox transcription factors in the
developing mouse pancreas. Developmental
Dynamics 227: 402-408.
Lunde, K., H.-G. Belting and W. Driever. 2004.
Zebrafish pou5fl/pou2, homolog of mammalian
Oct4, functions in the endoderm specification cas-
cade. Current Biology 14(1): 48-55.
Collignon, J., S. Sockanathan, A. Flacker, M. Cohen-
Tannoudji, and D. Norris. 1996. A comparison of
the properties of Sox3, with SRY and two related
genes, Soxl and Sox2. Development 122: 509-520.
Ohno, S. 1970. Evolution by gene and genome duplica-
tion. Springer Verlag, Berlin.
Pevny, L. H., S. Sockanathan, M. Placzek, and R.
160
Asiatic Herpetological Research, Vol. 11
2008
Lovell-Badge. 1998. A role for SOX1 in neural
determination. Development 125(10): 1967-78.
Rimini, R., M. Beltrame, F. Argenton, F. Cotelli and M.
E. Bianchi. 1999. Expression patterns of zebrafish
SOZ11A, SOS11B and So.z21. Mechanisms of
Development 89: 167-171.
Schilham, M. W., M. A.Oosterwegel, P. Moerer, J. Ya, R
A. deBoer, M . Van der Wetering , S. Verbeek, W.
H. Lamers, A. M. Kruisbeek, A. Cumano and H.
Clevers.1996. Defects in cardiac outflow tract for-
mation and pro-B-lymphocyte expansion in mice
lacking Sox-4. Nature 380(6576): 711-714.
Sinclair, A. H., R Berta and M. S. Palmer. 1990. A gene
from the human sex-determining region encodes a
protein with homology to a conserved DNA-bind-
ing motif. Molecular Phylogenetics and Evolution
3(1): 1-9.
Sinclair, A. H., P. Berta, M. S. Palmer, J. R. Flawkins, B.
L. Griyths, M. J. Smith, J. W. Foster, A. M.
Frischauf, R. Lovell-Badge, and P. N. Goodfellow.
1990. A gene from the sex-determining region
encodes a protein with homology to a conserved
DNA-binding motif. Nature 346: 240-244.
Stevanovic, M., R. Lovell-Badge, J. Collignon, and P. N.
Goodfellow. 1993. SOX3 is an X-linked gene relat-
ed to SRY. Human Molecular Genetics 2: 2013-
2018.
Tucker, P. K. and B. L. Lundrigan. 1993. Rapid evolu-
tion of the sex determining locus in Old World mice
and rats. Nature 364(6439): 715-717.
Wright, E. M., B. Snopek. and P. Koopman. 1993. Seven
new members of the Sox gene family expressed
during mouse development. Nucleic Acids
Research 21 : 744.
Submitted: 25 October 2006
Accepted: 23 September 2007
2008
Asiatic Herpetological Research, Vol. 1 1
pp. 16 1-205
Cummulative Index to Vols. 1-10 of
Asiatic Herpetological Research
Compiled by
Genevieve V. A. Gee
Flat A09-4 Satria Court, BDC
Kuching, Sarawak, Malaysia
E-mail: [email protected]
Author Index
Aa
Adler, K.
Studies on hynobiid salamanders, with descrip-
tion of a new genus. Asiatic
Herpetological Research 3:37-45. (K.
Adler and E. Zhao)
First records of the pipe snake ( Cylindrophis )
in China. Asiatic Herpetological Research
4:37^1. (K. Adler, E. Zhao and I. S.
Darevsky)
Ahsan, M. F.
The first record of Ptyas korros (Colubridae)
from Bangladesh. Asiatic Herpetological
Research 9:23-24. (M. F. Ahsan and S.
Parvin)
A record of Boiga ochracea walli (Stoliczka,
1870) from Bangladesh. Asiatic
Herpetological Research 10:235. (M. F.
Ahsan and S. Parvin)
Some aspects of breeding biology of the
Bengal Lizard ( Varanus bengalensis) in
Bangladesh. Asiatic Herpetological
Research 10:236—240. (M. F. Ahsan and
M. A. Saeed)
Al-Johany, A. M.
The activity and thermal biology of the fossor-
ial reptile, Diplometopon zarudnyi
(Amphisbaenia: Trogonophiidae) in
Central Saudi Arabia. Asiatic
Herpetological Research 8:1-6.
Ananjeva, N. B.
Historical biogeography of the
Phrynocephalus species of the USSR.
Asiatic Herpetological Research 4:76-98.
(N. B. Ananjeva and B. S. Tuniyev)
Stellio sacra (Smith 1935) - a distinct species
of Asiatic rock agamid from Tibet. Asiatic
Herpetological Research 3:104-115. (N.
B. Ananjeva, G. Peters, J. R. Macey and T.
J. Papenfuss)
See also J. R. Macey (and N. B. Ananjeva)
Anderson, S. C.
Book review: A guide to the fauna of Iran.
Asiatic Herpetological Research 9:149-
150.
Book review: Four recent handbooks for
Turkey. Asiatic Herpetological Research
9:151-152.
Book review: Wild about reptiles. Field guide
to the reptiles and amphibians of the UAE.
Asiatic Herpetological Research 9:153.
Andren, C.
See G. Nilson et al. (and C. Andren)
Arnekleiv, J. V.
See D. Dolmen et al. (and J. V. Arnekleiv)
Assadian, S.
See M. Sharifi (and S. Assadian)
Ataev, C.
See S. Schammakov et al. (and C. Ataev)
Atayev, C. A.
See B. S. Tuniyev et al. (and C. A. Atayev)
Auffcnberg, K.
Studies on Pakistan lizards: Cyrtopodion
stoliczkai (Steindachner, 1867)
(Gekkonidae: Gekkoninae). Asiatic
Herpetological Research 10:151-160. (K.
Auffenberg, K. L. Krysko and W.
Auffenberg)
© 2008 by Asiatic Herpetological Research
162
Asiatic Herpetological Research, Vol. 1 1
2008
Auffenberg, W.
Studies on Pakistan reptiles. Pt. 3 Calotes ver-
sicolor. Asiatic Herpetological Research
5:14-30. (W. Auffenberg and H. Rehman)
Calotes versicolor nigrigularis Auffenberg and
Rehman 1993 a junior primary homonym.
Asiatic Herpetological Research 6:27.
Autumn, K.
Preliminary observations on the ecology of
Phrynocephalus axillaris and Eremias
velox in the Turpan Depression, Xinjiang
Uygur Autonomous Region, China. Asiatic
Herpetological Research 2:6-13. (K.
Autumn and Y.-Z. Wang)
Mimicry of scorpions by juvenile lizards,
Teratoscincus roborowskii (Gekkonidae).
Asiatic Herpetological Research 2:60-64.
(K. Autumn and B. Han)
Ayaz, D.
See M. Tosunoglu et al. (and D. Ayaz)
Bb
Balletto, E.
See T. Dujsebayeva et al. (and E. Balletto)
Barth, D.
See M. Schilde et al. (and D. Barth)
Batra, R.
Simplified field technique for obtaining blood
from freshwater turtles. Asiatic
Herpetological Research 6:28-29. (R.
Batra and S. Prakash)
Bauer, A. M.
A preliminary report on the reptile fauna of the
Kingdom of Bhutan with the description of
a new species of scincid lizard (Reptilia:
Scincidae). Asiatic Herpetological
Research 4:23-36. (A. M. Bauer and R.
Gunther)
The systematic relationships of Dravidogecko
anamallensis (Gunther 1875). Asiatic
Herpetological Research 6:30-35. (A. M.
Bauer and A. P. Russell)
Bell, C. J.
See W. G. Joyce (and C. J. Bell)
Beregovaya, S. Y.
See B. S. Tuniyev (and S. Y. Beregovaya)
Biswas, S.
See S. S. Pawar (and S. Biswas)
Biun, A.
See R. F. Inger et al. (and A. Biun)
Blamires, S. J.
Influence of temperature on burrow use by the
monitor lizard Varanus panoptes of the
coastal dunes at Fog Bay, Northern
Australia. Asiatic Herpetological Research
9:25-29.
Bon, C.
See Y. Zhang et al. (and C. Bon)
Borkin, L. J.
See S. N. Fitvinchuk et al. (and F. J. Borkin)
D. V. Semenov (and F. J. Borkin)
Bour, R.
See J. Perala (and R. Bour)
Brown, R. M.
Description of a new species of Pseudorabdion
(Serpentes: Colubridae) from Panay
Island, Philippines with a revised key to
the genus. Asiatic Herpetological Research
8:7-12. (R. M. Brown, A. E. Feviton and
R. V. Sison)
A new snake of the genus Hologerrhum
Gunther (Reptilia; Squamata; Colubridae)
from Panay Island, Philippines. Asiatic
Herpetological Research 9:9-22. (R. M.
Brown, A. E. Feviton, J. W. Femer and R.
V. Sison)
See also, A. C. Diesmos et al. (and R. M.
Brown)
J. W. Femer et al. (and R. M. Brown)
Bursey, C. R.
See S. R. Goldberg et al. (and C. R. Bursey)
Bushkirk, J. R.
New locality records for Chinese non-marine
chelonians. Asiatic Herpetological
Research 2:65-68.
2008
Asiatic Herpetological Research, Vol. 1 1
163
Cc Notes on the diet, survival rate, and burrow
specifics of Uromastyx aegyptius
Cao, Y. microlepis from the United Arab Emirates.
See M. Huang et al. (and Y. Cao) Asiatic Herpetological Research 9:30-33.
Castellano, S.
See T. Dujsebayeva et al. (and S. Castellano)
Cedhagen, T.
Anurans collected in West Malaysia. Asiatic
Herpetological Research 7:1-5.
Chanda, S. K.
See I. Das (and S. K. Chanda)
Chen, B.
The past and present situation of the Chinese
alligator. Asiatic Herpetological Research
3:129-136.
Preliminary research on the function of the
eggshell in the Chinese alligator {Alligator
sinensis). Asiatic Herpetological Research
4:132-136. (B. Chen and B. Liang)
Chen, Y.
Evaluation of snake venoms among
Agkistrodon species in China. Asiatic
Herpetological Research 4:58-61. (Y.
Chen, D. Zhang, K. Jiang and Z. Wang)
Chen, Y.-Y.
See P. Guo et al. (and Y.-Y. Chen)
Chikin, Y. A.
A catalogue of non-metrical variations in skull
bones of Vipera lebetina (Reptilia,
Viperidae). Asiatic Herpetological
Research 7:6-18.
Chou, W.-H.
On the status of Rhacophorus prasinatus Mou,
Risch and Lue (Anura: Rhacophoridae).
Asiatic Herpetological Research 5:11-13.
Ciochon, R. L.
See J. H. Hutchinson et al. (and R. L. Ciochon)
Conant, R.
The type locality of Agkistrodon halys cara-
ganus. Asiatic Herpetological Research
4:57.
Dd
Daniels, R. J. R.
The Ceylonese tree frog Polypedates cruciger
Blyth, a new record for India. Asiatic
Herpetological Research 6:36-37. (R. J. R.
Daniels and M. S. Ravichandran)
Darevsky, I. S.
Two new species of the worm-like lizard
Dibamus (Sauria, Dibamidae), with
remarks on the distribution and ecology of
Dibamus in Vietnam. Asiatic
Herpetological Research 4:1-12.
A new subspecies of the dwarf snake
Calamaria lowi ingermarxi ssp. nov.
(Serpentes, Colubridae) from Southern
Vietnam. Asiatic Herpetological Research
4:13-17. (I. S. Darevsky and N. L. Orlov)
A new gecko of the genus Gonydactylus
(Sauria: Gekkonidae) with a key to the
species of Vietnam. Asiatic Herpetological
Research 7:19-22. (I. S. Darevsky and N.
N. Szczerbak)
See also, K. Adler et al. (and I. S. Darevsky)
Das, I.
Intergradation between Melanochelys trijuga
trijuga and M. t. coronata (Testudines:
Emydidae: Bataguruinae). Asiatic
Herpetological Research 3:52-53. (I. Das
and P C. H. Pritchard)
Cyrtodactylus madarensis Sharma (1980), a
junior synonym of Eublepharis macular-
ius Blyth (1854). Asiatic Herpetological
Research 4:55-56.
Size-gradation in syntopic frogs in South India.
Asiatic Herpetological Research 6:38^14.
Rediscovery of Lipinia macrotympanum
(Stoliczka, 1873) from the Nicobar
Islands, India. Asiatic Herpetological
Research 7:23-26.
Anguis melanostictus Schneider, 1801, a valid
species of Barkudia (Sauria: Scincidae)
from Southwestern India. Asiatic
Herpetological Research 8:13-17.
The dates of publication of amphibian and rep-
tile names by Blanford and Stoliczka in the
Cunningham, P. L.
164
Asiatic Herpetological Research, Vol. 1 1
2008
Journal and Proceedings of the Asiatic
Society of Bengal. Asiatic Herpetological
Research 8:18-24.
A new locality for the rare Bornean skink,
Lamprolepis vyneri (Shelford, 1905)
(Sauria: Scincidae). Asiatic Herpetological
Research 10:241-244.
Leptobrachium smithi Matsui, Nabitabhata,
and Panha, 1999 (Anura: Megophryidae),
an addition to the fauna of Myanmar
(Burma). Asiatic Herpetological Research
10:245-246. (I. Das and S. K. Chanda)
See also, J. L. Grismer et al. (and I. Das)
Diaz, R. E.
A new species of Dibamus (Squamata:
Dibamidae) from West Malaysia. Asiatic
Herpetological Research 10:1-7. (R. E.
Diaz, T. M. Leong, L. L. Grismer and N. S.
Yaakob)
Diesmos, A. C.
Rediscovery of the Philippine forest turtle,
Heosemys leytensis (Chelonia,
Bataguridae), from Palawan Island,
Philippines. Asiatic Herpetological
Research 10:22-27. (A. C. Diesmos, G. V.
A. Gee, M. L. Diesmos, R. M. Brown, P. J.
Widman and J. C. Dimalibot)
Diesmos, M. L.
See A. C. Diesmos et al. (and M. L. Diesmos)
Dimalibot, J. C.
See A. C. Diemos et al. (and J. C. Dimalibot)
Diong, C. H.
Size and shape description of oviductal eggs of
Draco obscurus formosus (Squamata:
Agamidae). Asiatic Herpetological
Research 8:25-28. (C. H. Diong and S. Y.
T. Soon)
Dolmen, D.
Diel activity of Ranadon sibiricus (Amphibia:
Hynobiidae) in relationship to environ-
ment and threats. Asiatic Herpetological
Research 8:29-37. (D. Dolmen, R. A.
Kubykin and J. V. Amekleiv)
Dujsebayeva, T.
On the distribution of diploid and tetraploid
green toads of the Bufo viridis complex
(Anura; Bufonidae) in southern
Kazakhstan. Asiatic Herpetological
Research 7:27-31. (T. Dujsebayeva, S.
Castellano, C. Giacoma, E. Balletto and G.
Odiema)
See also, V. Kolbintzev et al. (and T.
Dujsebayeva)
Diilger, B.
Antimicrobial activity in the skin secretion of
Bufo viridis (Laurenti, 1768). Asiatic
Herpetological Research 10:161-163. (B.
Diilger, I. H. Ugurtas and M. Sevinq)
See also, M. Tosunoglu et al. (and B. Diilger)
Durmus, S. H.
See Y. Kumlutas et al. (and S. H. Durmus)
Diisen, S.
Analysis of the stomach contents of the Lycian
salamander Mertensiella luschani
(Steindachner, 1891) (Urodela:
Salamandridae), collected from Southwest
Turkey. Asiatic Herpetological Research
10:164—167. (S. Diisen, M. Oz and M. R.
Tunq)
Dutta, S. K.
See A. K. Mohanty et al. (and S. K. Dutta)
Ee
Ebrahim, M.
First description of egg sacs and early larval
development in hynobiid salamanders
(Urodela, Hynobiidae, Batrachuperus )
from north-eastern Iran. Asiatic
Herpetological Research 10:168-175. (M.
Ebrahim, H. G. Kami and M. Stock)
Ff
Fan, Z.
See H. Shi et al. (and Z. Fan)
Feldman, C. R.
Molecular systematics of Old World stripe-
necked turtles (Testudines: Mauremys).
Asiatic Herpetological Research 10:28—
37. (C. R. Feldman and J. F. Parham)
Ferner, J. W.
The amphibians and reptiles of Panay Island,
Philippines. Asiatic Herpetological
Research 9:34-70. (J. W. Ferner, R. M.
2008
Asiatic Herpetological Research, Vol. 1 1
165
Brown, R. V. Sison and R. S. Kennedy)
See also, R. M. Brown et al. (and J. W. Femer)
Fritz, U.
See M. Schilde et al. (and U. Fritz)
Frynta, D.
See M. Stock et al. (and D. Frynta)
Fu, J.
The validity of Sacalia quadriocellata. Asiatic
Flerpetological Research 3:120-122. (J. Fu
and E. Zhao)
Phylogeny of genus Scutiger (Amphibia:
Megophryidae): a re-evaluation. Asiatic
Herpetological Research 7:32-37. (J. Fu,
A. Lathrop and R. W. Murphy)
Phylogeny of Chinese Oreolalax and the use of
functional outgroups to select among mul-
tiple equally parsimonious trees. Asiatic
Herpetological Research 7:38^43. (J. Fu
and R. W. Murphy)
See also, M. Song et al. (and J. Fu)
Fu, S.-Y.
See X. Ji et al. (and S.-Y. Fu)
Gg
Ganieva, A. N.
See E. V. Vashetko et al. (and A. N. Ganieva)
Gao, Z.
See Y. Yang et al. (and Z. Gao)
Gaulke, M.
Observations on arboreality in a Philippine
blind snake. Asiatic Herpetological
Research 6:45-48.
On the distribution of emydid turtles and the
anuran genus Microhyla in the Philippines.
Asiatic Herpetological Research 6:49-52.
Gee, G. V. A.
See A. C. Diesmos et al. (and G. V. A. Gee)
Giacoma, C.
See T. Dujsebayeva et al. (and C. Giacoma)
Goldberg, S. R.
Helminths of Tago's brown frog, Rana tagoi
(Ranidae), from Japan. Asiatic
Herpetological Research 7:44-47. (S. R.
Goldberg, C. R. Bursey and Q. A. Truong)
Golubev, M. L.
The variegated toad agama in Djungar Gate
(Eastern Kazakstan) with notes on certain
systematic problems of Phrynocephalus
versicolor Str. (Reptilia: Agamidae).
Asiatic Herpetological Research 5:51-58.
See also, V. V. Manilo (and M. L. Golubev)
S. Mezhzherin (and M. L. Golubev)
Greene, H. W.
Defensive behavior and feeding biology of the
Asian mock viper, Psammodynastes pul-
verulentus (Colubridae), a specialized
predator on scincid lizards. Asiatic
Herpetological Research 2:21-32.
Griffin, P. C.
Ecology and conservation of Onychodactylus
fischeri (Caudata, Hynobiidae) in the
Russian Far East. Asiatic Herpetological
Research 6:53-61. (P. C. Griffin and V. A.
Solkin)
Grismer, J. L.
Species diversity and checklist of the herpeto-
fauna of Pulau Tioman, Peninsular
Malaysia, with a preliminary overview of
habitat utilization. Asiatic Herpetological
Research 10:247-279. (J. L. Grismer, L. L.
Grismer, I. Das, N. S. Yaakob, B. L. Lim,
T. M. Leong, T. Youmans and H. Kaiser)
See also, L. L. Grismer et al. (and J. L.
Grismer)
Grismer, L. L.
A new species of Leptolalax (Anura:
Megophryidae) from Pulau Tioman, West
Malaysia. Asiatic Herpetological Research
10:8-1 1. (L. L. Grismer, J. L. Grismer and
T. Youmans)
See also, R. E. Diaz et al. (and L. L. Grismer)
J. L. Grismer et. al. (and L. L. Grismer)
T. M. Leong (and L. L. Grismer)
Grosse, W.-R.
See M. Stock et al. (and W.-R. Grosse)
Gu, H.
Electrocardiogram research on the Chinese alli-
gator {Alligator sinensis). Asiatic
Herpetological Research 4:137-140. (H.
Gu, R. Ruan and Z. Zhang)
166
Asiatic Herpetological Research, Vol. 1 1
2008
Gunther, R.
See A. M. Bauer (and R. Gunther)
Asiatic Herpetological Research 4:62 67.
(M. Huang, Y. Cao, F. Zhu and Y. Qu)
Guo, P.
The hemipenes of Chinese species of
Deinagkistrodon and Gloydius (Serpentes:
Crotalinae). Asiatic Herpetological
Research 8:38—42. (P. Guo, F.-J. Zhang
and Y.-Y. Chen)
Catalogue of type specimens of reptiles in the
herpetological collections of Chengdu
Institute of Biology, The Chinese
Academy of Sciences. Asiatic
Herpetological Research 8:43-47. (P. Guo,
F.-J. Zhang and Y.-Y. Chen)
Pareas stanleyi- A record new to Sichuan,
China and a key to the Chinese species.
Asiatic Herpetological Research 10:280-
281. (P. Guo and E. Zhao)
Hh
Han, B.
See K. Autumn (and B. Han)
Heatwole, H.
See B. L. Stuart (and H. Heatwole)
Herrmann, H.-J.
Investigations on ranid larvae in southern
Sakhalin Island, Russia. Asiatic
Herpetological Research 4:68-75. (H.-J.
Herrmann and K. Kabisch)
Hoang, T.
See M. Le et al. (and T. Hoang)
Hoggren, M.
See G. Nilson et al. (and M. Hoggren)
Holroyd, P. A.
See J. H. Hutchinson et al. (and P A. Holroyd)
Hua, J.
See Y. Tang et al. (and J. Hua)
Huang, J.
See R. Wu (and J. Huang)
Huang, M.
Female reproductive cycle and embryonic
development of the Chinese mamushi
(Agkistrodon blomhoffii brevicaudus).
Hung, D. O.
See S. Zbigniew (and Hung, D. O)
Hutchinson, J. H.
A preliminary report on Southeast Asia's oldest
Cenozoic turtle fauna from the late middle
Eocene Pondaung Formation, Myanmar.
Asiatic Herpetological Research 10:38—
52. (J. H. Hutchinson, P A. Holroyd and R.
L. Ciochon)
li
Inger, R. F.
A new species of Leptolalax (Anura:
Megophryidae) from Borneo. Asiatic
Herpetological Research 7:48-50. (R. F.
Inger, M. Lakim, A. Biun and P Yambun)
Ismail, A.
See I. H. Jaafar et al. (and A. Ismail)
Jj
Jaafar, I. H.
Correlations of reproductive parameters of two
tropical frogs from Malaysia. Asiatic
Herpetological Research 8:48-52. (I. H.
Jaafar, A. Ismail and A.-R. Kurais)
Jarrar, B. M.
Histochemical characterization of the lingual
salivary glands of the house gecko,
Ptyodactylus hasselquistii (Squamata:
Gekkonidae). Asiatic Herpetological
Research 10:176-181. (B. M. Jarrar and N.
T. Taib)
Ji, Xiang
Utilization of energy and material in eggs and
post-hatching yolk in an oviparous snake,
Elaphe taeniura. Asiatic Herpetological
Research 8:53-59. (X. Ji, P.-Y. Sun, S.-Y.
Fu and H.-S. Zhang)
See also, P-C. Wang (and X. Ji)
Ji, Xinquan
See Y. Tang et al. (and X. Ji)
2008
Asiatic Herpetological Research, Vol. 1 1
167
Jiang, K.
See Y. Chen et al. (and K. Jiang)
Joyce, W. G.
A review of the comparative morphology of
extant testudinoid turtles (Reptilia:
Testudines). Asiatic Herpetological
Research 10:53-109. (W. G. Joyce and C.
J. Bell)
Kk
Kabisch, K.
See H.-J. Herrmann (and K. Kabisch)
Kaiser, H.
See J. L. Grismer et al. (and H. Kaiser)
Kalkan, M.
See I. H. Ugurtas et al. (and M. Kalkan)
Kami, H. G.
The biology of the Persian mountain salaman-
der, Batrachuperus persicus (Amphibia,
Caudata, Hynobiidae) in Golestan
Province, Iran. Asiatic Herpetological
Research 10:182-190.
See also, M. Ebrahim et al. (and H. G. Kami)
Kaska, Y.
See Y. Kumlutas et al. (and Y. Kaska)
Kennedy, R. S.
See J. W. Femer et al. (and R. S. Kennedy)
Khan, M. R. Z.
See M. S. Khan (and M. R. Z. Khan)
ecology of Microhyla ornata tadpoles.
Asiatic Herpetological Research 9:13 0—
138.
Obituary: Sherman Anthony Minton, Jr. Asiatic
Herpetological Research 9:154-155.
Annotated checklist of amphibians and reptiles
of Pakistan. Asiatic Herpetological
Research 10:191-201.
Kolbintzev, V.
Distribution and natural history of the lidless
skinks, Asymblepharus alaicus and
Ablepharus deserti (Sauria: Scincidae) in
the Aksu-Djabagly Nature Reserve
(Western Tian-Shan Mountains),
Kazakstan. Asiatic Herpetological
Research 8:69-74. (V. Kolbintzev, L.
Miroschnichenko and T. Dujsebayeva)
Krysko, K. L.
See K. Auffenberg et al. (and K. L. Krysko)
Kubykin, R. A.
See D. Dolmen et al. (and R. A. Kubykin)
Kudryavtsev, S.
See S. Mamet (and S. Kudryavtsev)
Kumlutas, Y.
A morphological and taxonomic study on
Lacerta pai~va Boulenger, 1887 (Sauria:
Lacertidae) from West Taurus, Turkey.
Asiatic Herpetological Research 10:202-
207. (Y. Kumlutas, S. H. Durmus, Y.
Kaska, M. Oz and M. R. Tun?)
Kurais, A.-R.
See I. H. Jaafar et al. (and A.-R. Kurais)
Khan, M. S.
Taxonomic notes on Pakistani snakes of the
Coluber karelini - rhodorachis - ventro-
maculatus species complex: a new
approach to the problem. Asiatic
Herpetological Research 7:51-60.
A new skink from the Thai Desert of Pakistan.
Asiatic Herpetological Research 7:61-67.
(M. S. Khan and M. R. Z. Khan)
Redescription and generic redesignation of the
Ladakhian gecko Gymnodactylus
stoliczkai Steindachner, 1969 [1867],
Asiatic Herpetological Research 8:60-68.
(M. S. Khan and H. Rosier)
Buccopharyngeal morphology and feeding
Kuzmin, S. L.
Feeding ecology of the Caucasian salamander
(Mertensiellla caucasica ), with comments
on life history. Asiatic Herpetological
Research 4:123-131.
LI
Lakim, M.
See R. F. Inger et al. (and M. Fakim)
Lathrop, A.
Taxonomic review of the megophryid frogs
(Anura: Pelobatoidea). Asiatic
168
Asiatic Herpetological Research, Vol. 1 1
2008
Herpetological Research 7:68-79.
See also, J. Fu et al. (and A. Lathrop)
T. L. Trepanier et al. (and A. Lathrop)
Lau, M.
See J. Lazell et al. (and M. Lau)
Lazell, J.
Four remarkable reptiles from South China Sea
Islands, Hong Kong Territory. Asiatic
Herpetological Research 3:64-66. (J.
Lazell and W. Lu)
A brief herpetological excursion to Wai Ling
Ding, Wanshan Islands, South China Sea.
Asiatic Herpetological Research 7:80-84.
(J. Lazell, M. Lau and W. Lu)
Le, D.
See M. Le et al. (and D. Le)
Le, M.
Trade data and some comments on the distribu-
tion of Mauremys annamensis
(Siebenrock, 1903). Asiatic Herpetological
Research 10:110-113. (M. Le, T. Hoang
and D. Le)
Lee, W.-H.
See Y. Zhang et al. (and W.-H. Lee)
Leong, T. M.
A new species of Kukri snake, Oligodon
(Colubridae), from Pulau Tioman, West
Malaysia. Asiatic Herpetological Research
10:12-16. (T. M. Leong and L. L.
Grismer)
See also, R. E. Diaz et al. (and T. M. Leong)
J. L. Grismer et al. (and T. M. Leong)
Leviton, A. E.
See R. M. Brown et al. (and A. E. Leviton)
Li, Dejon
See G. Wei et al. (and D. Li)
Li, Dong
See J. F. Parham (and D. Li)
Li, W.-J.
The reproductive biology of Rana boulengeri.
Asiatic Herpetological Research 9:1-5.
Liang, B.
See B. Chen (and B. Liang)
Liang, D.
See J. Pan (and D. Liang)
Lim, B. L.
See J. L. Grismer et al. (and B. L. Lim)
Lin, J.
Studies on the distribution of trace elements in
Agkistrodon blomhoffii brevicaudus
Stejneger. Asiatic Herpetological Research
6:62-68. (J. Lin, K.-M. Xu and D.-G. Liu)
Litvinchuk, S. N.
Intraspecific and interspecific genome size
variation in hynobiid salamanders of
Russia and Kazakhstan: determination by
flow cytometry. Asiatic Herpetological
Research 10:282-294. (S. N. Litvinchuk,
L. J. Borkin and J. M. Rosanov)
Liu, D.-G.
See J. Lin et al. (and D.-G. Liu)
Liu, W.-Z.
A karyosystematic study of the genus Bombina
from China (Amphibia: Discoglossidae).
Asiatic Herpetological Research 5:137-
142. (W.-Z. Liu and D.-T. Yang)
Liu, Z.
See M. Song et al. (and Z. Liu)
Losos, J. B.
Thermal sensitivity of sprinting and clinging
performance in the Tokay gecko ( Gekko
gecko). Asiatic Herpetological Research
3:54-59.
Lu, B.
See P.-C. Wang et al. (and B. Lu)
Lu, L.
See J.-P. Mao et al. (and L. Lu)
Lu, S.-Q.
A study on morphological similarity between
the genera Nanorana and Altirana
(Amphibia, Anura, Ranidae). Asiatic
Herpetological Research 6:69-72. (S.-Q.
Lu and D.-T. Yang)
A study of relationships among ranid frogs of
the genera Nanorana and Altirana in the
Transhimalaya Mountains of China.
Asiatic Herpetological Research 6:73-77.
(S.-Q. Lu and D.-T. Yang)
2008
Asiatic Herpetological Research, Vol. 1 1
169
Lu, W.
See J. Lazell (and W. Lu)
J. Lazell et al. (and W. Lu)
Mm
Ma, W.
See P.-C. Wang et al. (and W. Ma)
Macey, J. R.
The snakes ol Ningxia Hui Autonomus Region
as an indication of a herpetofaunal corri-
dor. Asiatic Herpetological Research 2:4—
5. (J. R. Macey, T. J. Papenfuss and E.
Zhao)
Genetic variation among agamid lizards of the
Trapelus agilis complex in the Caspian-
Aral Basin. Asiatic Herpetological
Research 10:208-214. (J. R. Macey and N.
B. Ananjeva)
See also, Ananjeva, N. B. et al. (and J. R.
Macey)
E. Zhao et al. (and J. R. Macey)
Mamet, S.
Captive propagation of the Mandarin rat snake
(. Elaphe mandarina ) at Moscow Zoo.
Asiatic Herpetological Research 7:85-86.
(S. Mamet and S. Kudryavtsev)
Manilo, V. V.
Karyotype information on some toad agamas of
the Phrynocephalus guttatus species group
(Sauria, Agamidae) of the former USSR.
Asiatic Herpetological Research 5:105-
108. (V. V. Manilo and M. L. Golubev)
A karyosystematic study of the plate tailed
geckos of the genus Teratoscincus (Sauria,
Gekkonidae). Asiatic Herpetological
Research 5:109-111.
Mao, J.-P.
Fibrinoginase from the venom of Trimeresurus
mucrosquamatus . Asiatic Herpetological
Research 6:78-84. (J.-P. Mao, W.-Y.
Wang, Y.-L. Xiong and L. Lu)
Mao, W.-P.
Seasonal variations of testicular and epididy-
mal structure and plasma levels of testos-
terone in the soft-shelled turtle ( Pelodiscus
sinensis ). Asiatic Herpetological Research
8:75-80. (W.-P. Mao and Z.-X. Wang)
Mezhzherin, S.
Allozyme variation and genetic relationships
within the Phrynocephalus guttatus
species group (Sauria: Agamidae) in the
former USSR. Asiatic Herpetological
Research 5:59-64. (S. Mezhzherin and M.
L. Golubev)
Michihisa, T.
Karyotypes of some species of the genus
Mitchell, J. C.
See G. R. Zug, (and J. C. Mitchell)
Mohanty, A. K.
Population dynamics and growth in a natural
population of Limnonectes limnocharis
(Anura: Ranidae). Asiatic Herpetological
Research 7:87-92. (A. K. Mohanty, N.
Singh and S. K. Dutta)
Mu, Y.
Mating call structures of the Chinese frog,
Rana nigromaculata (Amphibia, Anura,
Ranidae). Asiatic Herpetological Research
3:60-63. (Y. Mu and E. Zhao)
Murphy, R. W.
See J. Fu (and R. W. Murphy)
J. Fu et al. (and R. W. Murphy)
T. L. Trepanier et al. (and R. W. Murphy)
Nn
Nilson, G.
Systematics of the vipers of the Caucasus:
polymorphism or sibling species? Asiatic
Herpetological Research 6:1-26. (G.
Nilson, B. S. Tuniyev, N. Orlov, M.
Hoggren and C. Andren)
Niu, C.
Food consumption and growth of juvenile
Chinese soft-shelled turtles (. Pelodiscus
sinensis ) in relation to body weight and
water temperature. Asiatic Herpetological
Research 8:81-84. (C. Niu, T. Zhang and
R. Sun)
170
Asiatic Herpetological Research, Vol. 1 1
2008
Nuridzhanov, A. S.
See E. V. Vashetko et al. (and A. S.
Nuridzhanov)
Oo
Odierna, G.
See T. Dujsebayeva et al. (and G. Odierna)
Ohler, A.
Digital pad morphology in torrent-living ranid
frogs. Asiatic Herpetological Research
6:85-96.
Okada, S.
See Y. L. Werner et al. (and S. Okada)
Orlov, N. L.
Three species in the Vipera kaznakowi complex
(Eurosiberian group) in the Caucasus: their
present distribution, possible genesis, and
phylogeny. Asiatic Herpetological
Research 3:1-36. (N. L. Orlov and B. S.
Tuniyev)
A new species of grass snake, Natrix megalo-
cephala, from the Caucasus (Ophidia:
Colubridae). Asiatic Herpetological
Research 4:42-54. (N. L. Orlov and B. S.
Tuniyev)
See also, I. S. Darevsky (and N. L. Orlov)
G. Nilson et al. (and N. Orlov)
Orlova, V. F.
Intrapopulational and geographic variation of
Eremias przewalskii Strauch in Mongolia.
Asiatic Herpetological Research 4:11 3—
122.
Ota, H.
See Y. L. Werner et al. (and H. Ota)
Oz, M.
See S. Diisen et al. (and M. Oz)
Y. Kumlutas et al. (and M. Oz)
pP
Pan, J.
Studies of the early embryonic development of
Rana rugulosa Wiegmann. Asiatic
Herpetological Research 3:85-100. (J. Pan
and D. Liang)
Panov, E. N.
Social organization and demography in the
rock agama, Stellio caucasius. Asiatic
Herpetological Research 6:97-110. (E. N.
Panov and L. Y. Zykova)
Papenfuss, T. J.
The history of the Journal Asiatic
Herpetological Research. Asiatic
Herpetological Research 10:306-307.
See also, Ananjeva, N. B. et al. (and T. J.
Papenfuss)
J. R. Macey et al. (and T. J. Papenfuss)
E. Zhao et al. (and T. J. Papenfuss)
Parham, J. F.
A new locality for Cuora pani Song 1984 with
comments on its known range. Asiatic
Herpetological Research 8:111-113. (J. F.
Parham and D. Li)
The discovery of Mauremys iversoni- like tur-
tles at a turtle farm in Hainan Province,
China: the counterfeit golden coin. Asiatic
Herpetological Research 9:71-76. (J. F.
Parham and H. Shi)
See also, C. R. Feldman (and J. F. Parham)
Parvin, S.
See M. F. Ahsan (and S. Parvin)
Pawar, S. S.
First record of the smooth-backed parachute
gecko Ptychozoon lionotum Annandale
1905 from the Indian mainland. Asiatic
Herpetological Research 9:101-106. (S. S.
Pawar and S. Biswas)
Perala, J.
Neotype of Testudo terrestris Forsskal, 1775
(Testudines, Testudinidae). Asiatic
Herpetological Research 10:114-119. (J.
Perala and R. Bour)
Perry, G.
See Y. L. Werner et al. (and G. Perry)
Peters, G.
See Ananjeva, N. B. et al. (and G. Peters)
Platt, S. G.
See B. L. Stuart (and S. G. Platt)
Prakash, S.
See R. Batra (and S. Prakash)
2008
Asiatic Herpetological Research, Vol. 1 1
171
Pritchard, P. C. H.
See I. Das (and P. C. H. Pritchard)
Pu, X.
See J. Song et al. (and X. Pu)
Qq
Qing, J.
A study on the comparative cytology of some
endocrine glands in Rana plancyi between
hibernation and post-hibernation. Asiatic
Herpetological Research 6:111-113.
Qu,Y.
See M. Huang et al. (and Y. Qu)
Rr
Rao, D.-Q.
The karyotypes of Megophryinae (Pelobatidae)
with a discussion on their classification
and phylogenetic relationships. Asiatic
Herpetological Research 7:93-102. (D.-Q.
Rao and D.-T. Yang)
The variation in karyotypes of
Br achy tar sophtys from China with a dis-
cussion of the classification of the genus.
Asiatic Herpetological Research 7:103-
107. (D.-Q. Rao and D.-T. Yang)
Rashid. S. M. A.
Interim report on the freshwater turtle trade in
Bangladesh. Asiatic Herpetological
Research 3: 123-128. (S. M. A. Rashid and
I. R. Swingwald)
Rastegar-Pouyani, E.
See N. Rastegar-Pouyani (and E. Rastegar-
Pouyani)
Rastegar-Pouyani, N.
First record of the lacertid Acanthodactylus
boskianus (Sauria: Lacertidae) for Iran.
Asiatic Herpetological Research 8:85-89.
Two new subspecies of Trapelus agilis com-
plex (Sauria: Agamidae) from lowland
southwestern Iran and southeastern
Pakistan. Asiatic Herpetological Research
8:90-101.
A new species of Eremias (Sauria: Lacertidae)
from highlands of Kermanshah Province,
western Iran. Asiatic Herpetological
Research 9:107-112. (N. Rastegar-
Pouyani and E. Rastegar-Pouyani)
Ravichandran, M. S.
See R. J. R. Daniels (and M. S. Ravichandran)
Rehman, H.
See W. Auffenberg (and H. Rehman)
Rocek, Z.
Holocene anurans from Caucasus. Asiatic
Herpetological Research 5:31-44.
Rogovin, K. A.
Lizards of the northern Mongolian deserts:
densities and community structure. Asiatic
Herpetological Research 9:113-121. (K.
A. Rogovin, D. V. Semenov and G. I.
Shenbrot)
Rosanov, J. M.
See S. N. Litvinchuk et al. (and J. M. Rosanov)
Rosier, H.
See M. S. Khan (and H. Rosier)
Ruan, R.
See H. Gu et al. (and R. Ruan)
Russell, A. P.
See A. M. Bauer (and A. P. Russell)
Rustamov, E. A.
See S. Schammakov et al. (and E. A.
Rustamov)
Ss
Schaedla, W. H.
Anomalous (?) nocturnal feeding by the
agamid lizard Calotes emma in northeast-
ern Thailand. Asiatic Herpetological
Research 10:295-297.
Schammakov, S.
Herpetogeographical map of Turkmenistan.
Asiatic Herpetological Research 5:127-
136. (S. Schammakov, C. Ataev and E. A.
Rustamov)
Schilde, M.
An Ocadia sinensis x Cyclemys shanensis
172
Asiatic Herpetological Research, Vol. 1 1
2008
hybrid (Testudines: Geoemydidae). Asiatic
Herpetological Research 10:120-125. (M.
Schilde, D. Barth and U. Fritz)
Schmid, M.
See M. Stock et al. (and M. Schmid)
Semenov, D. V.
On the ecology of Przewalsky’s gecko
{Teratoscincus przewalskii ) in the
Transaltai Gobi, Mongolia. Asiatic
Herpetological Research 4:99-112. (D. V.
Semenov and L. J. Borkin)
See also, K. A. Rogovin et al. (and D. V.
Semenov)
Serbinova, I. A.
Reproductive behavior in the long-tailed sala-
mander ( Onychodactylus fischeri
Boulenger). Asiatic Herpetological
Research 6:114-119. (I. A. Serbinova and
V. A. Solkin)
See also, D. N. Tarkhnishvili (and I. A.
Serbinova)
Sevin?, M.
The morphology and size of blood cells of
Lacerta rudis bithynica. Asiatic
Herpetological Research 9:122-129. (M.
Sevin? and I. H. Ugurtas)
Morphological observations on the erythrocyte
and erythrocyte size of some gecko species
of Turkey. Asiatic Herpetological Research
10:217-223. (M. Sevinp, I. H. Ugurtas and
H. S. Yildirimham)
See also, B. Diilger et al. (and M. Sevin?)
Shammakov, S. M.
See B. S. Tuniyev (and S. M. Shammakov)
B. S. Tuniyev et al. (and S. M. Shammakov)
Sharif], M.
Distribution and conservation status of
Neurergus microspilotus (Caudata:
Salamandridae) in western Iran. Asiatic
Herpetological Research 10:224-229. (M.
Sharifi and S. Assadian)
Shenbrot, G. I.
See K. A. Rogovin et al. (and G. I. Shenbrot)
Shi, H.
New data on the trade and captive breeding of
turtles in Guangxi Province, South China.
Asiatic Herpetological Research 10:126-
128. (H. Shi, Z. Fan, F. Yin and Z. Yuan)
See also, J. F. Parham (and H. Shi)
Simin, L.
See D. Yang (and L. Simin)
Singh, N.
See A. K. Mohanty et al. (and N. Singh)
Sison, R. V.
See R. M. Brown et al. (and R. V. Sison)
J. W. Femer et al. (and R. V. Sison)
Smith, B. E.
Notes on a collection of squamate reptiles from
eastern Mindanao, Philippine Islands Part
1: Lacertilia. Asiatic Herpetological
Research 5:85-95.
Notes on a collection of squamate reptiles from
eastern Mindanao, Philippine Islands Part
2: Serpentes. Asiatic Herpetological
Research 5:96-102.
Solkin, V. A.
See P. C. Griffin (and V. A. Solkin)
I. A. Serbinova (and V. A. Solkin)
Song, J.
A study on the purification and pharmacologi-
cal properties of two neurotoxins from the
venom of the king cobra ( Ophiophagus
hannah). Asiatic Herpetological Research
5:143-146. (J. Song, Y.-L. Xiong, W.
Wang and X. Pu)
Song, M.
A new species of Batrachuperus from north-
western China. Asiatic Herpetological
Research 9:6-8. (M. Song, X. Zeng, G.-F.
Wu, Z. Liu and J. Fu)
Translation: A new species of the turtle genus
Cuora (Testudoformes: Testudinidae).
Asiatic Herpetological Research 9:142-
144.
Song, X.
See G. Wei et al. (and X. Song)
Soon, S. Y. T.
See C. H. Diong (and S. Y. T. Soon)
Steinlein, C.
See M. Stock et al. (and C. Steinlein)
2008
Asiatic Herpetological Research, Vol. 11
173
Stock, M.
A review ol the distribution of diploid, triploid
and tetraploid green toads ( Bufo viridis
complex) in Asia including new data from
Iran and Pakistan. Asiatic Herpetological
Research 9:77-100. (M. Stock, D. Frynta,
W.-R. Grosse, C. Steinlein and M. Schmid)
See also, M. Ebrahim et al. (and M. Stock)
Stuart, B. L.
A new Philautus (Amphibia: Rhacophoridae)
from northern Laos. Asiatic Herpetological
Research 10:17-21. (B. L. Stuart and H.
Heatwole)
Recent records of turtles and tortoises from
Laos, Cambodia, and Vietnam. Asiatic
Herpetological Research 10:129-150. (B.
L. Stuart and S. G. Platt)
Sun, P.-Y.
See X. Ji et al. (and P.-Y. Sun)
Sun, R.
See C. Niu et al. (and R. Sun)
Swingland, I. R.
See S. M. A. Rashid (and I. R. Swingland)
Szczerbak, N. N.
See I. S. Darevsky (and N. N. Szczerbak)
Tt
Taib, N. T.
See B. M. Jarrar (and N. T. Taib)
Tan, A.
A rare case of karyotype in Anura - a prelimi-
nary study on the karyotype of Philautus
doriae (Boulenger) with different diploid
numbers of 26 and 16. Chinese
Herpetological Research 1:12-16.
The karyotype of the treefrog Rhacophorus
reinwardtii (Boie), from Xishuangbanna
Daizu Autonomous Prefecture, Yunnan
Province, China. Asiatic Herpetological
Research 2:33-36. (A. Tan, G.-F. Wu and
E. Zhao)
See also, E. Zhao et al. (and A. Tan)
Tang, Y.
Isolation and amino acid sequence of a new
dodecapeptide from the skin of Oreolalax
pingii. Asiatic Herpetological Research
3:116-119. (Y. Tang, S. Tian, S. Wu, J.
Hua, X. Ji, G.-F. Wu, E. Zhao and G. Zou)
Tarkhnishvili, D. N.
The ecology of the Caucasian salamander
(Mertensiella caucasica Waga) in a local
population. Asiatic Herpetological
Research 5:147-165. (D. N. Tarkhnishvili
and I. A. Serbinova)
On the inheritance of the mid-dorsal stripe in
the Iranian wood frog (Rana macrocne-
mis ). Asiatic Herpetological Research
6:120-131.
Tian, S.
See Y. Tang et al. (and S. Tian)
Tok, C. V.
See M. Tosunoglu et al. (and C. V. Tok)
Tokunaga, S.
See Y. L. Werner et al. (and S. Tokunaga)
Tosunoglu, M.
An investigation on the blood cells of the leop-
ard gecko, Eublepharis angramainyu
(Reptilia: Sauria: Eublepharidae). Asiatic
Herpetological Research 10:230-234. (M.
Tosunoglu, D. Ayaz, C. V. Tok and B.
Diilger)
Trepanier, T. L.
Rhacophorus leucomystax in Vietnam with
acoustic analysis of courtship and territori-
al calls. Asiatic Herpetological Research
8:102-106. (T. L. Trepanier, A. Lathrop
and R. W. Murphy)
Truong, Q. A.
See S. R. Goldberg et al. (and Q. A. Truong)
Tsellarius, A. Y.
Behavior of Varanus griseus during encounters
with conspecifics. Asiatic Herpetological
Research 7:108-130. (A. Y. Tsellarius and
E. Y. Tsellarius)
Tsellarius, E. Y.
See A. Y. Tsellarius (and E. Y. Tsellarius)
Tun?, M. R.
See S. Diisen et al. (and M. R. Tun?)
Y. Kumlutas et al. (and M. R. Tun?)
174
Asiatic Herpetological Research, Vol. 1 1
2008
Tuniyev, B. S.
On the independence of the Colchis Center of
amphibian and reptile speciation. Asiatic
Herpetological Research 3:67-84.
Coluber atayevi sp. nov. (Ophidia, Colubridae)
from the Kopet-Dag Mountains of
Turkmenistan. Asiatic Herpetological
Research 5:1-10. (B. S. Tuniyev and S. M.
Shammakov)
Sympatric amphibians of the Yew-box Grove,
Caucasian State Biosphere Reserve, Sochi,
Russia. Asiatic Herpetological Research
5:74-84. (B. S. Tuniyev and S. Y.
Beregovaya)
On the distribution of Coluber ravergieri and
Coluber nummifer in Turkmenistan and
the possible evolutionary reasons for their
polymorphism. Asiatic Herpetological
Research 7:131-136. (B. S. Tuniyev, C. A.
Atayev and S. M. Shammakov)
See also, Ananjeva, N. B. (and B. S. Tuniyev)
G. Nilson et al. (and B. S. Tuniyev)
N. L. Orlov (and B. S. Tuniyev)
Tyildirimhan, H. S.
See I. H. Ugurtas et al. (and S. Tyildirimhan)
Uu
Ugurtas, I. H.
Variation in Pelobates syriacus of Turkey.
Asiatic Herpetological Research 9:139-
141.
The feeding biology of Rana macrocnemis
Boulenger, 1885 (Anura: Ranidae),
Collected in Uludag, Bursa, Turkey.
Asiatic Herpetological Research 10:215-
216. (I. H. Ugurtas, H. S. Tyildirimhan and
M. Kalkan)
See also, B. Diilger et al. (and I. H. Ugurtas)
M. Seving (and I. H. Ugurtas)
M. Seving et al. (and I. H. Ugurtas)
Vv
Vashetko, E V.
Anomalies of gonads in Bufo viridis from
Uzbekistan. Asiatic Herpetological
Research 7:137-138. (E. V. Vashetko, A.
N. Ganieva and A. S. Nuridzhanov)
Ww
Wallach, V.
A new genus for the Ramphotyphlops subocu-
laris species group (Serpentes:
Typhlopidae), with description of a new
species. Asiatic Herpetological Research
6:132-150.
Wang. H.
See Y. Wang (and H. Wang)
Wang, P.-C.
Resting metabolic rate in three age-groups of
Alligator sinensis. Asiatic Herpetological
Research 5:112-116. (P.-C. Wang and J.-
H. Zhang)
A comparison of embryonic metabolic rates in
two lizards. Asiatic Herpetological
Research 7:147-152. (P.-C. Wang and X.
Ji)
Egg components and utilization during incuba-
tion in the turtle, Chinemys reevesii.
Asiatic Herpetological Research 7:13 9—
146. (P.-C. Wang, W. Ma, B. Lu and W.-H.
You)
Studies on the physiological ecology of incuba-
tion in Chinemys reevesii eggs. Asiatic
Herpetological Research 6:151-156. (P.-C.
Wang, W. Ma, B. Lu and W.-H. You)
Wang, W.-Y.
See J.-P. Mao et al. (and W.-Y. Wang)
J. Song et al. (and W.-Y. Wang)
Y. Zhang et al. (W.-Y. Wang)
Wang, Y.-Z.
See K. Autumn (and Y. -Z. Wang)
Wang, Y.
Geographic variation and diversity in three
species of Phrynocephalus in the Tengger
Desert, Western China. Asiatic
Herpetological Research 5:65-73. (Y.
Wang and H. Wang)
Wang, Z.
See Y. Chen et al. (and Z. Wang)
Wang, Z.-X.
See W.-P. Mao (and Z.-X. Wang)
Wei, G.
Karyotypes of two Rana from Xinjiang, China.
Asiatic Herpetological Research 4:141-
145. (G. Wei, N. Xu, D. Li and M. Wu)
2008
Asiatic Herpetological Research, Vol. 11
175
Karyotype C-band and Ag-Nors study of three
stink frogs. Asiatic Herpetological
Research 5:45-50. (G. Wei, N. Xu, D. Li,
G.-F. Wu and X. Song)
Weissinger, H.
Translation: Testudo graeca anamurensis ssp.
nov. from Asia Minor. Asiatic
Herpetological Research 9:145-148.
Wen, Y.
A new species of the genus Paramesotriton
(Amphibia: Caudata) from Guangxi and a
comparison with P. guangxiensis. Asiatic
Herpetological Research 2:15-20.
A new species of the genus Tropidophorus
(Reptilia: Lacertilia) from Guangxi
Zhuang Autonomus Region, China. Asiatic
Herpetological Research 4:18-22.
Werner, Y. L.
Varied and fluctuating foraging modes in noc-
turnal lizards of the family Gekkonidae.
Asiatic Herpetological Research 7:153-
165. (Y. L. Werner, S. Okada, H. Ota, G.
Perry and S. Tokunaga)
Widmann, P. J.
See A. C. Diesmos et al. (and P. J. Widmann)
Wu, G.-F.
See M. Song et al. (and G.-F. Wu)
A. Tan et al. (and G.-F. Wu)
Y. Tang et al. (and G.-F. Wu)
G. Wei et al. (and G.-F. Wu)
E. Zhao et al. (and G.-F. Wu)
X.-M. Zheng (and G.-F. Wu)
Wu, M.
See G. Wei et al. (and M. Wu)
Wu, R.
Relationships between serum T4, T3, cortisol
and the metabolism of chemical energy
sources in the cobra during pre-hiberna-
tion, hibernation and post-hibernation.
Asiatic Herpetological Research 3:46-51.
(R. Wu and J. Huang)
Wu, S.
See Y. Tang et al. (and S. Wu)
Xx
Xiong, Y.-L.
See J.-P. Mao et al. (and Y.-L. Xiong)
J. Song et al. (and Y.-L. Xiong)
Y. Zhang et al. (and Y.-L. Xiong)
Xu, K.-M.
See J. Lin et al. (and K.-M. Xii)
Xu, N.
See G. Wei et al. (and N. Xu)
Yy
Yaakob, N. S.
See R. E. Diaz et al. (and N. S. Yaakob)
J. L. Grismer et al. (and N. S. Yaakob)
Yambun, P.
See R. F. Inger et al. (and P. Yambun)
Yang, D.-T.
A new species of Varanus from Yunnan, with
morphological comparison between it and
six other species from Southeast Asia.
Chinese Herpetological Research 1:60-63.
(D.-T. Yang and L. Simin)
See also, W.-Z. Liu (and D.-T. Yang)
S.-Q. Lu (and D.-T. Yang)
D.-Q. Rao (and D.-T. Yang)
Yang, Y.
Karyotypic analyses of four species in four
genera of colubrid snakes. Asiatic
Herpetological Research 2:46-54. (Y.
Yang, F. Zhang and E. Zhao)
Karyotypic studies of Sphenomorphus indicus
(Scincidae) and Taky'dromus septentrion-
alis (Lacertidae). Asiatic Herpetological
Research 2:55-59. (Y. Yang, Z. Gao and E.
Zhao)
Karyotypic studies of nine species of Chinese
salamanders. Asiatic Herpetological
Research 4:146-157.
Karyological studies on amphibians in China.
Asiatic Herpetological Research 10:298-
305.
Yildirimham, H. S.
See M. Sevim; et al. (and H. S. Yildirimham)
Yin, F.
See H. Shi et al. (and F. Yin)
176
Asiatic Herpetological Research, Vol. 1 1
2008
You, W.-H.
See P.-C. Wang et al. (and W.-H. You)
Youmans, T.
See J. L. Grismer et al. (and T. Youmans)
L.L. Grismer et al. (and T. Youmans)
Yuan, Z.
See H. Shi et al. (and Z. Yuan)
Zz
Zbigniew, S.
Reptiles of the Democratic People’s Republic
of Korea Part I. Serpentes. Chinese
Herpetological Research. 1:22-59. (S.
Zbigniew and D. O. Hung)
Zeng, X.
See M. Song et al. (and X. Zeng)
Zhang, D.
See Y. Chen et al. (and D. Zhang)
Zhang, F.-J.
See P. Guo et al. (and F.-J. Zhang)
Y. Yang et al. (and F.-J. Zhang)
Zhang, H.-S.
See X. Ji et al. (and H.-S. Zhang)
Zhang, J.-H.
See P.-C. Wang (and J.-H. Zhang)
Zhang, T.
See C. Niu et al. (and T. Zhang)
Zhang, Y.
Effects of Chinese snake venoms on blood
coagulation, purified coagulation factors
and synthetic chromogenic substrates.
Asiatic Herpetological Research 5:117-
126. (Y. Zhang, Y.-L. Xiong and C. Bon)
Immuno-chemical study of TS V-PA, a specific
plasminogen activator from the venom of
Trimeresurus stejnegeri. Asiatic
Herpetological Research 8:107-110. (Y.
Zhang, W.-H. Lee, Y.-L. Xiong and W.-Y.
Wang)
Zhang, Z.
A major research achievement in captive repro-
duction of Chinese alligators. Asiatic
Herpetological Research 2:69-71.
Research on the sex sensitive period during the
incubation of Chinese alligator eggs.
Asiatic Herpetological Research 6:157-
160.
See also, H. Gu et al. (and Z. Zhang)
Zhao, E.
A taxonomic study on Chinese species of the
genus Sibynophis. Chinese Herpetological
Research. 1:1-6.
Karyotypes of Chinese species of Occidozyga
(Family Ranidae), with discussion on the
taxonomic status of O. laevis martensi.
Chinese Herpetological Research 1:7-11.
(E. Zhao, A. Tan and G.-F. Wu)
A new species of Rana from Ningxia Hui
Autonomous Region. Asiatic
Herpetological Research 2:1-3. (E. Zhao,
J. R. Macey and T. J. Papenfuss)
The validity of Elaphe perlacea , a rare endemic
snake from Sichuan Province, China.
Asiatic Herpetological Research 3:101-
103.
A new species of Rhabdophis (Serpentes:
Colubridae) from Hainan Island, China.
Asiatic Herpetological Research 7:166-
169.
Infraspecific classification of some Chinese
snakes. Asiatic Herpetological Research
7:170-172.
See also, K. Adler (and E. Zhao)
K. Adler et al. (and E. Zhao)
J. Fu (and E. Zhao)
P. Guo (and E. Zhao)
J. R. Macey et al. (and E. Zhao)
Y. Mu (and E. Zhao)
A. Tan et al. (and E. Zhao)
Y. Tang et al. (and E. Zhao)
Y. Yang et al. (and E. Zhao)
Zheng, X.-M.
Cytotaxonomical studies on Chinese pelobatids
V. The karyotypes, C-bands and Ag-NORs
of Megophrys omeimontis and Oreolalax
schmidti. Asiatic Herpetological Research
2:37-45. (X.-M. Zheng and G.-F. Wu)
Cytotaxonomic studies on Chinese pelobatids
VI. The karyotypes, C-bands and Ag-
NORs of Megophrys minor and Oreolalax
major. Asiatic Herpetological Research
6:167-171. (X.-M. Zheng and G.-F. Wu)
Karyotypes of four microhylid frogs from
Xishuangbanna, Southern Yunnan, China.
2008
Asiatic Herpetological Research, Voi. 11
177
Asiatic Herpetological Research 6:161—
166. (X.-M. Zheng and G.-F. Wu)
Zhong, C.
First records for Ophisaurus harti and Python
molurus bivittatus from Jiangxi Province,
China. Asiatic Herpetological Research
5:103-104.
Zhu, F.
See M. Huang et al. (and F. Zhu)
Zou, G.
See Y. Tang et al. (and G. Zou)
Zug, G. R.
Amphibians and reptiles of the Royal Chitwan
National Park, Nepal. Asiatic
Herpetological Research 6:172-180. (G.
R. Zug, and J. C. Mitchell)
Zykova, L. Y.
See E. N. Panov (and L. Y. Zykova)
Taxonomic Index
Aa
Ablabes chinensis, 1:4, 42.
Ablabes Nicobariensis, 8:22.
Ablepharus, 10:194.
Ablepharus alaicus, 8:73.
Ablepharus chernovi , 10:233.
Ablepharus deserti, 5:130, 133; 8:69, 70, 71, 72, 73.
Ablepharus gray anus, 10:1 94.
Ablepharus kitaibelii , 10:205.
Ablepharus pannonicus, 5:6, 130, 133, 134, 135;
10:194.
Acanthodactylus , 8:85; 9:111; 10:194.
Acanthodactylus blanfordi , 8:85.
Acanthodactylus blandfordii , 10:194.
Acanthodactylus boskianus, 7:159; 8:85, 86, 87, 88.
Acanthodactylus boskianus asper, 8:87, 88.
Acanthodactylus boskianus boskianus , 8:87, 88.
Acanthodactylus boskianus euphraticus, 8:87, 88.
Acanthodactylus cantoris , 8:85; 10:194.
Acanthodactylus grandis, 8:85.
Acanthodactylus micropholis, 8:85; 10:194.
Acanthodactylus opheodurus, 8:85.
Acanthodactylus schmiditi , 10:180.
Acanthodactylus schmidti, 8:85; 10:178.
Acanthodactylus schreiberi , 7:159; 8:85, 88.
Acanthodactylus scutellatus, 7:159.
Acanthosaura armata, 10:251, 257.
Achalinus meiguensis, 8:45.
Acinixys planicauda, 10:107.
A cris crepitans , 6:121, 128.
Acrochordus granulatus , 9:41, 51, 55.
Acutotyphlops , 6:132, 142, 143, 144, 148.
Acutotyphlops infralabialis , 6:132, 139, 140, 141, 142,
143, 144, 145, 147, 148.
Acutotyphlops kunuaensis, 6:132, 139, 140, 141, 142,
143, 144, 145, 146, 147, 148.
Acutotyphlops solomonis, 6:132, 139, 140, 141, 142,
143, 144, 145, 146, 147, 148, 149.
Acutotyphlops subocularis, 6:132, 139, 140, 141, 142,
143, 145, 147, 148, 149.
Aelurophryne, 7:34, 35, 70, 71.
Aelurophiyne mamma ta, 7:71.
Afrana , 6:86.
Agama , 3: 1 04.
Agama agilis , 8:90, 91.
Agama atra, 10:232.
Agama blandfordi, 10:178.
Agama blandfordii, 10:179.
Agama himalayana sacra, 3:104.
Agama isolepis, 8:90, 91.
Agama kermanensis, 8:101.
178
Asiatic Herpetological Research, Vol. 1 1
2008
Agama kermanensis brevicauda, 8:101.
Agama ( Laudakia ) stellio, 9:151.
Agama tiedmanni , 5:21.
Agama versicolor , 5:14, 21.
Agamodon anguliceps, 8:5.
Agamura , 10:193.
Agamura persica , 10:193.
Agkistrodon , 1:23, 49; 4:57, 58, 60; 5:122; 6:62.
Agkistrodon acutus, 4:58; 5:117, 118, 120, 121, 122,
123, 124, 125; 8:107, 108, 110.
Agkistrodon blomhoffii , 1:46, 47.
Agkistrodon blomhoffii blomhoffii, 1:45.
Agkistrodon blomhoffii brevicaudus, 1:22, 28, 45, 46,
47, 52; 4:58, 59, 60, 62, 63, 64, 65, 66; 6:62, 63, 68.
Agkistrodon blomhoffii intermedius, 1:47.
Agkistrodon blomhoffii ussuriensis, 1:45, 47; 4:58, 59,
60.
Agkistrodon caliginosus, 1:22, 28, 46, 47, 52.
Agkistrodon contortrix contortrix, 5:124, 125.
Agkistrodon halis, 7:134.
Agkistrodon halis caucasicus, 7:134.
Agkistrodon halys, 1:45, 48, 49; 4:58; 5:117, 118, 120,
121, 122, 123, 124, 125, 132, 133, 135; 8:73, 107, 108.
Agkistrodon halys blomhoffii, 6:83.
Agkistrodon halys brevicaudus, 1:45, 46.
Agkistrodon halys caraganus, 4:57; 5:130.
Agkistrodon halys caucasicus, 5:6, 130.
Agkistrodon halys intermedius, 1:48; 7:132.
Agkistron himalayanus, 2:24.
Agkistrodon intermedius, 2:4; 4:58, 59, 60.
Agkistrodon intermedius saxatilis, 1:48.
Agkistrodon monticola, 4:58.
Agkistrodon saxatalis, 1:22.
Agkistrodon saxatilis, 1:28, 47, 48, 52; 4:58, 60.
Agkistrodon shedaoensis, 4:58, 59, 60; 6:62; 7:170;
8:46.
Agkistrodon strauchii, 2:4; 4:58, 60, Plate 1.
Agkistrodon ussuriensis, 1:46, 47; 6:62.
Agrionemys, 10:192.
Agrionemys horsfieldi, 5:129, 132, 133, 134, 135;
10:106.
Agrionemys hors fieldii, 10:192.
Ahaetulla, 2:22, 23, 27, 28.
Ahaetulla nasuta, 2:23; 6:173; 7:1, 4.
Ahaetulla prasina, 3:66; 5:96; 10:253, 273.
Ahaetulla prasina prasina, 4:32.
Ahaetulla prasina preocularis, 5:96; 9:41, 51, 63.
Aldabrachelys dussumieri, 10:106.
Allaeochelys, 10:45, 47.
Alligator, 6:155.
Alligator chinensis, 2:69.
Alligator mississipiensis, 6:157.
Alligator mississippiensis, 4:133, 134, 136; 5:113;
7:141; 8:57.
Alligator sinensis, 3:129; 4:132, 133, 135, 137, 138;
5:112, 113, 114, 115; 6:157.
Alsophylax boehmei, 10:151, 152, 157, 158.
Alsophylax laevis, 5:129, 131.
Alsophylax loricatus, 5:131.
Alsophylax loricatus szczerbaki, 5:129.
Alsophylax pipiens, 5:129, 131; 9:114, 116, 119.
Alsophylax przewalskii, 8:22.
Altigekko, 10:193.
Altigekko baturensis, 10:193.
Altigekko boehmei, 10:193.
Altigekko stoliczkai, 10:193.
Altiphy lax boehmei, 10:151, 152, 157, 158.
Altirana, 6:69, 71, 72, 73, 75, 76, 77, 86; 10:300.
Altirana parkeri, 6:69, 70, 71, 73, 74, 75, 76, 77.
Alytes, 5:140, 141.
Ambystoma maculatum, 5:160, 161.
Ambystoma tigrinum, 4:71.
Amerana, 6:86.
Amietia, 6:86.
Amnirana, 6:86, 92, 93, 94.
Amnirana albolabris, 6:90, 96.
Amnirana lepus, 6:90, 96.
Amo, 6:86.
Amolops, 6:85, 86, 88, 90, 91, 92, 93, 94, 96; 10:300.
Amolops afghanus, 6:96.
Amolops formosus, 6:90, 92, 94, 96.
Amolops jingjiangensis, 1:12
Amolops kinabaluensis, 6:90, 96.
Amolops larutensis, 7:1, 2, 3, 4.
Amolops mantzorum, 1:12; 10:301.
Amolops marmoratus, 6:89, 90, 91, 92, 94, 96.
Amolops nasicus, 6:90, 96.
Amphiesma, 1:23; 10:195, 276.
Amphiesma optata, 8:45.
Amphiesma platyceps, 4:31; 10:196.
Amphiesma sieboldii, 10:196.
Amphiesma stolata, 2:47; 4:31; 6:173, 178.
Amphiesma stolatum, 10:196.
Amphiesma vibakari, 1:27, 39.
Amphiesma vibakari ruthveni, 1:22, 38, 39, 52.
Amphisbaena mertensi, 8:4.
Amyda cartilaginea, 10:135, 143, 148.
Ancistrodon halys, 1:45, 48.
Ancistrodon halys brevicaudus, 1:45, 46.
Ancistrodon halys intermedius, 1:48.
Ancistrodon saxatilis, 1:48.
Anelytropsis, 4:6.
Anelytropsis papillosus, 4:6, 11.
Anguis, 8:13.
Anguis firagilis, 3:13, 21, 68, 70, 78; 8:4; 10:232, 233.
Anguis fragilis colchicus, 3:68.
Anguis melanostictus, 8:13.
Anguis platura, 1:43.
2008
Asiatic Herpetological Research, Vol. 1 1
179
Anguis ruff a, 4:40.
Anguis r uf us, 4:40.
Anilius , 4:37.
Annamemys, 10:33.
Annamemys annamensis, 10:106.
Annandia, 6:86.
Anniella pulchra, 8:4.
Anolis , 2:27; 6:39.
Anolis aeneus, 6:103.
Anolis carolinensis, 2:24.
Anolis polylepis , 7:160.
Anomochilus, 4:37.
Anosteira, 10:38, 42, 45, 47, 49.
Ansonia, 6:94; 7:49; 8:21.
Ansonia penangensis, 8:21.
Ansonia tiomanica, 10:251, 255, 258, 277.
Apalone spinifera, 10:55, 56, 57, 59, 60, 61, 62, 63, 65,
66, 70, 71, 72, 105, 107.
Aphaniotis fusca, 10:252, 257.
Aquarana, 6:86.
Archeolacerta, 3:28, 29, 77.
Argyrogena, 10:196.
Argyrogena fasciolata, 10:196.
Asaccus elisae, 10:217, 218, 219, 220, 221.
Ascaphus, 7:73.
Aspideretes, 3:127; 10:49, 192.
Aspideretes gangeticus, 3:126, 127; 6:173; 10:192.
Aspideretes hurum, 3:126, 127; 6:179; 10:192.
Asterochelys radiata, 10:107.
Asterochelys yniphora, 10:107.
Astrotia, 10:197.
Astrotia stokesii, 10:197.
Asymblepharus, 8:69, 71.
Asymblepharus alaicus, 8:69, 70, 71, 72, 73.
Atympanophrys , 7:70, 71, 93, 97, 98, 99; 10:298, 300.
Atympanophrys shapingensis, 2:37, 42, 43, 44; 7:95, 97,
98; 10:298.
Aurorana, 6:86.
Bb
Babina , 6:86.
Barkudia , 8:13, 14, 15, 16.
Barkudia insularis, 8:13, 14, 15, 16.
Barkudia melanosticta, 8:13, 14, 15, 16.
Batagur, 10:55.
Batagur baska , 10:55, 61, 62, 63, 64, 66, 67, 68, 70, 72,
74, 105, 106, 107, 131, 136.
Batrachoseps, 4:71.
Batrachuperus, 3:40, 43; 4:152, 153; 9:6; 10:168, 169,
170, 171, 172, 174, 190, 224, 287, 288, 301, 302.
Batrachuperus gorganensis, 10:168, 169, 170, 171, 172,
174, 190, 286.
Batrachuperus karlschmidti, 4:146, 147, 149, 150, 151,
152, 153, 155; 9:7, 8; 10:168, 169, 171, 172, 301, 302.
Batrachuperus longdongensis, 9:6, 7; 10: 168, 170, 171,
172.
Batrachuperus mustersi, 4:149, 153; 10: 168, 169, 171,
172, 174.
Batrachuperus persicus, 10:168, 169, 172, 174, 182,
183, 184, 185, 186, 187, 188, 189.
Batrachuperus pinchonii, 4:153; 9:8; 10:168, 171, 172,
301, 302.
Batrachuperus taibaiensis , 9:6, 7, 8.
Batrachuperus tibetanus, 4:153; 9:7, 8; 10: 168, 171,
172,301,302.
Batrachuperus yenyuanensis, 4:146, 147, 149, 150, 151,
152, 153, 155; 10:168, 171, 172, 301, 302.
Batrachuperus yenyuansis, 9:8.
Batr achy lodes, 6:86.
Batrachylodes vertebralis, 6:89, 90, 93, 96.
Bipes biporus, 8:4.
Blanus cinereus, 8:4.
Boiga , 5:96; 10:196.
Boiga angulata , 9:41, 52, 64.
Boiga cynodon, 5:96; 10:253.
Boiga cf. cynodon, 9:42, 52, 64.
Boiga dendrophila, 2:23.
Boiga cf. dendrophila, 9:42, 52, 64.
Boiga dendrophila latifasciata, 5:96.
Boiga drapiezii, 10:253, 273.
Boiga gokool, 4:32.
Boiga melanocephala, 10:196.
Boiga multifasciata, 4:32.
Boiga nigriceps, 10:253, 273.
Boiga ochracea, 6:173, 178; 10:235.
Boiga ochracea ochracea , 4:31, 32.
Boiga ochracea walli, 10:235.
Boiga trigonata, 6:173; 10:196.
Boiga trigonatum, 5:132, 133, 134; 7:134.
Boiga trigonatum melanocephala, 7:132, 134.
Boiga trigonatum melanocephalia , 5:130.
Bolyeria, 2:23.
Bombina, 5:137, 138, 139, 140, 141; 10:298, 300.
Bombina bombina, 5:137, 140, 141; 8:51.
Bombina fortinuptialis, 5:137, 138, 139, 140, 141.
Bombina for tinuuptialis, 5: 140.
Bombina maxima, 5:137, 138, 139, 140, 141; 10:298.
Bombina microdeladigitora, 5:137, 138, 139, 140, 141.
Bombina orientalis, 5:137, 138, 139, 140, 141; 10:298.
Bombina variegata , 5:137, 140, 141.
Bombina variegata pachymus, 10:163.
Bombina variegata pachypus, 10:162.
Bothrops asper, 6:83.
Bothrops atrox, 5:1 17, 125; 8:108.
Bourretia, 6:86, 93.
Bourretia doriae, 6:88, 90, 92, 93, 96.
Bourretia pileata, 6:93.
180
Asiatic Herpetological Research, Vol. 1 1
2008
Bourretia pileatus, 6:90, 96.
Brachymeles, 5:90.
Brachymeles boulengeri taylori , 9:41, 49, 61, 62, 64.
Brachymeles gracilis hilong , 5:89.
Brachymeles schadenbergi orientalis , 5:90.
Brachymeles talinis, 9:41, 49.
Brachymeles tridactylus , 9:41, 49, 62.
Brachysaura, 10:192.
Brachysaura minor, 10:192.
Brachytarsophrys, 7:70, 71, 93, 94, 95, 96, 97, 98, 99,
103, 104, 106; 10:298.
Brachytarsophrys carinensis, 1:12; 2:37, 38, 42, 44;
7:96, 97, 98, 103, 104, 105, 106, 107; 10:298.
Brachytarsophrys carienensis, 2:43.
Brachytarsophrys feae, 7:96, 97, 98, 103, 104, 105, 106,
107.
Brachytarsophrys intermedius, 7:103, 105, 106, 107.
Brachytarsophrys platyparietus, 7:103, 106.
Brachytarsophy, 10:300.
Bransateryx, 4:78.
Briba, 6:30, 33.
Briba brasiliana , 6:30.
Bronchocela , 9:40, 46.
Bronchocela burmana, 8:24.
Bronchocela cristatella, 8:24; 9:46; 10:252, 257 .
Bronchocela marmorata, 9:46.
Buergeria, 2:35.
Buergeria buergeri, 7:46.
Buergeria japonica, 7:45.
Bufo, 5:31, 32, 33, 34, 36, 40, 42, 43; 6:175; 9:85, 130;
10:191, 300.
Bufo americanus, 8:50, 51.
Bufo arabicus, 9:83.
Bufo asper, 7:1, 2; 10:251, 255.
Bufo biporcatus, 7:45.
Bufo boreas, 7:87.
Bufo bufo, 5:33; 7:45; 8:51.
Bufo calamita , 8:51.
Bufo danatensis, 7:27, 28, 29; 9:99.
Bufo gargarizans, 4:68, 69, 71; 10:300.
Bufo hemiophrys, 7:87.
Bufo himalayanus, 10:191.
Bufo japonicus, 7:45, 46.
Bufo kavirensis, 9:77, 79, 83, 84, 99.
Bufo latastii, 8:65; 9:77, 79, 80, 82, 85, 86, 88, 89, 90,
100; 10:191.
Bufo luristanicus, 9:79, 83, 87.
Bufo melanostictus, 6:173, 175; 7:1, 2, 45, 87; 10:251,
255, 296.
Bufo melanostictus hazarensis, 10:191.
Bufo mammata, 7:71.
Bufo marinus, 5:99; 9:39, 40, 55, 59; 10:163.
Bufo nouettei, 9:100.
Bufo oblongus, 9:77, 79, 80, 81, 82, 83, 84, 87, 99.
Bufo olivaceus, 10:191.
Bufo parvus, 10:251, 255.
Bufo persicus, 9:100.
Bufo pseudoraddei, 9:90.
Bufo pseudoraddei baturae, 9:77, 81, 85, 100; 10:191.
Bufo pseudoraddei pseudoraddei, 9:77; 10: 191.
Bufo raddei, 2:4; 9:90; 10:300.
Bufo shaartusiensis, 9:100.
Bufo siacheninsis, 10:191.
Bufo siachinensis, 9:85, 100.
Bufo stomaticus, 6:173, 175; 9:85; 10:191.
Bufo surdus, 9:83, 90, 100; 10:191.
Bufo surdus annulatus, 9:100.
Bufo {surdus) luristanicus, 9:83, 99.
Bufo taxkorensis, 9:100.
Bufo verrucosissimus, 3:67, 69, 71, 72, 73, 75, 77; 4:48;
5:43, 74, 76, 77, 78, 79, 80, 81, 82, 83, 163.
Bufo verrucoisissimus, 5:77.
Bufo verucossimus, 3:12.
Bufo viridis, 3:19, 70, 78; 5:33, 43; 7:27, 28, 29, 137;
9:77, 80, 81, 82, 83, 84, 85, 88, 89, 90, 98; 10:161, 162,
163.
Bufo viridis arabicus, 9:83, 84.
Bufo viridis asiomontanus, 9:100.
Bufo viridis grum-grzimailoi, 9:100.
Bufo viridis kermanensis, 9:77, 79, 80, 81, 82, 83, 84,
85, 87, 99.
Bufo viridis pewzowi, 9:80, 100.
Bufo ( viridis ) pseudoraddei pseudoraddei, 9:100.
Bufo viridis strauchi, 9:80, 100.
Bufo viridis turanensis, 7:28, 29, 30; 9:80, 83, 99.
Bufo ( viridis ) unicolor, 9:100.
Bufo viridis viridis, 7:28, 29.
Bufo ( viridis ) zugmayeri, 9:100.
Bufo viridis zugmayeri, 10:191.
Bufo vulgaris, 10:163.
Bufo woodhousei fowleri, 7:87.
Bungarus, 1:17, 19, 21; 10:197.
Bungarus candidus, 1:17, 18, 19, 20, 21, Plate IV.
Bungarus caeruleus, 1:17, 19, 21; 6:173.
Bungarus caeruleus caeruleus , 10:197.
Bungarus fasciatus, 1:17, 18, 19, 21, Plate V; 5:1 17, 118,
120, 121, 124, 125; 6:173, 177, 178; 8:107, 108.
Bungarus flaviceps, 10:254.
Bungarus multicinctus, 1:17, 18, 19, 20, 21, Plate III;
5:118, 120, 121, 124; 8:107, 108.
Bungarus niger, 4:31.
Bungarus sindanus razai, 10:197.
Bungarus sindanus sindanus, 10:197.
B unopus, 10:193.
Bunopus tuberculatus, 5:129, 131; 10:193.
Burmemys, 10:38, 45, 46, 47, 49.
Burmemys magnifica, 10:38, 43, 44, 45.
2008
Asiatic Herpetological Research, Voi. 1 1
181
Cc
Cabrita, 9:111.
Calamaria, 2:25; 4:13, 16, 39; 10:273, 274.
Calamaria buchi, 4:16.
Calamaria geravaisi, 9:52.
Calamaria gervaisi , 5:97, 98, 99, 100; 9:42.
Calamaria ingeri, 10:253, 264, 273.
Calamaria lovii, 10:274.
Calamaria lovii gimletti , 10:274.
Calamaria lowi, 4:13, 14, 15, 16.
Calamaria lowi ingermarxi , 4:13, 14, 15, 16.
Calamaria lowi gimletti , 4:13, 15, 16.
Calamaria lowi lowi , 4:13, 15, 16.
Calamaria lowi wermuthi, 4:13, 15, 16.
Calamaria lumbricoidea , 10:253.
Calamaria pavimentata , 4:16; 10:253.
Calamaria septemtrionalis, 4:16.
Calamaria septentrionalis , 4:16.
Calemys insculpta , 10:106.
Calemys muhlenbergii, 10:106.
Callagur borneoensis, 10:55, 57, 64, 68, 74, 100, 105,
106, 108.
Calliophis calligaster gemianulis, 9:42, 54.
Calliophis intestinalis, 10:254, 216.
Calliophis macclellandii, 6:173.
Callisaurus , 2:1 1.
Callisaurus draconoides, 2:11.
Callopsis annulata, 10:106.
Callopsis areolata, 10:106.
Callopsis funerea , 10:106.
Callopsis nasuta, 10:106.
Callopsis pulcherrima, 10:107.
Callopsis rubida , 10:107.
Calotes , 4:26; 5:14, 15, 28; 6:27; 10:192, 295, 296.
Calotes bhutanensis, 4:23, 26, 33.
Calotes cristatellus, 5:88, 93.
Calotes emma, 10:295, 296.
Calotes gigas, 5:24.
Calotes grandisquamis, 5:15.
Calotes jerdoni, 2:25; 5:16.
Calotes medogensis , 8:43.
Calotes mystaceus , 2:25.
Calotes nemoricola, 10:296.
Calotes nigrigularis, 6:27.
Calotes versicolor , 4:26; 5:14, 15, 16, 1 7, 20, 2 1 , 24, 25,
28; 6:27, 173, 176; 10:296.
Calotes versicolor farooqi, 10:193.
Calotes versicolor nigrigularis , 5: 14, 21, 22, 23, 24, 25,
27, 28; 6:27.
Calotes versicolor versicolor , 5:16, 21, 22, 23, 24, 25,
26, 28; 10:192
Calotes viridis, 5:21, 24.
Calotes vultuosa, 5:24.
Cantoria day ana, 8:22.
Cantoria violaceus, 8:22.
Caretta, 10:192.
Caretta caretta , 10:55, 56, 57, 59, 60, 61, 62, 63, 65, 66,
68, 70, 71, 72, 105, 107, 192.
Carettochelys, 10:46, 47.
Carettochelys insculpta, 10:47, 54, 107.
Carpophrys, 7:72.
C as are a, 2:23.
Casarea dussumieri, 2:27.
Centrochelys sulcata, 10:116.
Ceratobatrachus, 6:86.
Ceratophora, 4:95.
Ceratophrys , 7:70.
Cerberus rynchops, 9:42, 52; 10:253.
Chalcides, 10:195.
Chalcides ocellatus, 5:131, 10:195, 232, 233.
Chalcides ocellatus ocellatus, 5:130.
Chalcidoseps, 8:16.
Chalcidoseps thwaitesii, 8:16.
Chalcorana, 6:86, 92, 93.
Chalcorana chalconota, 6:90, 92, 96.
Chalcorana cf. everetti, 9:45.
Chamaeleo, 10:193.
Chamaeleo zeylanicus, 10:193.
Chaparana, 6:86.
Chaperina fusca, 10:251, 255.
Chelonia, 10:192.
Chelonia mydas, 10:135, 148, 178, 192.
Chelodina, 10:70, 72.
Chelodina siebenrocki, 10:55, 65, 105, 107.
Chelonoidis carbonaria, 10:64, 66, 67, 85, 90, 92, 93,
97, 105, 106, 108.
Chelonoidis chilensis, 10:61, 66, 67, 105, 106.
Chelonoidis denticulata, 10:106.
Chelonoidis nigra, 10:106.
Chelus fimbriatus, 10:65, 107.
Chelydra, 10:126.
Chelydra serpentina, 7:141, 142; 8:57; 9:73; 10:55, 56,
57, 59, 60, 61, 62, 63, 65, 66, 68, 70, 71, 72, 105, 107,
126.
Chelydra serpetins, 7:141.
Chelydropsis , 10:59.
Chersina angulata , 10:106.
Chinemys, 10:28, 120, 122.
Chinemys kM’angtungensis, 2:65.
Chinemys nigricans, 2:65; 10:106.
Chinemys reevesii, 2:65; 6:151, 152, 153, 154, 155;
7:139, 140, 141, 142, 143, 144, 145, 146; 10:28, 57, 58,
59, 62, 63, 65, 68, 70, 74, 81, 85, 86, 87, 95, 105, 107,
109, 122, 123.
Chioglossa lusitanica, 5:147, 148, 150, 151, 153, 156,
157, 158, 160, 162, 163.
Chirixalus, 2:35; 10:19, 20.
182
Asiatic Herpetological Research, Vol. 1 1
2008
Chirixalus doriae , 2:35; 10:19.
Chirixalus hansenae, 10:19.
Chirixalus laevis, 10:19.
Chirixalus nongkhorensis, 10:19.
Chirixalus palpebralis, 10:19.
Chirixalus vittatus, 10:19.
Chitra, 10:48, 192
Chitra indica, 3:126, 127; 6:173, 192
Chondropython, 2:27.
Chorlakkichelys, 10:47, 49.
Chrysemys, 10:55, 75.
Chrysemys adiutrix, 10:106.
Chrysemys alabamensis, 10:106.
Chrysemys callirostris, 10:106.
Chrysemys concinna, 10:106.
Chrysemys decorata, 10:106.
Chrysemys decussata, 10:106.
Chrysemys dorbigni, 8:75, 79; 10:106.
Chrysemys emolli, 10:106.
Chrysemys floridana, 10:106.
Chrysemys gaigeae, 10:106.
Chrysemys nebulosa, 10:106.
Chrysemys nelsoni , 10:106.
Chrysemys ornata, 10:107.
Chrysemys picta , 7:142; 8:57, 75, 79; 10:58, 63, 67, 68,
70, 73, 105, 107, 108.
Chrysemys rubriventris, 10:107
Chrysemys scripta, 10:107.
Chrysemys stejnegeri, 10:107.
Chrysemys taylori, 10:107.
Chrysemys terrapin , 10:107.
Chrysemys texana , 10:107.
Chrysemys venusta, 10:107.
Chrysemys yaquia, 10:107.
Chrysopelea ornata , 6:173.
Chrysopelea paradisi, 9:42, 47, 52; 10:254, 277.
Chrysopelea pelias, 10:253, 265, 274.
Cistoclemmys flavomarginata, 2:66; 10:106.
Cistoclemmys galbinifrons, 2:66; 10:106.
Cistoclemmys trifasciata, 10:107.
Clelia occipitolutea, 2:53.
Clemmys bealei , 3:120; 10:106.
Clemmys bealei quadriocellata, 3:120.
Clemmys caspica, 10:106.
Clemmys guangxiensis, 9:71.
Clemmys guttata, 10:55, 63, 72, 105, 106, 108.
Clemmys insculpta , 10:59, 63, 75, 91, 94, 105, 106.
Clemmys japonica, 10:106.
Clemmys leprosa, 10:106.
Clemmys marmorata, 7:141; 10:55, 63, 105, 106.
Clemmys muhlenbergii, 10:55, 63, 105, 106.
Clemmys mutica, 2:66; 10: 106.
Clemmys quadriocellata , 2:66; 3:120; 10:107.
Clinotarsus, 6:86.
Cnemaspis affinis , 8:21.
Cnemaspis kendallii, 10:252, 270.
Cnemaspis limi, 10:252, 262, 270.
Cnemaspis nigridia, 10:270.
Cnemidophorus, 2:11.
Coiluber atayevi, 5:Plate 1.
Coleonyx, 2:63.
Coleonyx brevis , 2:63.
Coleonyx variegatus, 2:63; 7:153, 154, 158, 159, 160,
162; 10:219.
Coluber, 5:1; 7:51, 52, 58; 9:151; 10:196.
Coluber atayevi, 5:1, 2, Plate 1, 3, 4, 5, 6, 7, 8; 7:134.
Coluber anomalus, 1:35.
Coluber berus, 1:44.
Coluber berus dinniki, 3:4, 5, 14.
Coluber caspius, 5:130, 133, 135.
Coluber constrictor, 7:142; 8:57.
Coluber dione, 1:31.
Coluber jugularis, 3:13, 70, 78.
Coluber jugularis caspius, 3:70.
Coluber karelini, 5:132, 133, 134; 7:51, 52, 53, 54, 55,
56, 58, 134.
Coluber karelini karelini, 5:130; 10:196.
Coluber karelini mintonorum, 9:155; 10:196.
Coluber kaznakowi, 3:4, 6.
Coluber najadum, 3:13, 68, 69, 78; 4:52; 5:1, 2, 3, 4, 5,
6, 7, 8, 131, 6:24.
Coluber najadum dahlia, 5:3.
Coluber najadum najadum, 5:3, 130.
Coluber najadum rubriceps, 5:1, 2, 3, 4, 7, 8.
Coluber nummifer, 5:6; 7:131, 132, 133, 134, 135.
Coluber ravergieri, 5:6, 130, 132, 133, 134, 135; 7:55,
56, 58, 131, 132, 133, 134, 135, 137; 8:73.
Coluber ravergieri glazunovi, 7:131.
Coluber rhodorachis, 5:132, 133, 134, 135; 7:51, 52, 53,
54, 55, 56, 57, 58.
Coluber rhodorachis ladacensis, 5:130.
Coluber rhodorachis rhodorachis, 5:130.
Coluber rhodorhachis, 7:134.
Coluber rubriceps, 5:4, 5, 6, 8.
Coluber rubriceps rubriceps, 5:7.
Coluber rubriceps thracius, 5:3, 7.
Coluber spinalis, 1:22, 26, 27, 29, 52; 2:4, 5.
Coluber taeniura friesei, 1:37.
Coluber ventromaculatus, 7:51, 52, 53, 54, 55, 56, 57,
58.
Conraua, 6:86.
Cophophryne, 7:71.
Cophotis, 4:95.
Cor alius, 2:27.
Coronella austriaca, 3:13, 68, 70, 78.
Coronella austrica, 3:21.
Cosymbotus, 6:30, 33.
Cosymbotus craspedotus, 6:31; 10:252, 270.
2008
Asiatic Herpetological Research, Voi. 1 1
183
Cosymbotus platyurus, 6:31; 9:40, 47, 48, 103, 104;
10:252, 270.
Crocodylus, 6:155; 10:192
Crocodylns mindorensis , 9:65.
Crocodylus novaeguinae, 4:135.
Crocodylus palustris , 6:173; 10:192.
Crossobamon, 10:193.
Crossobamon eversmanni, 5:129, 132, 133, 134.
Crossobamon lumsdeni , 10:193.
Crossobamon maynardi , 10:193.
Crossobamon orientalis, 8:23; 10:193.
Crotalus atrox , 6:78.
Crotalus viridis, 4:66; 7:134.
Cuora, 8:111, 112; 9:142; 10:29, 30, 120, 122, 131.
Cuora amboinensis, 4:32; 6:50, 51; 9:60; 10:23, 24, 55,
57, 59, 60, 66, 67, 69, 71, 75, 81, 82, 86, 91, 94, 96, 97,
98, 99, 105, 106, 107, 123, 127, 131, 134, 137.
Cuora amboinensis amboinensis , 6:49, 50, 51; 9:40, 46.
Cuora amboinensis couro, 6:51.
Cuora amboinensis kamaroma, 6:49, 51; 10:122.
Cuora aurocapitata, 8:111, 112; 10:106.
Cuora bourreti, 10:122, 123, 131.
Cuora chris karannarum, 8:111, 112, 113.
Cuora flavomarginata , 2:66; 10:57, 60, 70, 71, 105, 108,
106, 122, 127.
Coura galbinifrons, 10:57, 66, 69, 70, 71, 74, 79, 88, 98,
105, 106, 112, 122, 123, 127, 131, 137.
Cuora galbinifrons galbinifrons , 10:131.
Cuora hainanensis, 2:66.
Cuora mouhotii, 10:29, 31, 32, 37, 57, 58, 59, 61, 63, 65,
69, 70, 71, 77, 78, 79, 80, 81, 82, 88, 105, 106, 108, 131,
138.
Coura pallidicephala , 8:112.
Cuora pani , 2:66; 8:111, 112, 113; 9:75, 142; 10:107.
Cuora picturata, 10:29, 31, 32, 37.
Cuora serrata, 10:122, 123.
Cuora trifaciata, 10:126, 127.
Cuora trifasciata, 2:66; 8:112; 9:71, 72, 73, 74, 75;
10:29,31,32,37, 105-106, 107, 112, 122, 123, 127.
Cuora yunnanensis, 2:66; 8:111, 112; 9:142; 10:107.
Cuora zhoui, 8:111, 112; 10:107.
Cyclemys, 10:120, 121, 122, 132, 133, 139.
Cyclemys atripons, 10:131, 132, 134, 138.
Cyclemys dentata , 6:49, 50; 10:23, 24, 25, 55, 62, 65,
67, 69, 70, 71, 72, 73, 75, 105, 106, 108, 127.
Cyclemys mouhotii, 10:106.
Cyclemys oldhamii, 10:106.
Cyclemys pulchristriata, 10:107, 132.
Cyclemys shanensis, 10:120, 121, 122, 123.
Cyclemys tcheponensis, 10:71, 105, 107, 132, 133, 134,
139.
Cyclochorus lineatus, 9:9.
Cyclochorus lineatus maculatus, 9:9, 11.
Cyclochorus maculatus, 9:9, 10, 11.
Cyclocorus, 2:22, 23, 26, 28; 9:9, 19, 20.
Cyclocorus lineatus, 9:11.
Cyclocorus lineatus alcalai, 9:42, 52, 64.
Cyclocorus nuchalis, 5:97.
Cyclocorus nuchalis taylori, 5:91, 97.
Cylindrophis, 4:37, 38, 39, 40.
Cylindrophis resplendens, 4:40.
Cylindrophis ruffus, 4:37, 38, 39, 40.
Cylindrophis ruffus ruffus, 4:38.
Cylindrophis rufus, 4:37.
Cynops, 4:150; 10:302.
Cynops cyanurus yunnanensis, 4:146, 150, 152, 153,
155; 10:302.
Cynops cyanurus yunnansis, 4:154.
Cynops ensicauda, 7:45.
Cynops orientalis, 4:148, 155, 156; 10:302.
Cyrtodactylus, 4:55; 7:19; 8:60, 62, 66; 9:47; 10:151,
296.
Cyrtodactylus affinis, 8:21.
Cyrtodactylus agusanensis, 5:87, 88, 92, 93.
Cyrtodactylus albofasciatus, 8:62.
Cyrtodactylus angularis, 8:62.
Cyrtodactylus annulatus, 9:40, 47, 52, 61, 64.
Cyrtodactylus battalensis, 8:62, 65, 66, 68.
Cyrtodactylus baturensis, 8:62, 66.
Cyrtodactylus brevipalmatus, 6:32.
Cyrtodactylus chitralensis, 8:66.
Cyrtodactylus collegalensis, 8:62, 68.
Cyrtodactylus consobrinoides, 8:62.
Cyrtodactylus darmandvillei, 2:25.
Cyrtodactylus dattanensis , 8:60, 62, 65, 66, 68.
Cyrtodactylus dekkanensis, 8:62.
Cyrtodactylus fasciolatus, 8:68.
Cyrtodactylus ( Cyrtopodion ) (. Mediodactylus ) hetero-
cercus, 9:151.
Cyrtodactylus himalayanus, 8:62.
Cyrtodactylus intermedins, 8:62.
Cyrtodactylus jayporensis, 8:62.
Cyrtodactylus khasiensis, 8:62.
Cyrtodactylus kirmanensis, 8:62, 66.
Cyrtodactylus lawderanus, 8:62.
Cyrtodactylus madarensis , 4:55, 56.
Cyrtodactylus medogensis, 8:44.
Cyrtodactylus mintoni, 8:60, 62, 65, 66.
Cyrtodactylus nebulosus, 8:62, 68.
Cyrtodactylus oldhami, 8:68.
Cyrtodactylus philippinicus, 9:41, 47, 61, 64.
Cyrtodactylus pulchellus, 8:62, 68.
Cyrtodactylus quadrivirgatus , 10:252, 270.
Cyrtodactylus rubidus , 8:62.
Cyrtodactylus stoliczkai, 4:55; 8:60, 62, 63, 66; 10:157.
Cyrtodactylus tibetanus, 3:109.
Cyrtodactylus tibetinus, 8:62, 68.
Cyrtodactylus tiomanensis, 10:252, 262, 271, 276, 277 .
184
Asiatic Herpetological Research, Vol. 1 1
2008
Cyrtodactylus triedrus, 8:62, 68.
Cyrtodactylus xvalli , 8:60, 62, 66.
Cyrtodactylus yarkandensis, 8:60, 66, 68; 10:157.
Cyrtodactylus yarkendensis , 8:62.
Cyrtopodion, 8:65; 10:151, 153, 158, 193.
Cyrtopodion agamuroides, 8:62; 10:193.
Cyrtopodion battalensis, 10:158.
Cyrtopodion baturensis, 10:156, 158.
Cyrtopodion caspius, 5:6, 132, 133, 134, 135.
Cyrtopodion caspius caspius, 5:129.
Cyrtopodion chitralensis, 10:156, 158.
Cyrtopodion dattanensis, 10:158.
Cyrtopodion elongatus , 8:22.
Cyrtopodion fedtschenkoi, 5:129, 132, 134, 135.
Cyrtopodion (Mediodactylus) heterocercus, 9:151.
Cyrtopodion heterocercus mardinensis, 10:217, 218,
219, 220, 221.
Cyrtopodion himalayanus, 10:158.
Cyrtopodion kachhense ingoldbyi, 10:193.
Cyrtopodion kachhense kachhense, 10:193.
Cyrtopodion kachhensis , 8:62, 65.
Cyrtopodion kirmanense, 10:158.
Cyrtopodion kohsulaimanai, 8:65; 10:193.
Cyrtopodion kotschyi, 10:205.
Cyrtopodion longipes, 5:131.
Cyrtopodion longipes microlepis, 5:129.
Cyrtopodion mintoni, 10:156, 158.
Cyrtopodion montiumsalsorum, 8:65; 10:193.
Cyrtopodion potoharensis, 10:193.
Cyrtopodion russowi, 5:129, 132, 133, 134.
Cyrtopodion scaber, 8:62, 65; 10:217, 218, 219, 220,
221.
Cyrtopodion scabrum, 9:122, 127; 10:194, 221.
Cyrtopodion spinicauda, 5:129, 135.
Cyrtopodion stoliczkai, 10:151, 152, 153, 154, 156, 157,
158.
Cyrtopodion tibetanus, 10:158.
Cyrtopodion turcmenicus, 5:129, 131.
Cyrtopodion walli, 10:156, 157, 158.
Cyrtopodion watsoni, 8:62, 65; 10:194.
Cyrtopodion yarkandensis, 10:151, 157, 158.
Dd
Daboia, 10:197.
Daboia russelii russelii, 10:197.
Dasia, 10:241.
Dasia grisea, 9:41, 49.
Dasia olivacea , 10:252, 271.
Dasia semicincta , 9:41, 49.
Dasia semisincta, 9:64.
Dasia vyneri, 10:241.
Deinagkistrodon, 4:58, 60; 8:38, 42.
Deinagkistrodon acutus, 4:58, 59, 60; 8:38, 39, 41, 42.
Deirochelys, 10:55, 75.
Deirochelys reticularia, 8:57; 10:55, 57, 58, 60, 63, 67,
68,71,72, 83,91, 105, 107, 109.
Denderlaphis striatus, 10:253.
Dendrelaphis caudolineatus, 10:253.
Dendrelaphis caudolineatus terrificus, 5:97; 9:42, 52.
Dendrelaphis cyanochloris, 10:253, 274.
Dendrelaphis pictus, 3:65; 10:253, 274.
Dendrelaphis pictus pictus, 9:42, 52, 63.
Dendrelaphis striatus, 10:265, 274.
Dendrelaphis tristis, 6:173.
Dermochelys, 10:192.
Dermochelys coriacea, 10:135, 148, 192.
Desmognathus, 5: 1 60.
Diadophis punctatus, 2:27.
Dibamus, 3:65; 4:1, 2, 3, 4, 10, 11; 10:1, 3, 5, 6.
Dibamus alfredi, 4:1; 10:1, 3, 4, 5, 6.
Dibamus cf. alfredi, 10:1, 4.
Dibamus bogadeki, 4:1, 2, 3, 8, 9, 11; 7:84; 10:3, 4, 5, 6.
Dibamus booliati, 10:3, 4, 5, 6.
Dibamus bourreti, 3:65; 4:1, 2, 3, 4, 5, 6, 8, 9, 10, 11;
10:3,4, 5, 6.
Dibamus bourreti bourreti, 4:4.
Dibamus cf. bourreti, 3:64; 4:8.
Dibamus celebensis, 10:3, 4, 5, 6.
Dibamus deharvengi, 10:3, 4, 5, 6.
Dibamus greeri, 4:1, 2, 3, 4, 5, 6, 7, 8, 10, 11, Plate 1;
10:3,4, 5, 6.
Dibamus ingeri, 10:3, 4, 5, 6.
Dibamus kondaoensis, 10:1, 3, 4, 5, 6.
Dibamus leucurus, 10:1, 3, 4, 5, 6.
Dibamus montanus, 4:1, 2, 3, 9, 10, 11; 10:1, 3, 4, 5, 6.
Dibamus nicobaricum, 10:3, 5, 6.
Dibamus nicobaricus, 10:5.
Dibamus novaeguinae, 3:65.
Dibamus novaeguineae, 4:6, 11; 10:1, 3, 4, 5, 6.
Dibamus seramensis, 10:3, 4, 5, 6.
Dibamus smithi, 4:1, 2, 3, 7, 10, 11; 10:3, 4, 5, 6.
Dibamus somsaki, 10:4, 5, 6.
Dibamus taylori, 10:4, 5, 6.
Dibamus tiomanensis, 10:1, 2, 4, 5, 6, 253, 273.
Dibamus vorisi, 10:4, 5.
Dinodon, 2:46.
Dinodon gammiei, 8:24.
Dinodon rosozonatum, 8:45.
Dinodon rufozonatum, 1:26, 29, 30; 2:46, 47, 53; 8:57.
Dinodon rufozonatum rufozonatum , 1:22, 29, 52.
Dinodon rufozonatum wallii, 1:30.
Dinodon rufozonatus, 1:29.
Dinodon rufozonayum, 2:48, 50.
Diplometopon , 8:4, 5.
Diplometopon zarudnyi, 8:1, 3, 4, 5.
Dipsochelys dussumieri, 10:106.
Dipsosaurus dorsalis, 4:85.
2008
Asiatic Herpetological Research, Vol. 11
185
Discodeles, 6:86; 10:256.
Discoglossus, 5:137, 140, 141; 7:74.
Discoglossus giganteus , 5:32.
Discoglossus pictus , 6:120; 7:76; 10:298.
Disteira cyanocincta, 1:42.
Disteira spiralis melanocephala, 1:43.
Ditypophis , 2:23.
Ditypophis vivax, 2:23, 27.
Dogania subplana, 10:251, 277.
Draco, 5:88; 8:23, 27; 9:46.
Draco blanfordi , 8:23.
Draco fimbriatus, 10:252, 257, 261.
Draco haematopogon , 10:252, 257, 261, 276.
Draco major , 8:23.
Draco melanopogan, 8:27.
Draco melanopogon, 8:27; 10:252, 269.
Draco mindanensis, 5:88, 93, 94.
Draco obscurus formosus, 8:25, 26, 27.
Draco sumatranus, 10:252, 269.
Draco spilopterus , 9:40, 46, 60.
Draco volans, 5:88, 89, 93; 8:27.
Dravidogecko, 6:30, 31, 32, 33.
Dravidogecko anamallensis, 6:30, 31, 32, 33.
Dryocalamus davisoni, 8:24.
Dryocalamus davisonii , 8:24.
Dryocalamus subannulatus, 10:253, 274.
Dryophiops philippina, 5:97.
Dryophiops rubescens, 10:253.
Ee
Eburana, 6:86.
Echinotriton , 4:156; 10:302.
Echinotriton andersoni , 10:302.
Dc/zD, 5:28; 10:197.
Echis carinatus , 5:14, 28, 117; 10:197.
Echis carinatus astolae , 10:197.
Echis carinatus multisquamatus , 10:197.
Dc/zw carinatus sochureki , 10:197.
Echis multisquamatus, 5:130, 132, 133, 134; 7:134.
Echmatemys, 10:55, 70.
Eirenis, 7:134.
Eirenis meda, 5:6.
Eirenis medus, 5:130, 134, 135.
Elachistoon westermanni, 6:173.
Elachistodon, 6:178.
Elaphe, 1:34, 35; 2:46, 47.
Elaphe bimaculata, 2:47, 53.
Elaphe carinata, 2:47, 53; 4:139; 8:57.
Elaphe coreana, 1:31.
Elaphe davidi, 1:22, 26, 30, 31, 38, 52.
Elaphe dione, 1:22, 26, 31, 32, 33, 52; 2: 4, 53, 5.130,
133; 7:137; 8:73.
Elaphe dione coreana, 1:31.
Elaphe erythrura erythrura, 5:97, 100.
Elaphe erythrura psephenoura, 9:42, 53.
Elaphe flavolineata, 10:253, 274.
Elaphe helenae, 6:173.
Elaphe hohenackeri, 3:13; 6:24.
Elaphe longissima, 3:13, 73, 75, 76, 77.
Elaphe mandarina, 2:46, 47, 48, 51, 53; 3: 101; 7:85.
Elaphe moellendor/ji, 2:53.
Elaphe perlacea, 3:101, 102, 103.
Elaphe porphyracea, 10:277.
Elaphe quatuorlineata, 5: 132.
Elaphe quatuorlineatus sauromates, 3:68; 5:130.
Elaphe radiata, 6:173.
Elaphe rufodorsata, 1:22, 27, 33, 34, 35, 52; 2:53.
Elaphe rufodorsatus, 1:33.
Elaphe schrencki schrencki, 1:35.
Elaphe schrenckii, 1:27, 35, 36, 37.
Elaphe schrenckii anomala, 1:22, 35, 36, 53.
Elaphe schrenckii schrenkii, 1:22, 27, 35.
Elaphe schrenckij schrenckii, 1:53.
Elaphe subocularis, 2:47.
Elaphe taeniura, 1:37, 38; 2:53; 4:139; 8:53, 54, 55, 56,
57, 58; 10:253, 274.
Elaphe taeniura friesei, 1:37.
Elaphe taeniura grabowskyi, 1:37.
Elaphe taeniura ridleyi, 1:37.
Elaphe taeniura taeniura, 1:22, 37, 52, 59.
Elaphe taeniurus, 1:37.
Elaphis schrenckii, 1:35.
Eleutherodactylus , 6:120.
Eleutherodactylus ricordii, 6:121.
Eleutherodactylus shrevei, 10:282.
Emoia atrocostata, 8:21; 9:41, 49, 64; 10:252, 271.
Emydoidea blandingii, 10:55, 60, 63, 67, 69, 70, 71, 88,
89, 93,95,99, 105, 106, 107.
Emydura, 10:70.
Emydura subglobosa, 10:55, 65, 105, 107.
Emys, 10:55.
Emys blandingii, 10:106.
Emys marmorata, 10:106.
Emys orbicularis, 3:68, 70, 78; 5:129, 133; 10:61, 63,
67, 69, 70, 71, 79, 80, 82, 83, 84, 85, 87, 96, 105, 107,
108.
Enhydrina, 10:1 97.
Enhydrina schistosa, 10:197.
Enhydris, 1:35; 10:196.
Enhydris enhydris, 6:179; 10:253.
Enhydris maculosa, 8:24.
Enhydris pakistanica, 10:196.
Enhydris plumbea , 10:253, 274.
Enhydris rufodorsata, 1:33.
Eremias, 2:10, 11, 13; 4:79, 80, 113, 120; 7:157, 170;
9:107, 108, 109, 110, 111, 114, 118, 119, 120; 10:194.
Eremias acutirostris, 10:194.
186
Asiatic Herpetological Research, Vol. 1 1
2008
Eremias afghanistanica, 9:107, 109.
Eremias aporosceles , 10:194.
Eremias argus, 4:120.
Eremias arguta, 5:131.
Eremias arguta uzbekistanica , 5:130.
Eremias brachydactyla, 4:113, 120.
Eremias fasciata, 10:194.
Eremias grammica, 4:85; 5:130, 132, 133, 134.
Eremias intermedia , 5:130, 132, 133, 134.
Eremias kessleri, 4:113, 120.
Eremias kesslieri, 4:120.
Eremias lalezharica, 9:107, 109.
Eremias lineolata, 5:130, 132, 133, 134.
Eremias lineoocellata , 7:159, 160.
Eremias lugubris, 7:159.
Eremias ( Eremias ) montanus, 9:107, 108, 111.
Eremias montanus, 9:108, 110, 111.
Eremias multiocellata, 4:113, 114, 120; 8:23; 9:114,
115, 116, 117, 118, 119, 120.
Eremias namaquensis, 7:159.
Eremias nigrocellata, 5:130, 131.
Eremias nigrolateralis, 9:107, 108, 112.
Eremias nikolskii, 9:107, 109.
Eremias persica, 5:130, 134; 9:107, 109, 111, 112;
10:194.
Eremias przewalskii, 4:113, 114, 115, 116, 118, 119,
120, 121; 9:114, 115, 116, 117, 118, 119, 120.
Eremias przewalskii przewalskii, 4:120.
Eremias przewalskii tuvensis, 4:120.
Eremias regeli, 5:130, 131; 9:107, 109.
Eremias scripta, 5:132, 133, 134; 10:194.
Eremias scripta scripta, 5:130.
Eremias strauchi, 5:6, 134; 9:107, 109, 112.
Eremias strauchi kopetdaghica, 5:130.
Eremias suphani, 9:107.
Eremias velox, 2:6, 7, 8, 10, 11, 12; 5:132, 133, 134,
135; 7:157; 9:107, 109, 110, 112.
Eremias velox velox, 5:130.
Eremias vermiculata, 4:100; 8:23.
Eremias yarkandensis, 8:23.
Eremiascincus fasciolatus, 3:57.
Eretmochelys, 10:192.
Eretmochelys imbricata, 10:135, 148, 192.
Ergilemys, 10:42.
Eripaa, 6:86.
Eristicophis, 10: 1 97.
Eristicophis macmahonii, 10:197.
Ermia mangshanensis, 8:46.
Erymnochelys madagascariensis, 10:59, 107.
Eryx,4-.19\ 7:134; 10:195.
Eryx conicus, 10:195.
Eryx elegans, 5:130, 135.
Eryxjohnii, 10:1 95.
Eryx miliaris, 5:6, 132, 133, 134.
Eryx miliaris miliaris, 5:130.
Eryx tataricus, 4:100; 5:131.
Eryx tataricus speciosus, 10: 195.
Eryx tataricus specious, 5:130.
Eryx tatarticus, 2:63.
Eublepharis, 4:55; 10:193.
Eublepharis angramainyu, 4:56; 10:230, 231, 232, 233.
Eublepharis hardwickii, 4:56.
Eublepharis macularius, 4:55, 56; 10: 193.
Eublepharis turcmenicus, 5:129, 135.
Eumeces, 2:26, 27; 7:61, 62, 80; 9:151.
Eumeces algeriensis, 10:233.
Eumeces blythianus, 7:61, 62, 65, 66.
Eumeces chinensis, 8:57.
Eumeces fasciatus, 8:57.
Eumeces indothalensis, 7:61, 62, 63, 64, 65, 66.
Eumeces liui, 8:44.
Eumeces pavimentatus, 7:65.
Eumeces princeps, 7:65, 66.
Eumeces quadrilineatus , 2:25; 7:80, 83.
Eumeces schneider i, 5:132, 133, 134, 135; 10:233.
Eumeces schneideri princes, 5:130.
Eumeces schneiderii, 7:62, 64, 65, 66.
Eumeces taeniolatus, 5:6, 133, 134-135; 7:61, 62, 64.
Eumeces taeniolatus taeniolatus, 5:130.
Eumeces tetragrammus, 2:26.
Eumeces zarudnyi, 7:61, 62, 65, 66.
Euphlyctis, 6:86; 10:191.
Euphlyctis cyanophlyctis cyanophlyctis, 10:191.
Euphlyctis cyanophlyctis micro spinulata, 10:191.
Euphlyctis cyanophlyctis seistanica, 10:191.
Eurylepis, 10:195.
Eurylepis taeniolatus taeniolatus, 10:195.
Eutropis longicaudata, 10:252.
Eutropis multifasciata, 10:252, 271.
Ff
Feirana, 6:86.
Fejervarya, 6:86; 10:191.
Fejervarya cancrivora, 10:251, 255.
Fejervarya cancrivora cancrivora , 9:44.
Fejervarya limnocharis, 10:191.
Fejervarya syhadrensis, 10:191.
Fejervarya vittigera, 9:45.
Fordonia leucobalia, 10:253, 266, 274.
Gg
Gavialis, 10:192.
Gavialis gangeticus, 4:23, 26; 6:173; 10:192.
Gehyra mutilata, 9:41, 47, 61; 10:252, 271.
Gehyra variegata, 7:159; 10:219.
Gekko, 7:20, 154.
2008
Asiatic Herpetological Research, Voi. 1 1
187
Gekko chinensis , 4:8.
Gekko gecko, 3:54, 55; 7:154, 158, 160, 161, 162; 9:41,
47, 104; 10:126.
Gekko gigante , 9:41, 47, 48, 58, 61, 66.
Gekko hokouensis, 7:153, 154, 155, 156, 158, 159, 160,
161, 162.
Gekko japonicus, 7:147, 148, 149, 150, 153, 154, 156,
157, 158, 159, 160, 161, 162.
Gekko kikuchii, 9:48.
Gekko mindorensis, 9:41, 48, 61.
Gekko monarchus , 10:252, 271.
Gekko smithii, 10:252.
Geochelone, 10:192.
Geochelone carbonaria , 10:106
Geochelone chilensis, 10:106.
Geochelone denticulata, 10:106.
Geochelone dussumieri, 10:106.
Geochelone elegans, 6:176; 10:61, 66, 105, 106, 192.
Geochelone elongata, 10:106.
Geochelone emys, 10:106.
Geochelone forsteni, 10:106.
Geochelone impressa, 2:67; 10:106.
Geochelone nigra , 10:66, 105, 106.
Geochelone pardalis, 10:57, 64, 66, 67, 70, 93, 95, 105,
107, 108.
Geochelone platynota, 10:54, 107.
Geochelone radiata, 10:61, 107.
Geochelone sulcata, 10:64, 66, 107.
Geochelone travancorica, 10:107.
Geochelone yniphora, 10:107.
Geochlemys hamiltoni, 3:126.
Geoclemmys hamiltoni, 3:127, 128.
Geoclemys, 10:192.
Geoclemys hamiltoni , 6:179.
Geoclemys hamiltonii, 10:56, 57, 58, 63, 65, 68, 69, 80,
105, 106, 108, 192.
Geoemyda, 10:55, 59.
Geoemyda annulata, 10:59, 106.
Geoemyda areolata, 10:106.
Geoemyda dentata, 10:106.
Geoemyda depressa, 10:106.
Geoemyda diademata, 10:106.
Geoemyda flavomarginata, 10:106.
Geoemyda funerea, 10:106.
Geoemyda grandis, 10: 1 06.
Geoemyda japonica, 10: 122.
Geoemyda leytensis, 10:106.
Geoemyda melanosterna, 10:106.
Geoemyda mouhotii, 10: 106.
Geoemyda nasuta, 10: 106.
Geoemyda pulcherrima, 10:107.
Geoemyda punctularia, 10:107.
Geoemyda rubida, 1 0: 1 07.
Geoemyda silvatica, 10:107.
Geoemyda spengleri, 10:57, 59, 60, 61, 65, 68, 70, 72,
74, 81, 89, 90, 92, 93, 99, 105, 107, 109, 127.
Geoemyda spinosa, 10: 107.
Geoemyda tcheponensis, 10:107.
Geoemyda tricarinata, 10:107.
Geoemyda trijuga, 10:107.
Geoemyda yuwonoi, 1 0: 1 07.
Glandirana, 6:86.
Glandula, 5:140, 141; 10:298.
Gloydius, 8:38, 42; 10:197.
Gloydius brevicaudus, 8:38, 39, 40.
Gloydius himalayanus, 10:197.
Gloydius intermedius, 8:39, 40.
Gloydius qinlingensis, 8:39, 41.
Gloydius saxatilis, 8:39, 40.
Gloydius shedaoensis, 8:39, 41, 46.
Gloydius strauchii, 8:39, 40, 41.
Gloydius ussuriensis, 8:38, 39, 40.
Glyptemys insculpta, 10:54, 55, 63, 75, 106.
Glyptemys muhlenbergii, 10:106.
Gonatodes, 7:160.
Gonglysoma mukutense, 10:253, 266, 275, 276.
Goniochersus angulata, 10:106.
Gonocephalus, 9:40, 46, 61.
Gonocephalus chamaeleontinus, 10:252, 270.
Gonocephalus grandis, 10:252, 270, 277.
Gonocephalus semperi, 9:46.
Gonocephalus sophiae, 9:46.
Gonydactylus, 7:19, 20, 21.
Gonydactylus angularis, 7:21.
Gonydactylus condorensis, 7:21, 22.
Gonydactylus intermedius, 7:22.
Gonydactylus irregularis, 7:22.
Gonydactylus oldhami, 7:21.
Gonydactylus paradoxus, 7:19, 20, 21, 22.
Gonydactylus philippinicus, 7:21.
Gonyocephalus godeffroyi, 5:88.
Gonyocephalus semperi, 5:88, 92, 93.
Gonyosoma oxycephala , 9:42, 53, 55.
Gonyosoma oxycephalum, 10:253, 267, 275.
Gopherus, 10:61, 62, 69, 70.
Gopherus agassizii, 10:57, 61, 62, 64, 66, 67, 69, 105,
107, 106.
Gopherus berlandieri, 10:61, 62, 64, 66, 69, 83, 87, 105,
106.
Gopherus chilensis, 10:61.
Gopherus flavomarginatus, 10:66, 69, 105, 106.
Gopherus polyphemus, 7:140; 10:61, 62, 64, 66, 67, 69,
105, 107, 109.
Graptemys, 10:55, 57, 58, 61, 64, 65, 67, 75, 76.
Graptemys barbouri, 10:58, 59, 63, 65, 105, 106, 107.
Graptemys caglei, 10:106.
Graptemys ernsti, 10:58, 59, 63, 105, 106.
Graptemys flavimaculata, 10:58, 59, 63, 65, 73, 105,
188
Asiatic Herpetological Research, Vol. 1 1
2008
106.
Graptemys geographica, 10:58, 59, 63, 65, 105, 106.
Graptemys gibbonsi, 10:58, 59, 63, 106.
Graptemys kohnii, 10:58, 59, 63, 65, 105, 106.
Graptemys nigrinoda , 10:58, 59, 63, 65, 105, 106.
Graptemys oculifera, 10:54, 55, 58, 59, 63, 65, 105, 106.
Graptemys ouachitensis, 10:58, 63, 105, 107.
Graptemys pseudogeographica, 10:65, 107.
Graptemys pulchra, 10:105, 107.
Graptemys versa, 10:58, 63, 65, 106, 107.
Gravemys, 10:55, 68, 69, 70, 71.
Gymnodactylus , 8:60; 10:156.
Gymnodactylus chitralensis, 8:68.
Gymnodactylus elongatus, 8:22.
Gymnodactylus microtis, 8:22.
Gymnodactylus mintoni, 9:155; 10:157.
Gymnodactylus stoliczakai , 8:60.
Gymnodactylus stoliczkai , 8:60, 63, 68; 10:157.
Gymnodactylus walli, 8:60, 68; 10:157.
Gymnodactylus yarkandensis, 10:151, 157.
Gynandropaa, 6:86.
Gynnodactylus stoliczkai, 8:60.
Hh
Hadrianus, 10:42, 49.
Hardella, 10:55, 192.
Hardella thurji, 3:127, 128; 6:179.
Hardella thurjii, 10:55, 62, 63, 64, 68, 73, 85, 95, 105,
107, 109, 192.
Hardella thutjii, 4:32.
Heleophryne, 6:94.
Hemichelys, 10:47, 49.
Hemidactylus, 2:25; 6:30, 31, 32, 33, 34, 177; 7:80;
10:194.
Hemidactylus albopunctataus, 6:31.
Hemidactylus anamallensis, 6:30, 33, 34.
Hemidactylus ansorgii, 6:31, 32.
Hemidactylus barodanus, 6:31, 32.
Hemidactylus bouvieri, 6:31, 32.
Hemidactylus bowringi, 4:8; 7:80, 82.
Hemidactylus bowringii, 4:32; 6:31, 32.
Hemidactylus brookii, 4:27; 6:31, 173, 177; 10:194.
Hemidactylus citernii, 6:31.
Hemidactylus curlei, 6:31.
Hemidactylus depressus, 6:31.
Hemidactylus echinus, 6:31.
Hemidactylus fasciatus, 6:31, 32.
Hemidactylus flaviviridis, 4:32; 6:31, 173, 177; 8:64, 66;
10:194.
Hemidactylus forbesii, 6:31, 32.
Hemidactylus frenatus, 4:27; 6:31, 173, 177; 7:161;
9:41,48, 103, 104; 10:194, 252, 271.
Hemidactylus gar noti, 9: :48, 104.
Hemidactylus garnotii, 4:32; 6:31, 32, 173, 177.
Hemidactylus giganteus, 6:3 1 .
Hemidactylus gracilis, 6:31, 34.
Hemidactylus grand, 6:3 1 .
Hemidactylus greeffd, 6:31.
Hemidactylus homeolepis, 6:31.
Hemidactylus isolepis, 6:31.
Hemidactylus jubensis, 6:31.
Hemidactylus karenorum, 6:31.
Hemidactylus laevis, 6:31.
Hemidactylus leschenaulti, 6:31.
Hemidactylus leschenauldi, 10:194.
Hemidactylus longicephalus, 6:31.
Hemidactylus mabouia, 6:31, 32.
Hemidactylus macropholis, 6:31.
Hemidactylus maculatus, 6:31.
Hemidactylus megalops, 6:3 1 .
Hemidactylus mercatorius, 6:31.
Hemidactylus modestus, 6:31.
Hemidactylus muriceus, 6:31.
Hemidactylus ophiolepis, 6:31, 32.
Hemidactylus oxyrhinus, 6:31.
Hemidactylus persicus, 6:31; 8:66; 10:194.
Hemidactylus prashadi, 6:31.
Hemidactylus pumilio, 6:31.
Hemidactylus redculatus, 6:31, 32, 34.
Hemidactylus richardsoni, 6:31.
Hemidactylus richardsonii, 6:32.
Hemidactylus ruspolii, 6:31.
Hemidactylus sinaitus, 6:31.
Hemidactylus smithi, 6:31.
Hemidactylus smithii, 6:31, 32.
Hemidactylus somalicus, 6:31, 32.
Hemidactylus squamulatus, 6:31.
Hemidactylus stejnegeri, 9:41, 48.
Hemidactylus subtriedrus, 6:31.
Hemidactylus taylori, 6:31.
Hemidactylus triedrus, 6:3 1 ; 10: 1 94.
Hemidactylus tropidolepis, 6:31.
Hemidactylus turcicus, 6:31, 32; 7:160; 10:194, 217,
218,219, 220, 221,232, 233.
Hemidactylus yerburii, 6:31.
Hemiphyllodactylus insularis, 9:41, 48.
Hemiphyllodactylus typus, 9:48.
Hemorrhois, 10:196.
Hemorrhois ravergieri, 10:196.
Heosemys, 10:57, 67, 120, 122.
Heosemys depressa, 10:106.
Heosemys grandis, 10:55, 57, 62, 65, 67, 68, 71, 72, 73,
75, 77, 78, 81, 82, 83, 84, 87, 92, 93, 95, 100, 105, 106,
108, 127, 133, 134, 140.
Heosemys leytensis, 6:50, 10:22, 23, 24, 25, 26, 106.
Heosemys silvatica, 10:107.
Heosemys spinosa, 10:57, 67, 68, 71, 72, 73, 90, 92, 98,
2008
Asiatic Herpetological Research, Vol. 11
189
105, 107.
Heteronota binoei , 10:219.
Heteronotia binoei, 7:159.
Hieremys , 10:120, 122.
Hieremys annandalei, 10:68, 105, 107, 127.
Hieremys annandalii, 10:106, 134, 140, 144.
Hologerrhum, 9:9, 10, 11, 17, 19, 20, 64.
Hologerrhum dermali, 9:11, 12, 13, 14, 15, 16, 17, 18,
19, 20, 42, 53,64.
Hologerrhum philippinum, 9:9, 10, 11, 12, 13, 14, 16,
17, 19, 20.
Hologerrhum philippinum philippinum, 9:14.
Hologerrum philippinum, 9:11.
Homalopsis buccata, 6:173.
Homopus areolatus, 10:62, 105, 106.
Homopus boulengeri, 10:106.
Homopus femoralis, 10:106.
Homopus signatus, 10:105, 107.
Hoplobatrachus, 6:86; 10:191.
Hoplobatrachus tigerinus, 7:46; 10:191.
Hoplodactylus , 6:30.
Huia , 6:86, 94.
Huia kinabaluensis, 6:90, 96.
Huia nasicus, 6:90, 96.
Humerana, 6:86.
Hydromedusa, 10:72.
Hydrophis, 10:197.
Hydrophis belcheri, 9:42, 54.
Hydrophis caerulescens, 10:197.
Hydrophis cyanocinctus, 1:22, 42, 49; 9:42, 54; 10:197.
Hydrophis elegans, 9:42, 54.
Hydrophis fasciatus, 10:197.
Hydrophis inornatus, 9:42, 54.
Hydrophis lapemoides, 10:197.
Hydrophis mamillaris, 10:197.
Hydrophis melanocephala, 1:43.
Hydrophis melanocephalus, 1:22, 43, 49.
Hydrophis ornatus, 10:197.
Hydrophis spiralis, 10:197.
Hydrophis sublaevis melanocephala, 1:43.
Hydrophylax, 6:86, 93.
Hydrophylax galamensis, 6:90, 96.
Hydrosaurus, 9:46.
Hydrosaurus pustulatus, 9:40, 46, 60, 64.
Hydrosaurus pustulosus, 5:88, 89.
Hydrus platurus, 1:43.
Hyla, 6:85; 10:300.
Hyla arborea, 5:78, 79, 81.
Hyla arborea schelkownikowi, 3:70, 71, 77; 5:74, 76, 77,
78, 80, 83.
Hyla crucifer , 8:50, 51.
Hyla japonica, 4:68, 69; 7:45; 8:51.
Hyla versicolor, 8:50, 51.
Hylarana, 6:86, 88, 92, 93.
Hylarana erythraea, 6:87, 90, 92, 96; 9:45.
Hylorana Nicobariensis, 8:21.
Hynobius, 3:37, 38, 39, 40, 41, 42, 43, 44; 10:287, 288,
301.
Hynobius chinensis, 3:37, 38, 39, 40.
Hynobius dunni, 4:149; 10:284, 285.
Hynobius formosanus, 3:42.
Hynobius fuscus, 3:40, 41 .
Hynobius keyserlingii, 10:286.
Hynobius kimurai, 3:42.
Hynobius leechii, 3:42, 43.
Hynobius lichenatus, 3:40, 42.
Hynobius naevis, 10:84, 285.
Hynobius nebulosus, 10:284, 285.
Hynobius nigrescens, 3:40, 41, 42, 43.
Hynobius okiensis, 3:42.
Hynobius retardatus, 3:37, 40, 41, 42, 43; 4:149, 152;
10:284, 285.
Hynobius sonani, 3:42.
Hynobius tsuensis, 10:284, 285, 286.
Hynobius yiwuensis, 3:37, 39, 40.
Hyperolius, 6:93, 94.
Hyperolius viridiflavus karissimbiensis , 6:90, 91, 92, 93,
96.
Hypsirhina maculata, 8:24.
Ii
Ichnotropis, 7:1 60.
Ichnotropis squamulosa, 7:159, 160.
Ichthyophis, 10:251, 277.
Iguana iguana, 7:142.
Indirana gundia, 6:90, 92, 96.
Indogekko , 10:194.
Indogekko fortmunroi, 10: 194.
Indogekko indusoani, 10:194.
Indogekko rhodocaudus , 10:194.
Indogekko rohtasfortai , 10:194.
Indogekko walli, 10:194.
Indotestudo, 6:178; 10:70.
Indotestudo elongata , 4:32; 6:173, 176; 10:61, 70, 89,
94, 105, 106, 108, 127, 142, 146.
Indotestudo forsteni, 10:70, 105, 106.
Indotestudo travancorica, 10:107.
Ingerana, 6:86, 94.
Ingerana tasanae, 6:89, 90, 92, 93, 96.
Ixalus, 7:70.
Jj
Japalura, 10:193.
Japalura andersoniana , 4:32.
Japalura bengalensis, 4:27.
Japalura kumaonensis, 10:193.
190
Asiatic Herpetological Research, Vol. 1 1
2008
Japalura szechwanensis, 8:43.
Japalura tricarinata , 4:32.
Japalura variegata , 4:26, 27.
Japalura yunnanensis, 4:26.
Kk
Kachuga, 6:28; 10:192.
Kachuga dhongoka, 3:127; 6:28, 173; 10:106.
Kachuga drongoka, 4:32.
Kachuga kachuga, 6:173; 10:55, 63, 64, 70, 105, 108.
Kachuga smithi, 6:179.
Kachuga smithii, 4:32; 10:107, 192.
Kachuga sylhetensis, 4:32; 10:107.
Kachuga tecta, 3:126, 127, 128; 4:32; 6:173; 10:107,
192.
Kachuga tentoria, 4:32; 6:28, 179; 10:107.
Kachuga tentoria flaviventer, 3:127.
Kachuga trivittata, 10:107.
Kalophrynus, 10:300.
Kalophrynus palmatissimus, 7:1.
Kalophrynus pleurostigma, 10:251, 255, 259.
Kaloula, 6:51, 85, 161, 164, 166; 7:80; 9:39, 40, 64;
10:300.
Kaloula baleata, 10:251.
Kaloula conjuncta, 9:39.
Kaloula conjuncta negrosensis, 9:39, 40, 59, 64.
Kaloula kalingensis, 9:39, 64.
Kaloula kokacii, 9:39, 64.
Kaloula negrosensis, 9:39.
Kaloula picta, 6:164; 9:39, 40, 55, 59.
Kaloula pulchra , 6:165, 166; 7:1, 2, 84; 10:251.
Kaloula pulchra pulchra, 6:161, 162, 164, 165; 7:80, 81
Kaloula rugifera, 6:165, 166.
Kansuchelys, 10:42, 49.
Kenyemys, 10:41.
Kinixys belliana, 10:62, 64, 71, 77, 85, 105, 106.
Kinixys erosa, 10:64, 65, 66, 71, 96, 105, 106.
Kinixys homeana , 10:62, 64, 65, 66, 67, 71, 105, 106,
108.
Kinixys lobatsiana, 10:106.
Kinixys natalensis, 10:106.
Kinixys spekii , 10:107.
Kinosternon coloratus, 7:141.
Kinosternon odoratus, 10:107.
Kinosternon scorpioides, 10:65, 107.
Kinosternon subrubrum , 7:141.
LI
Lacerta, 5:42; 7:161.
Lacerta agilis, 3:12, 13, 19, 68; 10:232.
Lacerta agilis grusinica, 3:69, 72, 74, 75, 75, 80.
Lacerta boskiana, 8:85.
Lacerta caucasica, 3:13, 20, 21.
Lacerta caucasica alpina, 3:70, 80.
Lacerta clarcorum, 3:80.
Lacerta clarkorum, 3:69, 75.
Lacerta danfordi , 10:205.
Lacerta derjugini, 3:12, 13, 19, 68, 69, 72, 77.
Lacerta laevis, 7:159, 160.
Lacerta media, 3:68, 69, 78.
Lacerta mixta, 3:13, 69, 73, 75.
Lacerta parva, 10:202, 203, 204, 205, 206.
Lacerta parvula, 3:13, 69, 73, 75.
Lacerta praticola, 3:12, 13, 68, 69.
Lacerta praticola pontica, 3:69, 78.
Lacerta raddei, 5:131.
Lacerta raddei raddei, 5:130.
Lacerta rudis, 3:13, 70, 77; 10:233.
Lacerta rudis bithynica, 9:122, 123, 124, 125, 126, 127,
128.
Lacerta saxicola, 3:12, 13, 21, 68.
Lacerta saxicola brauneri, 3:69, 73, 75, 77.
Lacerta saxicola darevskii, 3:69, 73, 75, 77, 78.
Lacerta strigata, 3:68, 69; 5:130, 131; 6:24.
Lacerta trilineata, 3:13.
Lacerta viridis, 10:232.
Lamprolepis, 10:241.
Lamprolepis nieuwenhuisii, 10:241.
Lamprolepis smaragdina, 10:241.
Lamprolepis smaragdina philippinica, 5:90; 9:41, 49.
Lamprolepis vyneri, 10:241, 242, 243.
Lampropeltis, 2:27.
Lapemis , 10:197.
Lapemis curtus, 10:197.
Lapemis hardwickii, 9:42, 54.
Larutia seribuatensis, 10:252, 272.
Laticauda colubrina, 9:42, 54.
Laudakia, 10:193, 208.
Laudakia agrorensis, 10:193.
Laudakia badakhshana, 10:193.
Laudakia caucasia, 10:193.
Laudakia fusca, 10:193.
Laudakia himalayana , 8:65; 10:193.
Laudakia lirata, 10:193.
Laudakia melanura melanura , 10:193.
Laudakia melanura nasiri, 10:193.
Laudakia microlepis, 10:193.
Laudakia nupta, 8:86; 10:193
Laudakia nuristanica, 10:193.
Laudakia pakistanica auffenbergi, 10:193.
Laudakia pakistanica khani, 10:193.
Laudakia papenfussi, 8:43.
Laudakia stellio, 9:151; 10:205.
Laudakia tuberculata, 10:193.
Laudakia wui , 8:43.
Leiolepis, 4:95.
2008
Asiatic Herpetological Research, Vol. 1 1
191
Leiolepis belliana, 10:277.
Leiolopisma tsinlingensis, 8:44.
Leiopelma, 7:73, 74, 75, 76.
Leiopelma hamiltoni , 6:168.
Lepidochelys, 10:192.
Lepidochelys olivacea, 10:192.
Lepidodactylus christiani, 9:65.
Lepidodactylus herrei, 9:65, 66.
Lepidodactylus herrei herrei , 9:65.
Lepidodactylus herrei medianus, 9:65.
Lepidodactylus lugubris, 7:159; 9:41, 48, 65; 10:252.
Lepidodactylus planicaudus, 9:49.
Leptobrachella, 7:70, 71, 72.
Leptobrachium, 7:39, 69, 70, 71, 72, 73, 74, 75, 76;
10:8, 10; 245,254, 298.
Leptobrachium gracile, 7:72.
Leptobrachium hasselti, 7:2.
Leptobrachium hasseltii, 7:1, 71, 75; 10:245.
Leptobrachium hassseltii, 10:245
Leptobrachium oshanense, 7:72.
Leptobrachium oshanensis, 7:72.
Leptobrachium pelodytoides, 7:72.
Leptobrachium smithi, 10:245.
Leptobrachium smithii, 10:245.
Leptolalax, 7:48, 49, 72; 10:8, 9, 10.
Leptolalax arayai, 10:8, 9, 10.
Leptolalax arayi, 10:10.
Leptolalax bourreti, 7:49.
Leptolalax dringi , 7:48, 49; 10:8, 9, 10.
Leptolalax gracilis, 7:49; 10:8, 9, 10, 254.
Leptolalax hamaidi , 10:9.
Leptolalax hamidi, 10:8, 10.
Leptolalax heteropus, 7:49; 10:8, 10.
Leptolalax kajangensis, 10:8, 9, 10, 251, 254, 258.
Leptolalax maurus, 7:49; 10:8, 9, 10.
Leptolalax marus, 10:10.
Leptolalax pelodytoides, 7:49, 69; 10:9, 10, 298.
Leptolalax pictus, 7:48, 49; 10:10.
Leptolaylax, 7:97.
Leptolaylax pelodytoides, 7:97.
Leptotyphlops, 10:195.
Leptotyphlops blandfordii, 10:195
Leptotyphlops dulcis, 6:48.
Leptotyphlops macrorhynchus , 10:195
Lepturophis, 2:22, 26, 28.
Lepturophis albofuscus, 10:253, 275, 277.
Leucocephalon, 10:120, 122.
Leucocephalon yuwonoi, 10:75, 106, 107.
Limnonectes, 6:86, 93.
Limnonectes blythii, 10:251, 255, 277.
Limnonectes doriae, 6:88, 90, 92, 93, 96.
Limnonectes hascheanus, 10:251, 256.
Limnonectes kuhlii, 6:90, 93, 96.
Limnonectes laticeps, 7:1, 2.
Limnonectes cf. leytensis, 9:39, 40, 59, 64.
Limnonectes limnocharis, 7:1, 2, 87, 88, 89, 90.
Limnonectes macrodon, 7:1, 4, 45.
Limnonectes malesianus, 7:4.
Limnonectes pileata, 6:93.
Limnonectes pileatus, 6:90, 96.
Limnonectes visayanus, 9:40, 43, 59.
Lindholmemys, 10:55, 66, 67, 68, 69, 71.
Liopeltis nicobariensis, 8:22.
Liopeltis tricolor, 10:253, 275.
Lipinia, 7:23, 24, 25.
Lipinia auriculata auriculata, 9:65.
Lipinia leptosoma, 7:25.
Lipinia macrotympanum, 7:23, 24, 25, 26.
Lipinia miotis, 7:25.
Lipinia noctua, 7:23, 25.
Lipinia pulchella, 7:25.
Lipinia pulchella taylori, 9:41, 50, 64.
Lipinia quadrivittata , 7:25.
Lipinia quadrivittata quadrivittata, 9:65.
Lipinia rabori, 9:65.
Lipinia rouxi, 7:25.
Lipinia semperi, 5:91, 93; 7:25.
Lipinia subvittata, 7:25.
Lipinia surda, 10:252.
Lipinia vittigera, 7:23, 25; 10:252, 263, 272.
Lissemys, 10:49, 192
Lissemys punctata, 3:126, 128; 4:32; 6:179.
Lissemys punctata andersoni, 3:127, 10:192
Lithobates, 6:86.
Liua, 3:40, 43; 4:148, 154; 10:288, 301.
Liuashihi, 4:146, 148, 149, 150, 151; 10:301, 302.
Liua shihii, 4:154, 155.
Liurana, 6:86.
Loxocemus, 4:37.
Luperosaurus, 9:65.
Luperosaurus cumingi, 9:65, 66.
Lycodon, 2:22, 23, 26; 10:196.
Lycodon aulicus, 2:23; 6:173, 178.
Lycodon aulicus aulicus, 10:196.
Lycodon aulicus capucinus, 9:42, 53, 63.
Lycodon effraenis , 10:277.
Lycodon rufozonatus, 1 :29.
Lycodon striatus , 5: 1 34, 135; 10:1 96.
Lycodon striatus bicolor , 5:130; 10:196.
Lycodon striatus striatus, 10:196.
Lycodon travancoricus , 10:196.
Lycophidion, 2:22, 23, 26, 27, 28.
Lygodactylus , 7:159.
Lygosoma, 2:25; 10:195.
Lygosoma bowringii, 10:252, 272.
Lygosoma lineolata, 8:21.
Lygosoma punctata, 10:195.
Lyriocephalus, 4:95.
192
Asiatic Herpetological Research, Vol. 1 1
2008
Lythorhyn chus, 10:196.
Lythorhynchus maynardi, 10:196.
Lythorhynchus paradoxus , 10:196.
Lythorhynchus ridgewayi, 5:130, 132, 133, 134; 7:134;
10:196.
Lytorhynch us ridgewayi, 5:133, 135.
Mm
Mabouya jerdoniana, 8:21.
Mabuya , 4:23, 29; 5:90, 96, 97; 6:177; 10:195.
Mabuya aurata, 5:6, 132, 133, 134; 10:233.
Mabuya aurata septemtaeniata , 5:130.
Mabuya dissimilis, 4:29; 6:173, 177; 10:195.
Mabuya indeprensa, 9:41, 50.
Mabuya macularia , 6:173, 177; 10:195.
Mabuya macularis , 6:177.
Mabuya multicarinata, 5:97.
Mabuya multicarinata borealis, 9:41, 50, 62, 64.
Mabuya multicarinata multicarinata, 5:91, 92, 93.
Mabuya multifasciata, 9:41, 50, 55.
Mabuya quadratilobus, 4:27, 28, 29, 33.
Mabuya quadratolobus , 4:27, 28.
Mabuya rugifera, 8:21.
Mabuya vittata, 10:205.
Macrocalamus tweediei, 10:14.
Macrochelodina siebenrocki, 10:107.
Macrochelys temminckii, 10:65, 107.
Macroclemys temminckii, 10:107, 126.
Macropisthodon rudis, 2:53.
Macropisthodon rudis multiprefrontalis , 8:45.
Macroprotodon, 2:22, 23, 26.
Macrovipera, 10:197.
Macrovipera lebetina , 7:6.
Macrovipera lebetina cernovi, 7:6.
Macrovipera lebetina obtusa, 7:6; 10:197.
Macrovipera lebetina turanica, 7:6.
Malaclemys, 10:55, 75.
Malaclemys barbouri, 10:106.
Malaclemys flavimaculata, 10:106.
Malaclemys geographica, 10: 106.
Malaclemys nigrinoda, 10:106.
Malaclemys oculifera, 10:106.
Malaclemys pseudogeographica, 10:107.
Malaclemys pulchra, 10:107.
Malaclemys terrapin, 10:58, 61, 63, 67, 99, 105, 107,
109.
Malaclemys versa, 10:107.
Malacochersus tornieri, 10:69, 70, 96, 105, 107, 109.
Malayemys subtrijuga, 10:58, 59, 62, 63, 65, 68, 74, 75,
76, 79, 80, 84, 86, 89, 105, 107, 109, 127, 134, 135, 141,
145.
Manouria, 10:70.
Manouria emys, 10:55, 62, 64, 66, 68, 91, 105, 106, 108.
Manouria forsteni, 10:106.
Manouria impressa, 2:65; 10:55, 62, 66, 68, 97, 105,
106, 127, 135, 143, 147.
Masticophis spinalis, 1:26.
Maticora intestinalis philippina, 5:99.
Mauremys, 9:71, 73, 74; 10:28, 29, 30, 31, 32, 33, 34,
75, 120, 122.
Mauremys annamensis, 10:28, 29, 31, 32, 33, 37, 106,
110, 111, 112, 122, 123.
Mauremys caspica, 5:129, 133; 10:28, 29, 31, 32, 33, 37,
60, 67, 68, 105, 106, 108.
Mauremys “guangxiensis ” ( Clemmys guangxiensis),
9:71.
Mauremys iversoni, 9:71, 72, 73, 74, 75; 10:29, 31, 32,
33, 37, 122, 123.
Mauremys japonica, 10:28, 29, 30, 31, 32, 37, 67, 68,
73, 105, 106, 122, 123.
Mauremys leprosa, 10:28, 29, 31, 32, 33, 37, 67, 105,
106.
Mauremys megalocephala, 10:29.
Mauremys mutica, 2:66; 9:71, 72, 73, 74; 10:28, 29, 31,
32, 33, 37, 65, 105, 106, 110, 111, 112, 122, 123, 126,
127.
Mauremys nigricans, 10:28, 29, 30, 31, 32, 37.
Mauremys pritchardi, 9:74; 10:29, 122, 123.
Mauremys reevesii, 10:28, 29, 30, 31, 32, 37.
Mauremys rivulata, 10:28, 29, 31, 32, 33, 37.
Mauremys sinensis, 10:28, 29, 30, 31, 32, 37.
Medio dactylus, 8:62; 10:194, 213.
Mediodactylus heterocercus , 9:151.
Megalobatrachus japonicus, 7:46.
Megalochelys dussumieri, 10:106.
Megalochilus, 4:80, 81, 83.
Megalophrys, 7:70.
Megalophrys hasseltii, 10:245.
Megophrys , 2:37; 6:167, 169, 170; 7:68, 69, 70, 71, 72,
73, 74, 75, 93, 94, 96, 97, 98, 99; 10:300.
Megophrys aceras, 7:73, 74, 75, 76, 98.
Megophrys baluensis, 7:98.
Megophrys boettgeri, 7:95, 96, 97, 98.
Megophrys brachykolos , 7:84, 98, 99.
Megophrys carinensis, 7:105.
Megophrys daweimontis, 7:93, 94, 95, 96, 97, 98, 99,
101.
Megophrys feae, 7:97, 103, 105.
Megophrys giganticus, 7:93, 94, 95, 96, 97, 98, 101.
Megophrys intermedius, 7:105.
Megophrys jingdongensis, 7:95.
Megophrys kempii, 7:98.
Megophrys kuatunensis, 7:93, 94, 95, 97, 98, 101.
Megophrys lateralis, 2:37, 42, 43, 44; 6:169; 7:70, 93,
94, 95,96, 97, 98, 101.
Megophrys longipes, 7:99.
Megophrys minor, 6:167, 168, 169, 170; 7:93, 94, 95,
2008
Asiatic Herpetological Research, Vol. 1 1
193
97, 98, 101.
Megophrys montana, 7:69, 70, 73, 74, 75, 76, 93, 96, 97,
98.
Megophrys monticola, 7:96, 97, 98.
Megophrys nankianensis , 7:98.
Megophrys nasuta, 6:170; 7:93, 96, 97, 98; 10:10, 251.
Megophrys omeimontis, 2:37, 38, 40, 41, 42, 43, 44;
6:169, 170; 7:93, 94, 95, 96, 97, 98, 101; 10:298.
Megophrys omeimotis, 6:169.
Megophrys palpebralespinosa , 7:93, 94, 95, 96, 97, 98,
101.
Megophrys parva, 7:93, 94, 95, 96, 97, 98, 99, 101.
Megophrys robusta, 7:98.
Megophrys shapingensis , 7:70, 95, 96, 97.
Mehelya, 2:22, 23, 26, 28.
Melanochelys, 3:52, 53.
Melanochelys tricarinata, 4:32; 6:173; 10:55, 107.
Melanochelys trijuga, 3:52, 53; 4:32; 6:173, 176; 10:57,
61, 65, 68, 75, 106, 107.
Melanochelys trijuga coronata, 3:52, 53.
Melanochelys trijuga indopeninsularis, 3:52.
Melanochelys trijuga trijuga , 3:52, 53.
Meristogenys, 6:86.
Meroles suborbitalis, 7:159.
Mertensiella, 5:162.
Mertensiella aff. caucasica, 5:162.
Mertensiella caucasica, 3:68, 69, 73; 4:123, 124, 129,
Plate 1; 5:147, 148, 149, 150, 151, 152, 153, 154, 155,
156, 157, 158, 159, 160, 161, 162, 163; 6:118.
Mertensiella caucasica djanashvilii, 5:157.
Mertensiella luschani, 5:157, 162, 163; 10:164, 165,
166, 167.
Mertensiella luschani antalyana, 10:164.
Mertensiella luschani atifi, 10:164.
Mertensiella luschani basoglui, 10:164.
Mertensiella luschani billae, 10:164.
Mertensiella luschani fazilae, 10:164.
Mertensiella luschani finikensis, 10:164.
Mertensiella luschani flavimembris, 10:164, 166.
Mertensiella luschani helverseni, 10:164, 166.
Mertensiella luschani luschani , 10:164.
Mesalina , 9:107, 111; 10:194.
Mesalina brevirostris, 10:194.
Mesalina guttulata, 5:132, 133, 134.
Mesalina guttulata wotsonana, 5: 130.
Mesalina watsonana, 10:194.
Mesoclemmys gibba, 10:55, 65, 105, 107.
Micrixalus , 6:86.
Microcephalophis, 10:197.
Microcephalophis cantoris, 10:197.
Microcephalophis gracilis, 10:197.
Microhyla, 6:39, 49, 51, 52, 161, 163, 164, 166; 10.191,
300.
Microhyla achatina, 6:51-52.
Microhyla annectens, 6:49, 51.
Microhyla butleri, 6:161, 162, 163, 165, 166.
Microhyla heymonsi, 6:163, 166; 7:1, 2, 4.
Microhyla inornata, 6:163.
Microhyla mixtura, 6:163, 166.
Microhyla nornata, 6:163.
Microhyla ornata, 6:39, 40, 41, 42, 161, 162, 163, 165,
166, 178; 7:45; 9:130, 131, 132, 133, 135, 136, 137;
10:191.
Microhyla pulchra, 6:161, 162, 163, 165, 166.
Microhyla rubra , 6:39, 40, 41, 163.
Mocoa macrotympanum, 7:23.
Mocoa sacra, 4:30.
Mongolemys, 10:55, 56, 57, 59, 60, 61, 62, 63, 66, 67,
68, 69, 70, 71.
Morenia ocellata, 10:55, 56, 58, 63, 64, 68, 105, 106.
Morenia petersi, 3:127; 6:179; 10:56, 57, 61, 63, 64, 68,
70, 73, 87, 105, 107, 108.
Nn
Naja, 10:197.
Naja haja, 4:8.
Naja naja, 3:46; 5:120, 124; 6:173, 178; 7:132; 10:197.
Naja naja atra, 5:117, 118, 121, 122, 125; 8:57, 107,
108.
Naja naja kaouthia, 4:32.
Naja naja samarensis, 5:99.
Naja oxiana, 5:6, 130, 132, 133, 134, 135; 7:134;
10:197.
Naja samarensis, 5:99, 100.
Naja sumatrana, 10:254.
Nanorana, 6:69, 71, 72, 73, 75, 76, 77, 86; 10:191.
Nan or ana parked, 6:72, 77.
Nanorana pleskei, 6:69, 70, 71, 73, 74, 75, 76; 10:191.
Nanorana ventripunctata, 6:69, 70, 71, 73, 74. 75, 76.
Nasirana, 6:86.
Natrix, 2:47; 4:42, 45, 50, 51, 52; 7:166; 10:196.
Natrix auchenia, 7:166, 168, 169.
Natrix callichroma, 7:166, 168.
Natrix chrysarga, 7:166, 168.
Natrix chrysarga callichroma, 7:166.
Natrix dendrophiops , 5:99.
Natrix erythrogaster, 2:47.
Natrix himalay anus, 7:166, 168.
Natrix megalocephala , 3:69, 73, 75, 77; 4:42, 43, 44, 45,
46, 47, 48, 49, 50,51,52.
Natrix natrix, 3:12, 13, 68, 70; 4:42, 44, 46, 48, 49, 50,
51, 52; 5:133, 161; 10:184, 205.
Natrix natrix a ter, 4:50.
Natrix natrix natrix, 4:44, 52.
Natrix natrix persa, 4:42, 44, 50, 51, 52; 5:130.
Natrix natrix scutata, 4:42, 44, 45, 47, 50, 51, 52.
Natrix natrix scutatus, 4:50.
194
Asiatic Herpetological Research, Vol. 1 1
2008
Natrix optata , 8:45.
Natrix rhombifera, 2:47.
Natrix tessalata , 4:48, 51.
Natrix tesselata , 4:46, 49, 52; 5:6.
Natrix tessellata , 3:13, 68, 69, 78; 5:130, 132, 133, 134,
135; 10:196.
Natrix tigrina, 1:39.
Natrix tigrina lateralis , 1:39.
Natrix tigrina tigrina, 1:39.
Natrix vibakari, 1:38.
Natrix vibakari ruthveni, 1:38.
Natrix vibakari vibakari, 1:38.
Necturus lewisi, 10:282.
Neochelys, 10:41, 42.
Neoemys blandingii, 10:106.
Neotestudo angidata, 10:106.
Nesobia, 7:70, 71.
Nesomantis, 7:70.
Neurergus, 10:224, 227.
Neurergus crocatus, 10:224.
Neurergus kaiseri, 10:224.
Neurergus microspilotus, 10:224, 225, 226, 227, 228.
Nicoria annulata, 10:106.
Nicoria areolata, 10:106.
Nicoria rubida, 10:107.
Nidirana, 6:86.
Notochelys, 10:120, 122.
Notochelys platynota, 10:54, 56, 57, 58, 62, 65, 66, 67,
68, 69, 70, 71, 73, 75, 82, 84, 85, 90, 91, 93, 94, 98, 105,
107, 108-109.
Notochelys yuwonoi, 10:75, 107.
Notophtalmus viridescens, 5:160.
Novoeumeces, 10:195.
Novoeumeces blythianus, 10:195.
Novoeumeces indothalensis, 10:195.
Novoeumeces schneiderii zarudnyi, 10:195.
Nucras tessellata, 7:159, 160.
Nyctixalus pictus, 10:251, 256, 260.
Oo
Ocadia, 10:28, 120, 121, 122.
Ocadia glyphistoma, 9:74; 10:29, 120, 122.
Ocadia philippeni, 10:120, 122.
Ocadia phillipeni, 9:74-75; 10:29.
Ocadia sinensis, 2:66; 9:72; 10:37, 61, 64, 65, 68, 75,
105, 107, 109, 120, 121, 122, 123, 126.
Occidozyga, 1:7, 9, 10; 6:86.
Occidozyga laevis, 1:7, 9, 10, 11, Plate 1 (Figures A, B,
C, E, F); 6:120; 9:40, 43,55, 59.
Occidozyga laevis mar tens i, 1:7, 10.
Occidozyga lima, 1:7, 8, 9, 10.
Occidozyga martensi, 1:7, 8, 9, 10, 11, Plate I (Figures
D and G).
Odorrana, 6:86, 92, 93, 94.
Odorrana andersoni, 6:90, 91, 92, 96.
Oedura, 7:159.
Oedura ocellata, 7:159.
Oligodon, 4:32; 6:178; 10:12, 15, 196, 275.
Oligodon annulifer, 10:12, 15.
Oligodon arnensis, 6:173, 178; 10:196.
Oligodon bitorquatus, 10:15.
Oligodon booliati, 10:12, 13, 14, 15, 253, 275.
Oligodon cinereus, 10:12, 15.
Oligodon everetti, 10:12, 15.
Oligodon maculatus, 5:98.
Oligodon modestum, 9:42, 53, 64.
Oligodon mulizonatum, 8:45.
Oligodon octolineatus, 10:12, 15.
Oligodon purpurascens, 10:12, 15, 253, 267, 275.
Oligodon signatus, 10:12, 15, 275.
Oligodon subcarinatus, 10:12, 15.
Ologodon taeniatus, 10:15.
Oligodon taeniolatus, 5:130, 134, 135; 10:196.
Oligodon vertebralis, 10:12, 15.
Omanosaura, 9:111.
Ombrana, 6:86.
Ommateremias , 9:111.
Onychodactylus, 3:40, 42, 43; 4:152; 6:59; 10:287, 288.
Onychodactylus fischeri, 4:149, 153; 6:53, 54, 55, 56,
57, 58, 59, 60; 6:114, 115, 116, 117, 118; 10:282, 283,
284, 285, 286, 287.
Onychodactylus japonicus, 4:125, 147, 149, 153; 6:59,
60; 10:284, 285, 286.
Ooeidozyga, 10:300.
Opheodrys aestivus, 4:66.
Ophiomorus, 10:195.
Ophiomorus blandfordi, 10:195.
Ophiomorus brevipes, 10:195.
Ophiomorus chernovi, 5:130, 131.
Ophiomorus punctatissimus, 10:233.
Ophiomorus raithmai, 10:195.
Ophiomorus tridactylus, 10:195.
Ophiophagus hannah, 4:32; 5:117, 118, 120, 121, 122,
124, 125; 5:143; 6:173; 8:107, 108; 9:65; 10:254, 276.
Ophisaurus, 4:79.
Ophisaurus buetticoferi, 4:16.
Ophisaurus gracilis, 2:25.
Ophisaurus hard, 5:103.
Ophisaurus sokolovi, 4:8, 16.
Ophisops, 9:111; 10:194.
Ophisops elegans, 10:194.
Ophisops jerdonii, 10:194.
Ophites gammiei, 8:24.
Opbyophryne, 7:71, 72, 93, 96, 97, 98, 99.
Ophryophryne microstoma, 7:93, 94, 95, 96, 97, 98, 101.
Ophryophryne pachyprocta, 7:93, 94, 95, 96, 97, 98.
Ophryophryne poilani, 7:97, 98.
2008
Asiatic Herpetological Research, Vol. 1 1
195
Opisthotropis guangxiensis, 8:45.
Oreolalax, 2:37; 6:167, 169, 170; 7:32, 34, 35, 36, 38,
41,69, 73,97; 10:298, 300.
Oreolalax chuanbeiensis, 7:32, 38, 39, 40, 41, 43.
Oreolalax granulosus, 7:32, 38, 39, 40, 41, 43.
Oreolalax jingdongensis, 7:32, 38, 39, 40, 41, 43.
Oreolalax liangbeiensis , 7:32, 38, 39, 40, 41, 42, 43;
10:298.
Oreolalax lichuanensis , 7:32, 38, 39, 40, 41, 42, 43.
Oreolalax major, 6:167, 168, 169, 170; 7:32, 38, 39, 40,
41.42, 43.
Oreolalax multipunctatus, 7:38, 39, 40.
Oreolalax omeimontis, 2:42; 6:169, 170; 7:32, 38, 39,
40.41.42, 43.
Oreolalax pingii, 2:42, 43; 3:116, 118; 6:169, 170; 7:32,
38, 39, 40,41,43.
Oreolalax popei, 2:43; 6:169; 7:32, 38, 39, 40, 41, 42,
43.
Oreolalax puxiongensis, 7:32, 38, 39, 40, 41, 42, 43.
Oreolalax rhodostigmatus, 7:32, 38, 39, 40, 41, 42, 43.
Oreolalax rugosa, 2:42, 43; 6:169, 170.
Oreolalax rugosus, 7:32, 38, 39, 40, 41, 43.
Oreolalax schmidti, 2:37, 38, 39, 40, 42, 43, 44; 6:169,
170; 7:32, 38, 39, 40, 41, 42, 43; 10:298.
Oreolalax xiangchengensis, 7:38, 39, 40, 41, 43.
Oreolalax xiangchensis, 7:32.
Oreophryne jeffersoniana, 2:25.
Orlitia, 10:55.
Orlitia borneensis, 10:63, 67, 68, 70, 73, 74, 75, 105,
106, 108, 127.
O to crypt is , 4:95.
Otophryne, 9:137.
Otophryne robusta, 9:136.
Ovophis, 8:22.
Ovophis convictus, 8:22.
Ovophis monticola monticola, 7:172.
Ovophis monticola orientalis, 7:172.
Ovophis monticola zhaokentangi, 7:170, 172; 8:47.
Ovophis zayuensis, 8:47.
Oxyrhabdion leporinum visayanum, 9:65.
Oxyrhabdium modestum, 5:98.
Pp
Paa, 6:86; 10: 192.
Paa barmoachensis, 10:192.
Paa hazarensis, 10:192.
Paa sternosignata, 1 0: 1 92.
Paa vicina, 10:192.
Pachyhynobius, 3:40; 4:149; 10:288, 301.
Pachvhynobius shangchengensis, 4:146, 149, 150, 151,
153, 154, 155; 10:301,302.
Pachypalaminus, 3:40, 41, 43.
P achy triton, 4:150; 10:302.
Pachytriton brevies, 4:150.
Pachytriton brevipes, 4:148, 155, 156; 10:302.
Pachytriton brevips, 10:302.
Pachytriton labiatum, 4:146, 150, 152, 154, 155;
10:302.
Palea steindachneri, 10:126, 127.
Palmatorappia, 6:86.
Pangshura smith 'd, 10:67, 107.
Pangshura sylhetensis, 10: 1 07.
Pangshura tecta, 10:65, 67, 68, 105, 107.
Pangshura tentoria , 10:61, 63, 64, 65, 67, 68, 70, 83, 88,
91, 105, 107, 109.
Panophrys, 7:98.
Panophrys daweimontis, 7:98.
Panophrys omeimontis, 7:98, 99.
Panophrys palpebralespinosa, 7:98, 99.
Pantherana, 6:86.
Papurana, 6:86.
Paradactylodon, 10:168, 190, 288.
Paradactylodon gorganensis, 10:284, 285.
Paradactylodon mustersi, 10:284, 285.
Paramesotriton, 2:15; 4:151; 10:302.
Paramesotriton caudopunctatus, 2:17.
Paramesotriton chinensis, 4:146, 151, 152, 154, 155;
10:302.
Paramesotriton fuzhongensis, 2:15, 16, 17, 18, 19.
Paramesotriton guangxiensis, 2:15, 17, 18, 19.
Paramesotriton hongkongensis, 4:151.
P areas, 10:280.
P areas boulengeri, 10:281.
Pareas carinatus, 10:281.
Pareas chinensis, 10:280.
Pareas formosensis, 10:280, 281.
Pareas hamptoni, 10:280, 281.
Pareas komaii, 10:280.
Pareas macularius, 10:280.
Pareas margaritophorus, 4:8; 10:280.
Pareas monticola, 10:281.
Pareas stanleyi, 10:280, 281.
Pareas vertebralis, 10:253, 275, 276.
Pareremias, 9:111.
Parvoscincus sisoni, 9:41, 50, 64.
Parvoscincus palawanensis, 9:50.
Pedioplanis lineocelata , 2:11.
Pedioplanis namaquensis, 2:11.
Pelamis, 10:197.
Pelamis platurus, 1:22, 43, 49, 59; 10:197.
Pelamydrus platurus, 1:43.
Pelias, 3:1, 25.
Pelias chersea, 3:13.
Pelobates, 7:70, 73, 74.
Pelobates cul tripes, 7:73, 74, 76.
Pelobates fuscus, 7:73, 74, 76.
Pelobates syriacus, 7:73, 74, 76; 9:139, 140, 141.
196
Asiatic Herpetological Research, Vol. 1 1
2008
Pelobates syriacus balcanicus, 9:139.
Pelobates syriacus boettgeri, 9:139.
Pelobates syriacus syriacus , 9:139.
Pelobates syriacus transcaucasicus, 9:139.
Pelobates varaldii , 7:73, 74, 76.
Pelobates veraldii , 7:74.
Pelobatrachus , 7:70.
Pelochelys, 10:48.
Pelochelys bibroni, 3:127; 10:127.
Pelochelys cantorii , 10:135, 144, 147, 148.
Pelodaytes punctatus, 7:76.
Pelodicus sinensis, 10:127.
Pelodiscus, 8:81; 10:48.
Pelodiscus sinensis, 8:75, 76, 77, 78, 79, 81; 10:126,
127.
Pelodytes, 7:69, 70, 73, 74.
Pelodytes caucasicus, 3:12, 19, 68, 69, 72, 74, 77; 4:48,
49; 5:43, 74, 76, 77, 78, 79, 80, 81, 82, 83, 163.
Pelomedusa subrufa, 10:55, 65, 105, 107, 116.
Pelophryne, 7:49.
Pelophryne brevipes, 10:251.
Pelophylax, 6:86.
Peltocephalus dumerilianus , 10:59, 107.
Petropedetes, 6:94.
Philautus, 1:15; 2:35; 6:37; 7:49; 10:17, 20, 300.
Philautus abditus, 10:19.
Philautus albopunctatus, 10:19.
Philautus banaensis, 10:19.
Philautus carinensis, 10:19.
Philautus doriae, 1:12, 13, 14, 15, Plate II (Figures A-
F); 2:33, 35.
Philautus gracilipes, 10:19.
Philautus gryllus, 10:19.
Philautus ( Platymantis ) hazelae, 9:44.
Philautus jinxiuensis, 10:19.
Philautus longchuanensis, 10:19.
Philautus maosonensis, 10:19.
Philautus menglaensis, 10:19.
Philautus ocellatus, 10:19.
Philautus odontotarsus, 10:19.
Philautus parvulus, 10:19.
Philautus petersi, 10:251, 276.
Philautus petilus, 10:17, 18, 19, 20.
Philautus rhododiscus, 10:19.
Philautus romeri, 7:84.
Phoxophrys , 4:95.
Phrynocephalus, 2:10, 13; 4:76, 78, 79, 80, 81, 83, 89,
90, 91, 93, 94, 95, 96; 5:53, 55, 59, 65, 66, 67, 68, 69,
70,71,72, 105, 106; 7:170; 9:118; 10:193.
Phrynocephalus acutirostris, 5:57.
Phrynocephalus affinis, 5:65.
Phrynocephalus alpheraki, 5:53.
Phrynocephalus alpherakii, 4:89.
Phrynocephalus axillaris, 2:6, 7, 8, 10, 11, 12; 5:57;
7:157.
Phrynocephalus clarkorum, 10:193.
Phrynocephalus euptilopus, 10:193.
Phrynocephalus frontalis, 5:56, 65, 69, 70, 71, 72.
Phrynocephalus gutatus alpherakii, 5:54.
Phrynocephalus guttatus, 4:79, 80, 81, 82, 83, 89, 90,
93, 94; 5:56, 57, 59, 60, 61, 62, 63, 64, 105, 106, 107.
Phrynocephalus guttatus alpherakii, 5:51, 57, 59, 60,
63, 105, 106, 107.
Phrynocephalus guttatus guttatus, 4:87, 96; 5:59, 60,
63, 64, 105, 107.
Phrynocephalus guttatus kuschakevitschi, 4:93.
Phrynocephalus guttatus kuschakewichi, 4:87, 96.
Phrynocephalus guttatus kushackevitschi, 5:63.
Phrynocephalus guttatus kushackewitschii, 5:59, 60, 61,
63, 64, 105, 106, 107.
Phrynocephalus guttatus kushakewichi, 4:91.
Phrynocephalus guttatus moltschanovi, 5:59, 60, 63, 64,
105, 106, 107.
Phrynocephalus guttatus moltschanovii, 5:59, 63.
Phrynocephalus guttatus salenskyi, 5:51, 57, 59, 60, 61,
63, 64, 105, 106, 107.
Phrynocephalus helioscopus, 4:82, 92, 95-96; 5:53,
132, 133, 134.
Phrynocephalus helioscopus helioscopus, 4:87, 96;
5:129.
Phrynocephalus helioscopus persicus, 4:82, 87, 96.
Phrynocephalus helioscopus saidalievi, 5:60, 61, 63, 64.
Phrynocephalus hongyuanensis, 8:44.
Phrynocephalus interscapularis, 4:83, 85, 88, 92, 93,
94, 95, 96; 5:129, 132, 133, 134.
Phrynocephalus interscapularis sogdianus, 4:92.
Phrynocephalus langwalaensis, 4:78.
Phrynocephalus laungwalaensis, 4:95.
Phrynocephalus luteoguttatus , 10:193.
Phrynocephalus maculatus, 4:79, 80, 81, 86, 96; 5:129,
131; 10:193
Phrynocephalus melanurus, 4:88, 89, 90, 96; 5:59.
Phrynocephalus moltschanovi, 4:82, 90; 5:59.
Phrynocephalus moltschanowi, 4:87, 89, 96.
Phrynocephalus mystaceus, 4:83, 84-85, 89, 92, 93, 94,
95, 96; 5:132, 133, 134; 7:160.
Phrynocephalus mystaceus galli, 4:83, 88.
Phrynocephalus mystaceus mystaceus, 4:84, 88.
Phrynocephalus ornatus, 10:193.
Phrynocephalus persicus, 4:82.
Phrynocephalus przewalskii, 2:4, 11; 5:65, 69, 70, 71,
72.
Phrynocephalus raddei, 4:79, 80, 85, 90, 91, 93; 5:132.
133, 134.
Phrynocephalus raddei boettgeri, 4:86, 91, 96; 5:129.
Phrynocephalus raddei raddei, 4:86, 91, 96; 5:129.
Phrynocephalus reticulatus, 4:81, 82, 89; 5:129, 132
134,
2008
Asiatic Herpetological Research, Vol. 1 1
197
Phrynocephalus reticulatus bannikovi , 5:129.
Phrynocephalus reticulatus bannikowi , 4:86, 96.
Phrynocephalus reticulatus reticulatus , 4:86, 96.
Phrynocephalus rossicovi, 5:131.
Phrynocephalus rossikowi , 4:81, 82, 91, 92, 93.
Phrynocephalus rossikowi rossikowi , 4:86, 96; 5:129.
Phrynocephalus rossikowi schammakowi, 4:86.
Phrynocephalus rossikowi shammakovi , 4:91-92.
Phrynocephalus rossikowi shammakowi, 4:96; 5:129.
Phrynocephalus salenskyi, 4:89; 5:53, 56, 57, 59.
Phrynocephalus scutellatus, 10:193.
Phrynocephalus sogdianus, 4:88, 92, 93, 96.
Phrynocephalus strauchi , 4:87, 89, 96; 5:53, 60, 61, 63,
64.
Phrynocephalus theobaldi, 3:112; 8:65.
Phrynocephalus versicolor , 4:82, 89, 90, 96, 100, 105,
106, 108, 109; 5:51, 52, 53, 54, 55, 56, 57, 59, 61, 62,
63, 65, 69, 70, 71, 72, 105, 106, 107; 9:113, 114, 116,
117, 118, 119, 120.
Phrynocephalus versicolor bogdanowi, 5:105, 106.
Phrynocephalus versicolor doriai, 5:51, 53, 54, 57.
Phrynocephalus versicolor hispida, 5:51, 53, 54, 55, 56,
59, 60, 61, 63, 64, 105, 106, 107.
Phrynocephalus versicolor kulagini, 4:76, 87; 5:53, 54,
57, 59.
Phrynocephalus versicolor paraskii, 5:59, 60.
Phrynocephalus versicolor paraskiivi, 4:87.
Phrynocephalus versicolor paraskivi, 4:89, 90; 5:64.
Phrynocephalus versicolor par askiwi, 5:53, 54, 105.
Phrynocephalus versicolor parasskiwii, 4:96.
Phrynocephalus versicolor versicolor, 5:54, 57, 60, 63,
64.
Phrynocephalus vlangalii, 4:78; 5:65.
Phrynocephalus vlangalii hongyuanensis, 8:44.
Phrynocephalus zetangensis, 8:44.
Phrynoglossus, 6:86.
Phrynoglossus laevis, 6:90, 93, 96; 7:45.
Phrynoglossus martensi, 1:8.
Phrynops gibba, 1 0: 1 07.
Phrynosoma platyrhinos, 2:11.
Physignathus, 4:95.
Pituophis melanoleucus, 7:134.
Plagiopholis unipostocularis , 8:46.
Platyceps rhodorachis kashmirensis, 10:196.
Platyceps rhodorachis ladacensis, 10:196
Platyceps rhodorachis rhodorachis , 10:196
Platyceps ventromaculatus bengalensis, 10:196
Platyceps ventromaculatus indusai, 10: 196
Platyceps ventromaculatus ventromaculatus , 10:196
Platymantis, 6:86; 9:40, 44, 64; 10:256.
Platymantis corrugatus, 6:90, 96; 9:40, 43, 55, 59.
Platymantis dorsalis, 9:40, 43, 55.
Platymantis guentheri, 9:44.
Platymantis hazelae, 9:44, 65.
Platymantis insulatus, 9:40, 44, 58, 59, 66.
Platymantis luzonensis, 9:44.
Platymantis negrosensis, 9:40, 44.
Platymantis panayensis, 9:40, 64, 65.
Platymantis pseudodorsalis, 9:44.
Platymantis pygmaeus, 9:44.
Platymantis spelaeus, 9:65, 66.
Platysternon, 10:75, 127.
Platysternon megacephalum, 2:67; 10:55, 59, 107, 127,
130, 134, 136.
Platyurus platyurus, 4:27, 33.
Plethodon vehiculum, 10:287.
Pleurodeles waltl, 10:283.
Podarchis, 3:77.
Podarchis muralis, 8:57.
Podarcis sicula, 7:155.
Podocnemis dumerilianus , 10:107.
Podocnemis madagascariensis, 10:107.
Poecilia shenops melanistica, 6:168.
Polydontophis grahami, 1:4.
Polypedates, 2:35; 5:11, 12; 6:36; 7:80, 82; 10:300.
Polypedates chenfui, 2:35.
Polypedates cruciger, 6:36, 37.
Polypedates dennysi, 2:35.
Polypedates Hascheanus, 8:21.
Polypedates leucomystax, 2:35; 5:11; 6:36; 7:45; 9:40,
45, 60; 10:251, 256.
Polypedates maculatus, 6:36, 39, 40, 41, 173.
Polypedates megacehalus, 5:11, 12.
Polypedates megacephalus, 7:80, 81, 82
Polypedates prasinatus, 5:11, 12.
Praescutata, 10:197.
Praescutata viperina, 10:197.
Pristurus, 7:160.
Pristurus celerrimus, 7:160.
Proacris mintoni, 9:155.
Protestudo, 4:79.
Protohynobius , 10:288.
Protohynobius puxiongensis, 10:288.
Proviper a boettgeri, 3:28.
Psammobates geometricus, 10:71, 105, 106.
Psammobates oculifera, 10:54, 71, 105, 106, 108.
Psammobates ten tori us, 10:105, 107.
Psammodynastes, 2:21, 23, 28.
Psammodynastes pictus , 2:22.
Psammodynastes pulverulentus , 2:21, 22, 23, 24, 25, 26,
27, 28; 5:98; 9:42, 53, 55; 10:253, 275, 276.
Psammodynastes pulverulentus papenfussi, 7:170, 171.
Psammodynastes pulverulentus pulverulentus , 7:171.
Psammophis, 2:22, 23, 26, 28; 10:196.
Psammophis condanarus, 6:173; 10:196.
Psammophis leithii leithii, 10:196.
Psammophis lineolatum, 5:6, 130, 132, 133, 134, 135;
8:73.
198
Asiatic Herpetological Research, Vol. 1 1
2008
Psammophis lineolatus , 2:4, 6, 10, 12; 4:100; 7:157.
Psammophis lineolatus lineolatus, 10:196.
Psammophis schokari, 5:134, 135.
Psammophis schokari schokari, 5:130; 10:196.
Psdudohemisus, 9:137.
Psedohemisus granulosa, 9:136.
Pseudanosteira, 10:45.
Pseudemys, 10:55, 57, 64, 75.
Pseudemys adiutrix, 10:106.
Pseudemys alabamensis, 10:58, 59, 64, 105, 106.
Pseudemys callirostris, 10:106.
Pseudemys concinna, 10:106.
Pseudemys decorata, 10:106.
Pseudemys decussata, 10:106.
Pseudemys dorbigni, 10:106.
Pseudemys emolli, 10:106.
Pseudemys floridana, 10:106.
Pseudemys gaigeae, 10:106.
Pseudemys nebulosa, 10:106.
Pseudemys nelsoni, 10:54, 58, 59, 64, 105, 106.
Pseudemys ornata, 10:54, 107.
Pseudemys rubriventris, 10:58, 61, 63, 64, 105, 107.
Pseudemys scripta, 10:58, 63, 64, 105, 107, 109.
Pseudemys stejnegeri, 10:107.
Pseudemys taylori, 10:107.
Pseudemys terrapen, 10:107.
Pseudemys texana, 10:58, 59, 61, 63, 64, 73, 77, 78, 79,
80, 81, 84, 86, 87, 97, 98, 105, 107, 109.
Pseudemys venusta, 10:107.
Pseudemys yaquia, 10:107.
Pseudoacris triseriata, 8:50, 51.
Pseudocerastes, 10:197.
Pseudocerastes bicornis, 10:197
Pseudocerastes persicus, 10:197.
Pseudocyclophis, 10: 1 96.
Pseudocyclophis persicus, 5:134, 135, 10:196.
Pseudocyclophis persicus persicus, 5:130.
Pseudogekko brevipes, 9:65.
Pseudogekko compressicorpus , 9:65.
Pseudohynobius, 10:288.
Pseudophus apodus, 5:134.
Pseudopus apodus, 3:13, 68, 69, 78; 5:6, 134, 135.
Pseudopus apodus apodus, 5:129.
Pseudopus apodus tracius, 3:69.
Pseudorabdion, 8:7, 9, 10.
Pseudorabdion albonuchalis, 8:7, 8, 9, 11, 12.
Pseudorabdion ater, 8:9, 10.
Pseudorabdion collaris, 8:11.
Pseudorabdion eiselti, 8:9, 10, 11.
Pseudorabdion longiceps, 8:9.
Pseudorabdion longipes, 8:10.
Pseudorabdion mcnamarae, 8:7, 9, 11, 12; 9:42, 53, 63,
64.
Pseudorabdion montanum, 8:9, 10, 11; 9:65.
Pseudorabdion oxycephalum, 8:9, 10, 11, 12; 9:42, 53.
Pseudorabdion sarasinorum, 8:7, 8, 9, 11.
Pseudorabdion saravacensis, 8:7, 8, 9, 11.
Pseudorabdion talonuran, 8:7, 8, 9, 10, 11, 12; 9:42, 54,
64, 65.
Pseudorabdion taylori, 8:7, 8, 9, 11.
Pseudorana, 6:86.
Pseudosalamandra, 10:288.
Pseudosalamandra naevis, 10:284.
Pseudoxenodon, 2:46.
Pseudoxenodon macrops, 2:48, 49; 4:31, 33.
Pseudoxenodon macrops sinensis, 2:46, 47, 53.
Psuedotrapelus, 3:104.
Ptenopus, 7:158.
Pterorana, 6:86.
Ptyas, 10:196.
Ptyas carinatus, 10:254, 276.
Ptyas corros, 4:8.
Ptyas korros, 4:139; 8:57; 9:23.
Ptyas mucosus, 5:133; 6:173; 10:196.
Ptyas mucosus nigricans, 5:130.
Ptyas muscosus, 9:23.
Ptychogaster, 10:70.
Ptychozoon, 9:101, 103, 104, 105.
Ptychozoon horsfieldii, 9:101.
Ptychozoon intermedium, 9:101, 105.
Ptychozoon kuhli, 9:101, 103; 10:252, 271, 274.
Ptychozoon lionotum, 9:101, 102, 103, 104, 105.
Ptychozoon rhacophorus, 9:101.
Ptychozoon trinotaterra, 9:101.
Ptyctolaemus, 4:95.
Ptyctolaemus gularis, 2:25; 4:32.
Ptyodactylus, 10:194.
Ptyodactylus guttatus, 7:158.
Ptyodactylus hasselquistii, 10:176, 177, 178, 179.
Ptyodactylus homolepis, 8:23; 10:194.
Pulchrana, 6:86.
Python, 10:195.
Python molurus, 4:8, 30; 6:173; 10:195.
Python molurus bivittatus, 5:103, 104.
Python reticulatus, 9:41, 51, 62; 10:253, 273.
Pythonodipsas, 2:23.
Pythonodipsas carinatus, 2:23, 27.
Pyxicephalus adspersus, 6:167; 10:301.
Pyxidea, 10:120, 122, 131.
Pyxidea mouhotii, 10:106, 122, 123, 127, 131.
Pyxis arachnoides, 10:105, 106.
Pyxis planicauda, 10:107.
Qq
Quasipaa, 6:86.
Quedenfeldtia trachyblepharus, 7:160.
2008
Asiatic Herpetological Research, Vol. 11
199
Rr
Ramphotyphlops, 3:65; 6:132, 141, 142, 145, 148;
10:195.
Ramphotyphlops adamsi, 6:134, 135.
Ramphotyphlops albiceps , 10:253, 264, 273.
Ramphotyphlops bergi, 6:134, 135.
Ramphotyphlops braminus , 4:30; 6:132, 148, 173; 9:42,
54, 55; 10:195, 253,273.
Ramphotyphlops cumingii , 6:141; 9:42, 54.
Ramphotyphlops depressus , 6:132, 148.
Ramphotyphlops diardi , 4:32.
Ramphotyphlops flaviventer, 6:132, 141, 148.
Ramphotyphlops infralabialis , 6:132, 133, 134, 135,
138, 139, 141.
Ramphotyphlops jerdoni, 4:32.
Ramphotyphlops keasti, 6:134, 135.
Ramphotyphlops kunuaensis , 6:134, 135, 139.
Ramphotyphlops nigrescens , 6:47.
Ramphotyphlops oligolepis, 4:32.
Ramphotyphlops olivaceus , 6:45.
Ramphotyphlops solomonis, 6:132, 133, 134, 135, 139,
141.
Ramphotyphlops subocularis, 6:132, 133, 134, 135, 136,
138, 139, 141, 148.
Ramphotyphlops suluensis, 6:45, 46, 47, 48.
Ramphotyphlops willeyi, 6:132, 141, 148.
Rana, 2:1, 71; 5:33, 34, 43; 6:85, 86, 87, 90, 91, 92, 93,
96, 121, 170; 9:130; 10:256, 300.
Rana albolabris, 6:90, 96.
Rana altaica, 4:141, 142, 143, 144, 145; 10:299, 301.
Rana amurensis, 4:68, 69, 70, 71, 72; 6:120; 10:299,
301.
Rana amurensis coreana, 10:299.
Rana andersoni, 6:90, 91, 92, 96.
Rana andersonii, 5:45, 46, 47, 48.
Rana anlungensis, 5:45, 49.
Rana arvalis, 4:141, 143, 144, 145; 5:35; 6:120, 121,
126, 127, 129; 7:87.
Rana asiatica, 4:144.
Rana baramica , 7:1, 4.
Rana boulengeri, 9:1, 2, 3, 4.
Rana brevipoda , 8:51.
Rana cancrivora, 7:45; 8:48, 49, 50, 51.
Rana cancrivora cancrivora , 9:40.
Rana (" Fejervaiya ") cancrivora cancrivora , 9:44.
Rana catesbeiana, 3:85, 87; 4:71; 7:87; 8:50, 51.
Rana chalconota, 6:90, 92, 96; 10:251, 256.
Rana chaochiaoensis, 10:299, 301.
Rana chensinensis , 4:68, 69, 70, 71, 72, 143, 144, 145;
6:73, 74, 75, 120; 10:299, 301.
Rana clamitans, 4:71.
Rana crassa, 6:39, 40, 41, 173.
Rana cyanophlyctis, 6:39, 40, 41, 173, 175.
Rana dalmatina, 5:35; 9:151.
Rana danieli, 6:173, 175, 176, 178.
Rana doriae, 10:277.
Rana dybowskii, 4:144, 145.
Rana dyhowskii, 4:145.
Rana erythraea , 6:87, 90, 92, 96; 7:1, 4, 87; 9:40, 60;
10:251, 256.
Rana (" Hylarana") erythraea , 9:45.
Rana esculenta , 5:34, 40; 10:287, 300.
Rana cf. esculenta , 6:120.
Rana everetti, 9:45.
Rana cf everetti, 9:40.
Rana (" Chalcorana ") cf. everetti, 9:45.
Rana galamensis, 6:90, 96.
Rana glandulosa, 7:1, 4.
Rana grahami, 5:45, 49.
Rana guentheri, 3:85, 88; 7:46, 84.
Rana hexadactyla, 6:39, 40, 41.
Rana hosii, 10:10, 251, 256, 277.
Rana ishikawae, 7:45.
Rana japonica, 7:45, 46; 10:299, 300, 301.
Rana kuanguensis, 5:48.
Rana kuangwuensis, 5:45, 46, 47, 48, 49.
Rana kuhlii, 7:45.
Rana latastei, 5:35.
Rana lepus, 6:90, 96.
Rana lessonae, 10:287.
Rana cf. ley tens is, 9:43.
Rana limnocharis, 2:25; 3:87; 5:98; 6:121, 173, 176;
7:45, 46, 84; 8:48, 49, 50,51.
Rana limnochiris, 3:87.
Rana lungshengensis, 5:45, 49.
Rana macrocnemis, 3:70, 77; 4:49; 5:35, 43, 74, 76, 77,
78, 79, 80, 81, 82, 83, 163; 6:120, 121, 125, 127, 128,
129; 10:215, 216.
Rana macrodon, 7:3.
Rana malesiana, 7:1, 4.
Rana margaratae, 5:45, 46, 47, 48, 49; 10:301.
Rana microdisca, 2:25.
Rana narina, 7:45.
Rana nicobariensis , 7:1, 4; 8:21.
Rana nigromaculata, 2:1, 2, 4; 3:60, 61, 62, 63, 87, 88;
6:120, 121; 7:45, 46; 10:300.
Rana ornativentris, 4:144, 145; 7:45, 46.
Rana phrynoides, 1:12; 10:298.
Rana picturata, 10:10, 251, 256, 259.
Rana pierrei, 6:173, 176, 178.
Rana pipiens, 4:71; 7:87; 8:104.
Rana pirica, 10:299.
Rana plancyi, 6:1 1 1.
Rana ridibunda, 3:70, 78; 4:141, 142, 143; 5:43, 74, 76,
77, 78, 79, 80, 81, 82, 83, 84; 6:121, 129; 7:137, 138;
10:162, 184.
Rana rugosa, 7:45, 46.
200
Asiatic Herpetological Research, Vol. 1 1
2008
Rana rugulosa, 3:85, 87, 88, 89, 90, 91, 92, 93, 94, 95,
96, 97, 98, 99, 100; 7:45,46, 84.
Rana schmackeri , 5:45, 49.
Rana semiplicata, 6:127.
Rana septentrionalis , 7:87.
Rana shuchinae, 6:73, 74, 75.
signata, 10:256.
Rana syhadrensis, 6:173, 175, 176, 178.
Rana sylvatica, 4:71; 6:120, 121; 7:87; 8:50, 51.
Rana tagoi, 8:51.
Rana tagoi tagoi , 7:44, 45, 46.
Rana temporaria, 4:143, 144-145; 5:35; 6:120, 121,
126, 127; 8:51; 10:286, 299.
Rana temproaria chensinensis, 10:299.
Rana tenggerensis, 2:1, 2, 4.
Rana tiannanensis, 5:45, 49.
Rana tigerina, 6:173, 176.
Rana tigrina, 3:85, 87.
Rana vittigera, 9:40, 55, 60.
Rana (" Fejervarya ") vittigera , 9:45.
Rana wuchuanensis, 5:45, 49.
Ranadon sibericus, 4:149.
Ranodon, 3:40, 42, 43; 4:152; 10:169, 172, 288, 301.
Ranodon sibiricus, 5:148; 6:117; 8:29, 31, 32, 33, 34,
35, 36; 10:168, 169, 170, 171, 172, 174, 282, 283, 284,
285, 286, 287, 288.
Rhabderemias, 9:111.
Rhabdophis, 7:166, 168.
Rhabdophis adleri, 7:166, 167, 168; 8:46,
Rhabdophis auriculata auriculata, 5:98, 100.
Rhabdophis callichromus, 7:166.
Rhabdophis chrysargos, 10:254, 268, 276.
Rhabdophis chrysargus , 7:166, 168.
Rhabdophis himalayana , 4:32.
Rhabdophis nuchalis pentasupralabralis , 8:46.
Rhabdophis pentasupralabralis, 8:46.
Rhabdophis subminata, 6:179.
Rhabdophis tigrina, 1:40; 2:4.
Rhabdophis tigrina lateralis, 1:40; 2:4.
Rhabdophis tigrina tigrina, 1:40.
Rhabdophis tigrinus, 1:19, 22, 27, 38, 40, 41, 42, 52.
Rhabdophis tigrinus formosiana, 1:42.
Rhabdophis tigrinus lateralis, 1:40, 41, 42; 8:57.
Rhabdophis tigrinus multiventris, 1:42.
Rhabdophis tigrinus tigrinus, 1:41, 42.
Rhacophorus, 2:33, 35; 5:11, 12; 6:93, 94; 7:80, 82;
8:102; 10:300.
Rhacophorus appendiculatus, 9:65; 10:19.
Rhacophorus baliogaster, 10:19.
Rhacophorus bisacculus, 10:19.
Rhacophorus chenfui, 2:33, 35; 5:11.
Rhacophorus cruciger, 6:36.
Rhacophorus dennysi, 2:33, 35.
Rhacophorus gongshanensis, 2:33.
Rhacophorus leucomystax, 2:35; 6:90, 92, 93, 96; 7: 1 , 4,
80, 81, 82; 8:102, 103, 104, 105.
Rhacophorus megacephalus, 8:102, 104.
Rhacophorus moltrechti, 5:11, 12.
Rhacophorus pardalis, 9:65.
Rhacophorus prasinatus, 5:11, 12.
Rhacophorus prominanus, 7:1, 4.
Rhacophorus reinwardtii, 2:33, 34, 35.
Rhacophorus schlegelii, 8:51.
Rhacophorus smaragdinus, 5:11, 12.
Rhacophorus taipeianus, 5:11, 12.
Rhacophorus tunkui, 7:1.
Rhacophorus verrucosus, 10:19.
Rhinoclemmys, 3:53; 10:75.
Rhinoclemmys annulata, 10:57, 59, 60, 64, 73, 105, 106,
107.
Rhinoclemmys areolata, 10:64, 106.
Rhinoclemmys diademata, 10:106.
Rhinoclemmys funerea, 10:106.
Rhinoclemmys melanosterna, 10:106.
Rhinoclemmys nasuta, 10:106.
Rhinoclemmys pulcherrima, 10:57, 59, 60, 61, 68, 70,
105, 107, 109.
Rhinoclemmys punctularia, 10:62, 68, 73, 100, 105,
107.
Rhinoclemmys rubida, 10:66, 73, 105, 107.
Rhinogecko, 10:194.
Rhinogecko femoralis, 10:194.
Rhinogecko missonei, 10:194.
Rhinotyphlops , 6:141.
Riopa lineolata, 8:21.
Rugosa, 6:86.
Ss
Sacalia, 10:120, 122.
Sacalia bealei, 2:66; 3:120, 121; 10:58, 67, 70, 105, 106,
108.
Sacalia pseudocellata, 9:74, 75.
Sacalia quadriocellata, 3:120, 121; 10:107, 127, 141,
145.
Salamandra, 10:224.
Salamandra atra, 10:163.
Salamandra maculosa, 10:163.
Salamandra salamandra, 5:153, 158, 160, 162.
Salamandrella, 3:40, 43, 10:288, 301.
Salamandrella keyserlingii, 3:43; 4:68, 69, 149; 6:60,
117; 10:282, 283, 284, 285, 286, 287, 288, 301, 302.
Salamandrella keyserlingii kalinowskiana, 10:288.
Salamandrella keyserlingii tridactyla, 10:288.
Sanguirana, 6:86.
Satobius, 3:37, 40, 41, 43, 44; 10:288.
Satobius retardatus, 3:41, 42, 43, 44; 4:152; 10:284.
Scalia quadriocellata, 3:121.
2008
Asiatic Herpetological Research, Vol. 1 1
201
Scaphiodontophis, 1:1; 2:28.
Scaphiopus, 7:69, 70, 74.
Scaphiopus couchii, 7:73, 74, 76.
Scaphiopus holbrookii , 7:73, 74, 76.
Scaphiopus hurterii, 7:73, 74, 76.
Scapteria , 9:1 1 1.
Sceloporus merriami, 7:158, 161.
Scincella, 4:29; 6:177; 7:23; 10:195.
Scincella himalayana, 10:195.
Scincella huanrenensis , 8:44.
Scincella ladacensis, 8:65; 10:195.
Scincella modes ta, 7:80, 83.
Scincella reevesii, 7:83.
Scincella sikimmensis, 6:173, 177, 178.
Scincella sikkimensis, 4:29, 30, 33.
Scincella tsinlingensis , 8:44.
Scincus mitranus, 10:178, 180.
Scutiger, 6:170; 7:32, 33, 34, 35; 7:69, 70, 71, 72, 73,
97; 10:298, 300.
Scutiger adungensis, 7:32.
Scutiger boulengeri, 2:37, 42, 44; 7:33, 34, 36.
Scutiger brevipes, 7:33, 34, 36.
Scutiger chintingensis, 7:33, 34, 36.
Scutiger gongshanensis, 7:33, 34, 36.
Scutiger gongshanesis, 7:33, 34.
Scutiger liupanensis, 7:33, 34, 36.
Scutiger maculatus, 7:32.
Scutiger mammatus, 7:33, 34, 36.
Scutiger muliensis, 7:33, 34, 36.
Scutiger nepalensis, 7:32.
Scutiger ningshanensis, 7:32.
Scutiger nyingchiensis, 7:33, 34, 35, 36.
Scutiger occidentalis, 7:32.
Scutiger pingwuensis, 7:33, 34, 36.
Scutiger sikkimensis , 7:33, 34, 36.
Scutiger tuberculatus , 7:33, 34, 36.
Scutiger a, 7:71.
Sepsophis, 8:16.
Sepsophis punctatus, 8:16.
Sharemys, 10:42.
Sibynophis , 1:1, 3, 5; 10:196.
Sibynophis chinensis, 1:1, 2, 3, 5, 22, 42, 52, 59.
Sibynophis chinensis chinensis , 1:3, 4, 6.
Sibynophis chinensis grahami, 1:3, 4, 5, 6.
Sibynophis chinensis miyiensis, 1:2, 3, 4, 5; 8:46.
Sibynophis collaris, 1:1, 3, 4, 5, 42; 6:173.
Sibynophis collaris formosensis, 1:1.
Sibynophis grahami, 1:1, 2, 5.
Sibynophis hainanensis, 1 :4.
Sibynophis melanocephalus, 10:254, 268, 276.
Sibynophis Sagittarius , 10: 1 96.
Siebenrockiella crassicollis, 10:57, 59, 63, 65, 67, 68,
73, 75, 83, 84, 88, 92, 97, 105, 106, 108, 142, 146.
Sierrana, 6:86.
Sitana ponticeriana, 10:296.
Siwaligekko, 10:194.
Siwaligekko battalensis, 10:194.
Siwaligekko dattanensis, 10:194.
Siwaligekko mintoni, 10:194.
Sooglossus, 7:70.
Spalerosophis, 10:196.
Spalerosophis arenarius , 10:196.
Spalerosophis diadem , 5:132.
Spalerosophis diadema, 5:132, 133, 134, 135; 7:134.
Spalerosophis diadema atriceps, 10:196.
Spalerosophis diadema diadema, 10:196.
Spalerosophis diadema schiraziana, 5:130.
Spalerosophis schirazianus, 1 0: 1 96.
Spea, 7:69, 70, 74.
Spea bombifrons , 7:73, 74, 76.
Spea hammondii , 7:73, 74, 76.
Spea intermontana, 7:73, 74, 76.
Spea multiplicata, 7:73, 74, 76.
Sphaerotheca, 10:192.
Sphaerotheca breviceps, 10:192.
Sphenodon punctatus, 9:127; 10:219.
Sphenomorphus, 2:55; 5:90, 91, 97; 10:252, 263, 272.
Sphenomorphus acutus, 5:91, 93.
Sphenomorphus arborens, 9:41, 50.
Sphenomorphus coxi coxi, 5:91, 92, 93.
Sphenomorphus coxi divergens , 9:41, 50, 64.
Sphenomorphus cumingi, 9:41, 51, 64.
Sphenomorphus decipiens, 5:91, 92, 93.
Sphenomorphus fasciatus, 5:92; 9:64.
Sph enomorphus florensis, 2:25.
Sphenomorphus indicus, 2:25, 55, 56, 57, 59; 4:30.
Sphenomorphus jagori grandis, 9:41, 51, 62.
Sphenomorphus maculatus, 4:30, 33.
Sphenomorphus quadrivittatum , 7:23.
Sphenomorphus rufocaudatus , 4:8.
Sphenomorphus schlegeli, 2:25.
Sphenomorphus scotophilus, 10:252, 272, 277 .
Sphenomorphus steerei , 5:92, 93; 9:41, 51.
Sphenomorphus stellatus, 4:16.
Sphenomorphus variegatus, 5:92, 93.
Staurois, 6:86.
Stegonotus muelleri, 5:98.
Ste//w, 3:104, 106, 108, 110, 112, 113, 114; 4:94.
Stellio adramitana, 3:113, 114.
Stellio agrorensis, 3: 1 09, 111, 112, 113.
Stellio annectens , 3:111, 112, 113, 114.
Stellio atricollis, 3:113, 114.
Stellio badakhshanus, 3:104, 108, 110, 113.
Stellio caucasicus , 5:6.
Stellio caucasius , 3:108, 113; 5:134; 6:97, 98.
Stellio caucasius caucasius, 5:129.
Stellio caucasius triannulatus, 5:129.
Stellio chernovi, 3:104, 108, 109, 110, 111, 113; 5:129,
202
Asiatic Herpetological Research, Vol. 1 1
2008
135.
Stellio cyanogaster, 3:113, 114.
Stellio erythrogaster, 3:108, 111, 112, 113; 5:129, 134.
Stellio himalay anus, 3:104, 107, 108, 109, 110, 111, 112,
113.
Stellio himalayanus himalayanus , 3:106.
Stellio lehmanni, 3:108, 113; 5:129, 135.
Stellio melanurus, 3:109, 111, 112, 113, 114.
Stellio microlepis, 3:113.
Stellio nuptus, 3:109, 111, 112, 113, 114.
Stellio nuristanicus, 3:108, 109, 111, 113.
Stellio phillipsi, 3:114.
Stellio phillipsii, 3:113, 114.
Stellio sacra, 3:104, 105, 106, 107, 108, 109, 110, 111,
112, 113.
Stellio stellio, 3:109, 113, 114.
Stellio stoliczkana, 8:22.
Stellio stoliczkanus, 3:104, 107, 108, 109, 110, 113;
8:22.
Stellio trachypleurus, 3:113, 114.
Stellio tuberculatus, 3:109, 111, 112, 113
Stellio yemenensis, 3:113, 114.
Stellio zonorus, 3:113.
Stellio zonurus, 3: 1 14.
Stenodactylus doriae, 7:153, 160, 161, 162.
Stenodactylus orientalis, 8:23.
Stenodactylus slevini , 10:180.
Sternothaerus odoratus, 10:107.
Sternotherus odoratus, 10:55, 56, 57, 59, 60, 61, 62, 63,
65, 67, 70, 72, 105, 107.
Strongylopus, 6:86.
Stylemys, 10:42.
Sylvirana, 6:86, 90, 91, 92, 93, 96.
Tt
Tachydromus, 2:25.
Tachydromus sauteri, 2:25.
Takydromus, 2:55.
Takydromus septentrionalis, 2:55, 56, 57, 58, 59; 7:141,
147, 148, 149, 150; 8:83.
Taylorana, 6:86.
Taylorana hascheana, 8:21.
Telescopus, 10:197.
Telescopus rhinopoma, 10:197.
Telescopus rhynopoma, 5: 1 30, 131.
Tenuidactylus , 8:60; 10:151.
Tenuidactylus baturensis , 8:63, 68; 10:158.
Tenuidactylus caspius, 8:68.
Tenuidactylus chitralensis , 8:62.
Tenuidactylus fedtschenkoi, 8:68.
Tenuidactylus fortmunroi, 8:66.
Tenuidactylus indusoani, 8:66, 68.
Tenuidactylus kirmanensis, 8:62.
Tenuidactylus kohsulaimanai, 8:60.
Tenuidactylus lawderanus, 8:66.
Tenuidactylus longipes, 8:68.
Tenuidactylus longipes voraginosus, 8:68.
Tenuidactylus medogensis, 8:44.
Tenuidactylus mintoni, 8:62.
Tenuidactylus montiumsalsorum, 8:60, 68.
Tenuidactylus rohtasfortai, 8:66, 68.
Tenuidactylus stoliczkai, 8:61, 62, 63, 65, 66.
Tenuidactylus tibetanus, 8:60.
Tenuidactylus turcmenicus, 8:68.
Tenuidactylus walli, 8:63.
Tenuidactylus yarkandensis, 8:63.
Teratolepi fasciata, 6:34.
Teratolepis, 6:30, 32, 33; 10:194.
Teratolepis albofasciatus, 6:31, 32, 34.
Teratolepis fasciata, 6:31, 32; 10:194.
Teratoscincus, 2:60, 61, 63; 5:109; 7:154, 157; 10:194.
Teratoscincus bedriagai, 2:61, 63.
Teratoscincus keyserlingii, 5:109, 111.
Teratoscincus microlepis, 2:61, 63; 10:194.
Teratoscincus przewalskii, 2:10, 61, 63; 4:99, 102, 103,
104, 105, 106, 107, 108, 109, 110, Plate 1; 7:158.
Teratoscincus roborowski, 2:61.
Teratoscincus roborowskii, 2:60, 61, 62, 63; 7:153, 154,
156, 157, 158, 159, 160, 161, 162.
Teratoscincus roborowskiii, 2:61.
Teratoscincus scincus, 2:6, 10, 12, 61, 63; 4:99, 102,
105, 109, 110; 5:109, 111,132, 133, 134; 7:158; 10:194.
Teratoscincus scincus keyserlingi, 10:194.
Teratoscincus scincus rustamowi, 5:109, 110.
Teratoscincus scincus scincus, 5:109, 110, 129.
Terrapene, 10:63, 71.
Terrapene Carolina, 2:66; 10:55, 66, 69, 71, 72, 90, 94,
95, 100, 105, 106.
Terrapene coahuila, 10:66, 71, 105, 106.
Terrapene nelsoni, 10:54, 66, 71, 72, 106.
Terrapene ornata, 10:54, 55, 66, 69, 71, 72, 75, 99, 105,
107, 108.
Testudo, 10:42, 49, 62, 67, 70, 114, 116.
Testudo angulata, 10:106.
Testudo cyrenaica, 10:115.
Testudo gracea anamurensis, 9:145.
Testudo gracea ibera, 9:145.
Testudo graeca, 3:13, 68, 69, 78; 9:145, 146; 10:61, 69,
70, 105, 106, 108, 115, 117.
Testudo graeca anamurensis, 9:145, 146, 147, 148.
Testudo graeca ibera, 9:145, 146.
Testudo graeca ibera” terrestris” , 9:146.
Testudo graeca nikolskii, 3:69, 70.
Testudo graeca terrestris, 9:145, 146; 10:115.
Testudo hermanni, 8:79; 10:69, 70, 105, 106.
Testudo hermanni hermanni, 8:79.
Testudo horsfieldi, 10:61, 69, 70, 72, 89, 90, 94, 96, 99.
2008
Asiatic Herpetological Research, Vol. 1 1
203
105, 106, 108.
Testudo horsfieldii, 2:65, 67; 6:176.
Testudo impressa, 2:67.
Testudo kleinmanni , 10:62, 69, 70, 105, 106, 114, 115.
Testudo marginata , 10:69, 106.
Testudo mauritanica, 10:115.
Testudo terrestris, 10:114, 115-116, 117, 118.
Testudo triunguis , 10:115.
Testudo werner i, 10:107, 114.
Testudo zohalfa, 10:115.
Testudo zolkafa , 10:115.
Theloderma, 10:19.
Theloderma asperum , 10:19.
Theloderma horridum , 10:251, 257, 260.
Theloderma stellatum , 10:19.
Tiliqua, 9:122.
Tiliqua rigifera, 8:21.
Tinosaurus yuanquensis , 10:49.
Tomopterna , 6:176, 179.
Tomopterna breviceps, 6:173, 176.
Tomopterna rolandae, 6:39, 40, 41.
Trachemys, 10:55, 57, 64, 67, 75.
Trachemys adiutrix, 10:106.
Trachemys callirostris, 10:106.
Trachemys decorata, 10:58, 64, 105, 106.
Trachemys decussata, 10:106.
Trachemys dorbigni, 10:106.
Trachemys emolli, 10:106.
Trachemys gaigeae, 10:106.
Trachemys ornata, 10:107.
Trachemys scripta, 10:107.
Trachemys scripta elegans, 10:126.
Trachemys scripte elegans , 10:126.
Trachemys sripta elegans, 10:126.
Trachemys stejnegeri, 10:107.
Trachemys taylori, 10:107.
Trach emys terrapen , 10:107.
Trachemys venusta, 10:107.
Trachemys yaquia, 10:107.
Trachischium guentheri, 4:31, 33.
Trachmys scripta elegans, 10:127.
Trapelus, 3:104; 4:82; 8:97; 10:193, 208, 209, 210, 211,
213.
Trapelus agilis, 8:90, 91, 92, 94, 96, 97; 10:193, 208,
212, 213.
Trapelus agilis agilis, 8:90, 91, 92, 94, 95, 96, 97, 99;
10:193.
Trapelus agilis isolepis, 8:90, 91.
Trapelus agilis khusistanensis, 8:97.
Trapelus agilis khuzistanensis, 8:90, 91, 92, 93, 94, 96,
97, 101.
Trapelus agilis pakistanensis, 8:90, 92, 94, 95, 96, 97,
98, 101, 10:193.
Trapelus agilis sanguinolentus, 8:90, 91, 96, 97, 100;
10:208.
Trapelus flavimaculatus, 8:97.
Trapelus megalonyx, 10:193.
Trapelus persicus, 8:93, 94, 97; 10:208.
Trapelus rubrigularis, 8:23; 10:193.
Trapelus ruderatus, 8:86.
Trapelus ruderatus baluchianus, 10:193.
Trapelus sanguinolenta, 5:132.
Trapelus sanguinolentus, 4:79, 80; 5:132, 133, 134, 135;
6:101; 10:208, 213.
Trapelus sanguinolentus aralensis, 5:129; 10:208.
Trapelus sanguinolentus sanguinolentus, 10:208.
Trapelus savignii, 8:97; 10:208.
Trapelus turnevillei, 8:97.
Trigonocephalus blomhojfii, 1:45.
Trigonocephalus intermedius, 1:47.
Trimeresurus, 5:122; 10:254, 269, 276.
Trimeresurus albolabres, 4:8.
Trimeresurus albolabris, 6:173, 178.
Trimeresurus convictus, 8:22.
Trimeresurus flavomaculatus , 9:42, 64.
Trimeresurus flavoviridius, 8:108.
Trimeresurus labialis, 8:22.
Trimeresurus mangshanensis, 8:46.
Trimeresurus medoensis, 8:47.
Trimeresurus monticola zayuensis, 8:46.
Trimeresurus mucrosquamatus, 5:117, 118, 120, 121,
122, 123, 124, 125; 6:78, 79, 80, 82, 83; 8:107, 108.
Trimeresurus mutabilis, 8:22.
Trimeresurus cf. popeiorum, 10:276.
Trimeresurus stejnegeri, 5:117, 118, 120, 121, 122, 123,
124, 125; 8:107, 108, 110.
Trimeresurus stejnegeri chenbihuii, 7:170, 172: 8:47.
Trimeresurus stejnegeri stejnegeri, 7:172.
Trimeresurus xianchengensis, 8:47.
Trionyx sinensis, 2:67.
Trionyx spinifera, 10: 107.
Trionyx triunguis, 7:141; 10:114.
Triturus, 8:29, 35, 36; 10:163, 301.
Triturus cristatus, 5:82; 8:34, 35.
Triturus cristatus karelini, 3:69, 78; 5:74, 78, 83.
Triturus vittatus, 3:71, 75; 4:49; 5:78, 79, 80, 81, 82, 83.
Triturus vittatus ophryticus, 3:69, 71, 77; 5:74, 76, 77,
78, 80, 81, 82, 83.
Triturus vulgaris , 5:78, 79, 81, 83; 8:35.
Triturus vulgaris lantzi, 3:69, 71, 72, 75, 77; 5:74, 75,
78, 80, 83.
Trogonophis weigmanni, 8:4.
Tropicochelymys subglobosa, 10:107.
Tropidoclonion lineatum , 4:66.
Tropidolaemus wagleri, 9:55.
Tropidolaemus cf. wagleri, 9:42, 55, 63.
Tropidonophis, 5:99.
Tropidonophis dendrophiops dendrophiops, 5:99.
204
Asiatic Herpetological Research, Vol. 1 1
2008
Tropidonophis negrosensis, 9:42, 54.
Tropidonotus chrysargos, 7:169.
Tropidonotus chrysargus , 7:166, 168.
Tropidonotus davidi , 1:31.
Tropidonotus himalayanus, 7:169.
Tropidonotus lateralis, 1:39.
Tropidonotus natrix, 4:42, 44, 50.
Tropidonotus natrix ater, 4:44.
Tropidonotus natrix colchica, 4:42.
Tropidonotus natrix natrix, 4:44.
Tropidonotus natrix nigra, 4:42.
Tropidonotus natrix scutata, 4:44.
Tropidonotus natrix scutatus, 4:44, 50.
Tropidonotus tigrinus, 1:39.
Tropidonotus vibakari, 1:38.
Tropidophorus, 4:18.
Tropidophorus grayi, 9:41, 51, 62, 64.
Tropidophorus guangxiensis , 4:18, 20, 21.
Tropidophorus partelloi, 5:92, 93.
Tropidophorus sincus, 4:18.
Tropidophorus sinicus, 4:18, 19, 21.
Tropidophorus thai, 4:18, 21.
Tropiocolotes, 10:194.
Tropiocolotes depressus, 10:194.
Tropiocolotes persicus euphorbiacola, 10:194.
Tropiocolotes persicus persicus, 10:194.
Triturus vittatus ophryticus, 3:12.
Trypheropsis, 6:86.
Tupinambis teguixin, 10:178, 179.
Tyler ana, 6:86.
Tylototriton , 4:149, 155; 10:302.
Tylototriton andersoni, 4:148, 150, 155-156.
Tylototriton kweichawensis, 10:302.
Tylototriton kweichowcensis, 10:302.
Tylototriton kweichowensis, 4:146, 148, 149, 152, 153,
154, 155; 10:302.
Tylototriton verrucosus, 4:146, 148, 150, 152, 153, 154,
155; 10:302.
Tympanocryptis, 4:95.
Typhlina, 3:65; 6:132.
Typhlops, 3:65; 6:141; 7:134; 8:13; 10:195.
Typhlops adamsi, 6:132, 137, 138, 142, 148.
Typhlops ahsanai, 10:195.
Typhlops bergi, 6:132, 135, 136, 138, 140, 142, 145,
148, 149.
Typhlops braminus, 4:8.
Typhlops castanotus, 9:42, 55.
Typhlops diardii, 10:195.
Typhlops diardii platyventris, 10:195
Typhlops ductuliformes, 10:195
Typhlops hypogius, 9:42, 55.
Typhlops infralabialis, 6:132, 136, 137, 138, 140, 148.
Typhlops keasti, 6:132, 135, 138, 142, 148, 149.
Typhlops luzonensis, 9:55.
Typhlops madgemintonai madgemintonai, 10:195.
Typhlops madgemintonai shermanai, 9:155; 10:195.
Typhlops ruber, 9:42, 55.
Typhlops solomonis, 6:132, 136, 137, 138, 149.
Typhlops subocularis, 6:135, 136, 137, 138, 149.
Typhlops vermicularis, 5:6, 130, 134, 135; 6:141.
Uu
Ulupe, 8:24.
Ulupe davisoni, 8:24.
Uperodon, 10:191.
Uperodon systoma, 6:39, 40, 41; 10:191.
Uromastyx, 4:95; 9:32, 33; 10:195.
Uromastyx acanthinurus , 9:32.
Uromastyx aegyptius, 9:32.
Uromastyx aegyptius microlepis, 9:30, 31, 32, 33.
Uromastyx asmussi, 10:195.
Uromastyx hardwickii, 10:195.
Uromastyx microlepis, 10:178, 180.
Urosaurus ornatus, 7:158, 161.
Uta stansburiana, 8:82-83.
Vv
Varanus, 1:60, 61; 5:86; 9:25; 10:195, 236.
Vararus bengalensis, 1:60, 61, 62; 4:30; 6:173; 7:114;
10:195,236, 237, 238, 239, 240.
Varanus dumerili, 1:60, 61, 62.
Varanus flavescens, 1:60, 62; 6:173; 10:195.
Varanus griseus, 5:132, 133, 134, 135; 7:108; 9:33;
10:195.
Varanus griseus caspius, 5:130; 10:195.
Varanus griseus koniecznyi, 10:195.
Varanus cf. griseus, 4:80.
Varanus irrawadicus, 1:60, 61, 62, 63.
Varanus irrawardicus, 1:60.
Varanus komodensis, 7: 1 14.
Varanus komodoensis, 7:160.
Varanus monitor, 1:60, 62, 63.
Varanus nebulosus, 10:252, 272.
Varanus olivaceus, 5:85.
Varanus panoptes, 9:25, 26, 27, 28.
Varanus rosenbergi, 7: 1 14.
Varanus rudicolis , 1:60, 61, 62, 63.
Varanus salvator, 1:60, 61, 62, 63; 10:252, 273.
Varanus salvator nuchalis, 9:41, 51, 62.
Vibrissaphora , 2:37; 7:71, 97; 10:298, 300.
Vibrissaphora ailaonica, 2:37, 42.
Vibrissaphora boringii, 2:42.
Vibrissaphora leishanensis, 2:42.
Vibrissaphora liui, 2:42.
Vibrissaphora yaoshanensis, 2:42.
Vipera, 3:1, 25, 28.
2008
205
Asiatic Herpetological Research, Vol. 1 1
Vipera ammodytes, 3:20.
Vipera aspis , 6:18; 7:134.
Vipera berus, 1:28,44, 45; 3:3, 4, 5, 8, 13, 14, 15,25,26;
4:66; 6:3, 6, 13, 18.
Vipera berus berus , 1:22, 44, 45, 49; 3:26.
Vipera berus dinniki , 3:3, 4, 5, 8, 9, 14; 6:1.
Vipera berus ornata, 3:3, 5, 6, 26.
Vipera berus renardi , 3:26.
Vipera berus sachalinensis, 1:44.
ttpera darevskii , 3:1, 2, 5, 6, 8, 9, 19, 21, 22, 23, 24, 26,
30, 31; 6:15, 19.
Vipera dinniki , 3:1, 2, 5, 6, 8, 9, Plate 2, 11, 13, 14, 15,
16, 17, 18, 19, 20, 21, 22, 23, 25, 27, 29, 30, 31, 70, 80;
6:1,2, 3, 4, 5, Plate la, lb, lc, 6, 7, 8, 9, 10, 11, 13, 14,
15, 16, 17, 18, 19, 20, 21; 7:134.
Vipera eriwanensis, 6:3, 13, 19, 20, 21, 23.
Vipera gedulyi , 3:28.
Vipera kaznakovi , 6:1, 2, 3, 5, 7, 8, 9, 10, 11, 12, 13, 14,
15, 18, 19; 7:134.
Vipera kaznakowi, 3:1, 2, 3, 4, 5, 6, 7, 8, 9, 10, Plate 1,
11, 12, 13, 14-15, 16, 17, 18, 19, 20,21,22, 23,25,26,
27, 28-29, 30, 31, 32, 67, 68, 69, 73, 75, 77, 80; 4:52.
Vipera kaznakowi dares kii, 3:21.
Vipera kaznakowi dinniki , 3:14, 21.
Vipera kaznakowi kaznakowi, 3:6.
Vipera kaznakowi orientalis , 3:3, 14; 6:20.
Vipera lebetina, 3:25; 5:6, 132, 133, 134, 135; 7:6, 132,
134.
Vipera lebetina cernovi, 7:6.
Vipera lebetina chernovi, 7:134.
Vipera lebetina obtusa, 7:6, 134.
Vipera lebetina turanica, 5:130; 7:6, 134.
Vipera lotievi, 6:1, Plate Id, 11, 16, 17, 18, 19, 20, 21,
22, 23, 24.
Vipera lotievii, 6:3, 13.
Vipera orientalis, 6:20.
Vipera palaestina, 7:132.
Vipera persica, 3:25.
Vipera pontica, 6:19.
Vipera raddei, 3:20, 25; 7:132.
Vipera renardi, 3:3-4, 6, 14; 6:1, 18, 19, 20, 21, 23.
Vipera russelli, 5:125; 8:108.
Vipera seoanei, 6:16, 22.
Vipera tigrina, 3:3, 5, 14.
Vipera ursini, 3:2, 5, 13, 18, 22, 23, 25; 7:137; 8:73.
Vipera ursini eriwanensis, 3:2, 6, 8, Plate 3, 19, 22, 23,
24, 30, 31; 6:19.
Vipera ursini kaznakowi, 3:6, 14.
Vipera ursini renardi, 3:2, 4, 5, 6, 8, 14, 19, 25, 26, 27,
28 29 30 31 32.
Vipera ursinii, 6:1, 2, 15, 16, 18, 19, 21, 22, 23, 24;
7:134.
Vipera xanthina, 3:14, 25; 7:132.
Xx
Xenagama, 3: 104.
Xenobius melanonychus, 4:149.
Xenochrophis, 10:197.
Xenochrophis cerasogaster cerasogaster, 10:197.
Xenochrophis piscator, 4:31; 6: 1 73.
Xenochrophis piscator piscator, 10:197.
Xenochrophis pisctor, 8:57.
Xenochrophis sanctijohannis, 1 0: 1 97.
Xenopeltis hainanensis , 8:45.
Xenopeltis hainanensis hainanensis, 7:171; 8:45.
Xenopeltis hainanensis jidamingae, 7:170, 171.
Xenophtys, 7:70.
Xenopus, 10:163.
Xenopus laevis, 10:287.
Xerobates agassizii, 10:106.
Xerobates polyphemus, 10:107.
Zz
Zaissanurus, 4:78.
Zamenis dahli, 5:1, 2.
Zamenis ravergieri, 7:132.
Zamenis spinalis, 1:27.
Zamnis ladacencis, 7:57.
Zaocys dhummnades, 2:53.
Zaocys dhumnades, 2:53; 8:57.
Zaocys luzonensis, 9:42, 54.
Zaocys nigromarginatus, 2:46, 47, 48, 52, 53; 4:31.
Zweifelia, 6:86.
Submitted: 05 January’ 2007
Accepted: 06 September 2007
[pp. 206-208
Asiatic Herpetological Research, Vol. 1 1
2008
Asiatic Herpetological Research
Gudelines for Manuscript Preparation and Submission
Asiatic Herpetological Research is published annually by the Chengdu Institute of Biology (CIB) of the Chinese
Academy of Sciences (CAS) and the Asiatic Herpetological Research Society (AHRS). It publishes results from orig-
inal research with primary focus on Asian herpetofauna. Occasionally, the journal publishes invited review articles.
Molecular data generated in a research project and submitted for publication to Asiatic Herpetological Research must
also be deposited at a recognized archive, such as GenBank, and accession numbers must then be provided in the
Results section. Furthermore, holotypes of taxa described in Asiatic Herpetological Research as new to science
should be deposited in National or International Centers. Secondary types of these taxa should be distributed among
several museums.
All manuscripts must be submitted via email to the editorial office at [email protected]. For manuscript submission, a
single file including all text, tables and figures in pdf format is preferred, although separated files in MSWord, text,
jpeg, Tiff or other commonly used file formats are also acceptable. After acceptance, separate files will be required
for text, figures and tables. Please note that it is possible for an email message to disappear on the Internet without
being delivered. If an acknowledgement is not received within 3-5 working days, please contact the editorial office.
Manuscripts should be arranged in the following order:
Manuscript Title page
Abstract
Key words (5-7 that do not appear in the title)
Manuscript Text
Tables
Figure legends
Figures
Figures and Tables should be stand-alone, and should not be imbedded within the text of the manuscript.
A cover letter should accompany the manuscript. Contact information for suggested reviewers (if any) should be pro-
vided in the letter.
The Editor will examine a given manuscript upon submission. If appropriate, the manuscript will then be reviewed
by an appointed Sectional Editor and selected outside reviewers. Acceptance will be based upon the quality of the
science and the appropriateness of the manuscript for our journal. Each manuscript must stand on its own merits and
be a substantial contribution to the field.
Asiatic Herpetological Research requests $25 US per printed page from authors with funds available. Please indicate
if funds are available.
Three Categories are available for manuscript submission
Major articles are full-length reports usually greater than 15 but not more than 50 manuscript pages (the latter only
at discretion of the Editor).
Shorter Contributions are more limited in scope and usually occupy 15 or fewer manuscript pages. Manuscripts
may be moved from one category to the other at the discretion of the Editor.
Review article are invitation only. Authors are encouraged to contact the editor for potential invitation.
Format
The manuscript must be arranged in the following format or it will be returned to authors without review.
© 2008 by Asiatic Herpetological Research
2008
Asiatic Herpetological Research, Vol. 1 1
207
COVER PAGE must contain the title of the manuscript, names and affiliations of authors, contact information for the
corresponding author, running head, manuscript type, and no more than six key words that are not found in the title.
TEXT must be numbered with abstract as the first page, double-spaced and left justified. All measurements must be
in metric units, and abbreviations (except for common ones pertaining to measurement, time, or statistical test) must
be defined at first use. Footnotes (other than in tables) are not permitted. Generic and specific names (and nothing
else except secondary headings, genetic loci, and some statistical abbreviations) are italicized, and taxonomic author-
ship should appear only when nomenclatural problems are involved. Recognized common names of organisms must
be capitalized. Institutional abbreviations used in text and in Material Examined (see Major Article below) must fol-
low Leviton et al., 1985. (Leviton, A. E., R. H. Gibbs Jr., E. Heal, and C. E. Dawson. 1985. Standards in herpetology
and ichthyology. Part I. Standard symbolic codes for institutional resource collections in herpetology and ichthyology.
Copeia 1985:802-832). Numerical ranges must be delimited with an en-dash. Latitudinal and longitudinal informa-
tion should be presented with datum used cited.
Articles will be published using two level subheading styles. All heading levels must be on their own line, and left
justified. For the purposes of manuscript submission, Level 1 heading is bold, and generally reserved for
Introduction, Material and Methods, Results, and Discussion; Level 2 is italic. More than two levels of subheading
are not encouraged. Manuscripts of the shorter contribution category should not be sectioned.
ACKNOWLEDGMENTS identify individuals by first initial and full surname and do not list professional titles and
institutions. Collecting permits, import/export permits, and Institutional Animal Care protocols must be cited in
Acknowledgments.
LITERATURE CITED is double-spaced and formatted identically for all manuscripts. References in the text must
be checked for consistency with references in the literature cited section. The length of Literature Cited should not
exceed 20% of the text.
References in Text. 1) References to articles by one or two authors must include both surnames in the order they
appear in the original publication. References to articles by more than two authors must include the first author's sur-
name, followed by "et al." 2) The year of article follows the authors, separated only by a space. 3) References with
the same author and year are distinguished by the lower case characters "a, b, c . . .” 4) References cited in text are
listed in alphabetical order by first author.
For example, "My results also incorporate literature records (Marx et al., 1982; Marx and Rabb, 1972; Mertens, 1930;
Pope, 1929; Wall, 1909, 1910a, 1910b, 1910c)."
References in Literature Cited. 1 ) References must include all authors, in the order that they appear in the orig-
inal publication; "et al." is never used in a literature cited section. 2) The first author is listed surname first, initial(s)
last. All other authors are listed initial(s) first, surname last. 3) References with the same author and year are distin-
guished by the lower case characters, "a, b, c,. .." 4) References cited are listed in alphabetical order by first author.
5) Names of journals are not abbreviated. See below for examples:
Journal article
Dial, B. E. 1987. Energetics and performance during nest emergence and the hatchling frenzy in loggerhead sea tur-
tles ( Caretta caretta). Herpetologica 43(3):307-3 1 5.
Journal article, title translated, article not in English
Ananjeva, N. B. 1986. [On the validity Megalochilus mystaceus (Pallas, 1776)]. Proceedings of the Zoological
Institute, Leningrad 157:4-13. (In Russian).
Note that for Acta Herpetologica Sinica, the year must precede the volume number. This is to distinguish between the
old and new series, and between 1982-1987, Vols.1-6 (new series) and 1988 with no volume number, numbers 1 and
2 (new series).
Cai, M., J. Zhang, and D. Lin. 1985. [Preliminary observation on the embryonic development of Hynobius chinensis
208
Asiatic Herpetological Research, Vol. 1 1
2008
Guenther], Acta Herpetologica Sinica 1985, 4(2): 177-180. (In Chinese).
Book
Pratt, A. E. 1892. To the snows of Tibet through China. Longmans, Green and Co., London. 268 pp.
Article in book
Huey, R. B. 1982. Temperature, physiology, and the ecology of reptiles. Pp. 25-91. In C. Gans and F. H. Pough (eds.),
Biology of the Reptilia, Vol. 12, Physiological Ecology. Academic Press, New York.
Government publication
United States Environmental Data Service. 1968. Climatic Atlas of the United States. Environmental Data Service,
Washington, D. C.
Thesis or dissertation
Moody, S. 1980. Phylogenetic and historical biogeographical relationships of the genera in the Agamidae (Reptilia:
Lacertilia). Ph.D. Thesis. University of Michigan. 373 pp.
Internet References
To cite a website in text (but not a specific document), it is sufficient to give the address (e.g., http://www.apa.org)
there and no reference entry is needed. However, when citing a particular web page as a citation in the text (e.g. Gaten
2000) and an entry in the reference list will be required.
Example:
Gaten, E. 2000. Internet references. Retrieved from http://www.le.ac.uk/biology/teach/mod300/ecitations.html
19/9/2000.
TABLES (numbered in Arabic) must each appear with a short heading on a separate sheet and be double-spaced with
no dotted or vertical lines. Location of each table should be indicated in the right margin of text as "Tl," "T2," etc.
For ease of layout, please submit tables as either word or excel tables. Multiple tabs may not format correctly and
will be returned to the author for correction.
FIGURES (numbered in Arabic) should each be on a separate sheet. When several drawings or photographs are
grouped as one, they must be arranged as one unit on a single page, and each lettered with an uppercase block letter
in the upper comer of each plot. Most figures are reduced to one-column width; hence, lettering must be sized appro-
priately. Location of each figure should be clearly indicated in right text margin as "FI," "F2," etc. Figure legends are
grouped sequentially and double-spaced on a separate sheet. Figures should be submitted at a minimum of 300 dpi
resolution as TIFF, PSD, JPG, PICT or EPS for vector graphic based data. Figures will be reduced to either on column
(3.25”) or 2 columns (6.5”).
AHR may publish color figures at the discretion of the editors. AHR is now published both on paper and electroni-
cally. Printing costs of color figures may be required for the paper version of AHR. Color figures will be published
free of charge in the electronic version. If you submit color figures, please indicate if you wish them to be considered
for publication in color in the paper version. Otherwise, they will be converted to black and white in the paper ver-
sion.
STATEMENT OF AUTHORSHIP. Authorship implies responsibility. All authors should have played a significant
role in designing and performing the research and in writing the manuscript. Those whose roles were limited solely
to providing materials (to include financial support), collecting data, or reviewing the manuscript, should be recog-
nized in Acknowledgments. Honorary authorship must be avoided.
Wei Zhi Meng, Xiao Bing Wu and Lu Sheng Wu. An Investigation of the Morphometric Characteristics of Eggs
of the Chinese Alligator {Alligator sinensis ) 80-84
Yun Ming Mo, Jian Ping Jiang, Feng Xie and Annemarie Ohler. A New Species of Rhacophorus (Anura: Ranidae)
from China 85-92
Oren Pearlson and Gad Degani. The Life History of Triturus v. vittatus (Urodela) in Various Habitats
93-97
Peng Liu, Wen Ge Zhao, Zhi Tao Liu, Bing Jun Dong and Hui Chen. Sexual Dimorphism and Female Reproduction
in Lacerta vivipara in Northeast China 98-104
Li Mei Qin, Zhong Hua Zheng, Jian Ping Jiang, Feng Xie and Yun Ming Mo. Sperm Morphology of Five
Rhacophorus (Amphibia: Anura: Rhacophoridae) Species from China 105-109
C. Srinivasulu and Indraneil Das. The Herpetofauna of Nallamala Hills, Eastern Ghats, India: An Annotated
Checklist, With Remarks on Nomenclature, Taxonomy, Habitat Use, Adaptive Types and Biogeography . . .
110-131
Farhang Torki and Ahmad Gharzi. Spermatogenesis Timing in a Population Ophisops elegans (Sauria;
Lacertidae), Western Iran 132-135
Basudev Tripathy. An Assessment of Solitary and Arribada Nesting of Olive Ridley Sea Turtles (Lepidochelys
olivacea) at the Rushikulya Rookery of Orissa, India 136-142
Jie Wang and Cuijuan Niu. Effects of Starvation on Urinary Nitrogen Composition of Juvenile
Chinese Three-keeled Pond Turtles {Chinemys reevesii) 143-146
Xianghong Xiao, Dong Zheng, Cuijun Yang and Longhui Chai. Survival and Metabolic Responses to Freezing
Temperature in the Northeast Forest Frog Rana dybowskii 147-152
Yan Zhang, Liu Wang Nie, Liang Yan, Ping Ping Zheng and Wen Cheng. Clone and Sequence Analysis of Sox
Genes in Rana tientaiensis 153-160
Genevieve V. A. Gee. Cummulative Index to Vols. 1-10 of Asiatic Herpetological Research 161-205
Editors. Guidelines for Manuscript Preparation and Submission 206-208
3804 28
About the cover.- The Chinese frog Wurana tormota is unique among vocalizing anurans (and vocalizing organisms in general) by way of their
ultrasonic calling. The photographed specimen is a male Concave Eared Frog inhibiting Taohua Creek. As a cascade frog, it was once thought to
be a species of Amolops. Dr. Pipeng Li and his colleagues took a survey in the type locality and collected the four types of tadpoles in the creek
in 2005, read articles by Li et al. on pages 55-59 and 69—73 in this issue.
ISSN 1051-3825
F. Ahmadzadeh, B. H. Kiabi, H. G. Kami and V. Hojjati. A Preliminary Study of the Lizard Fauna and Their
Habitats in Northwestern Iran 1-9
M. Farid Ahsan, Ghazi S. M. Asmat and S. Chakma. A Second Record of Ptyctolaemus gularis (Peters 1864)
from Bangladesh ini?
A. A. Thasun Amarasinghe and D. M. S. Suranjan Karunarathna. Observations on the Ovipositional Behavior of
the Crest-less Lizard Calotes liocephalus (Reptilia: Agamidae) in the Knuckles Forest Region of Sri Lanka
13-16
Patrick David, Haiyan Tong, Gemot Vogel and Mingyi Tian. On the Status of the Chinese Pitviper
Ceratrimeresurus shenlii Liang and Liu in Liang, 2003 (Serpentes, Viperidae), with the Addition of
Protobothrops cornutus (Smith, 1930) to the Chinese Snake Fauna 17-23
Wei Guo Du and Xiang Ji. The Effects of Incubation Temperature On Hatching Success, Embryonic Use of
Energy and Hatchling Morphology in the Stripe-tailed Ratsnake Elaphe taeniura 24-30
Da-Jie Gong and Mai Mu. Behavioral Observations and Descriptions of the Endangered Knobby Newt
Tylototriton wenxianensis and Their Application in Conservation 31-38
Karen A. Jensen and Indraneil Das. Observations on the Influence of Seasonality, Lunar Cycles, and Weather
Condition on Freshwater Turtle Activity in Sarawak, East Malaysia (Borneo) 39—44
Runzhen Jing and Cuijuan Niu. Effect of Stocking Density on the Energy Budget of Juvenile
Soft-Shelled Turtles ( Pelodiscus sinensis ) 45^19
En Li, Xiao Bing Wu and Peng Yan. Genetic Variation and Trans-species Polymorphism of MHC Class II B
Genes in Reptiles cncr
Pipeng Li and Yuyan Lu. The Biology and Taxonomic Status of the Sunken Ear Frog (Wurana tormotus)
57-61
Pipeng Li, Yuyan Lu and Ang Li. A New Species of Brown Frog from Bohai, China
62-70
Pipeng Li, Yuyan Lu, Ang Li and Lina Yu. The Tadpole of A Little-known Frog, Wurana tormotus
71-75
Pipeng Li, Yuyan Lu and Ang Li. A Brief Report on the Life History of Batrachuperus taibaiensis at Ping He
Liang of Tsinling Mts nr.
(Continued on inside back cover)
MCZ ERNST MAYR l irrapv
3 2044 118 665 082