ceestita Soe
Near
Se ae
ewig 0 ww
EE egin ve AN lh wih
(tn ain 4 ea hts ty EA TO
Ae KR AEE
Nim
Sehincites tree et
Specks eo RT
sik Tra Ea!
et Rieti Sa
Fite gt ietiatie ye t-5e when's
ay = sagt Se
os aber atin et
Ed etn oO ite
awn tan 2
RS we AS letra
crab: Reg BAGR ST ME. BE
m2 Ae tr een ah 4 oat > yeet ee * a
Sp SRD HOR AR he Bh ea NS artis Te
Secs? oR > ae Ee RO Goat
= . es eee Aer
oe
SS ee ee ee —— - m
MRE Ae RINT AS OD RS OO a: wee S - ago Daw as
Rat etn CRA Ce ae Sa ee Sa a kScwk doa be wane : - ‘ ‘
aS ert rf : : Sor eckoe ee = eterna ee ee - my
eee ae 4 ¥ na. Faerie Ae ERY Oe ‘
gp ; S ese ¥- per ener ee ST OLS aide Sea
PROCEEDINGS
OF THE
GENERAL MEETINGS FOR SCIENTIFIC BUSINESS
OF THE
ZOOLOGICAL SOCIETY
OF LONDON.
1905, vol. II
(MA Y—DECEMBER.)
PRINTED FOR THE SOCIETY,
AND SOLD AT THEIR HOUSE IN HANOVER-SQUARE,
LONDON:
MESSRS. LONGMANS, GREEN, AND CO,
PATERNOSTER ROW,
Ow onian institu,
Eeiise
OF THE
COUNCIL AND
OFFICERS
OF THE
ZOOLOGICAL
SOCIETY OF LONDON.
1905.
COUNCIL.
His Grace Tue DuKE or Beprorp, K.G., President.
Sir ALEXANDER Batrrp, Br.
Grorce A. BouLencer, Hsq., |
E.R.S., Vice-President.
Tuomas H. Burroveues, Hsq.
Freperic G. Dawtrey Drewirt,
Esq., M.D.
Hersert Drucs, Ksq., F.L.8.,
Vice-President.
Cuartes Drummonp, Ksq.,
Treasurer.
Sir Epwarp Duranp, Br., C.B.
FREDERICK GiLLeTT, Esq.
F. DuCanr Gopmay,
D.C.L.,F.R.S., Vice-President.
W. R. Octuvir-Grant, Esq.
Hsa., |
JOSEPH JACKSON ListER, Hsq.,
M.A., F.R.S.
Sir Epmunp Gitrs Loprr, Br.
EK. G. B. Meapr-Watpo, Esq.
P. Cuatmers MircHey, Ksq.,
M.A., D.8c., Secretary.
E. Lort Puitures, Esq.
Howarp Saunpers, Ksq., Vice-
President.
H.S.H. Prince
TECK.
CuHarues 8. Tomus, Hsq., M.A.,
F.R.S., Vice-President.
Aveustus F. Wiener, Esq.
Henry Woopwarp, Esq., LL.D.,
E.R.S., Vice-President.
FRANCIS OF
PRINCIPAL OFFICERS.
P. Cuaumers Mircuenr, Hsq., M.A., D.Sc., Secretary.
Frank H. Bepparp, Hsq., M.A., F.R.S8., Prosector.
R. I. Pococgr, Hsq., F.L.S., Superintendent of the Gardens.
CHARLES GABRIEL SELIGMANN, Hsq., M.R.C.S., L.R.C.P.,
Pathologist.
Me. F. H. Wateruouss, Librarian.
Mr. Joun Barrow, Accountant.
Mr. W. H. Cots, Chief Clerk.
Mr. Grorce ArtHur Doupiepay, Clerk of Publications.
Mr. ArtHur THomson, Assisiant Superintendent of the
Gardens.
Y,
LIST OF CONTENTS.
May 2, 1905.
The Secretary. Exhibition of photographs of Hippo-
[DOWATIMNEISSS) ShyamoMNATTAMIe? So Gavide acnonoaseanne sac ve odunooasraqtTee
Mr. R. KE. Holding. Exhibition of, and remarks upon, a
series of the first-year antlers of certain Deer ............
My. R. I. Pocock, F.Z.8. Exhibition of a specimen of the
Syoeiouteln “beneryoniblless cocoeboncosendnostcopec: Nt SABE eee aS
Mr. W. Bateson, F.R.S. Exhibition of, and remarks upon,
specimens of Fowls illustrating peculiarities in the
hereditymolewhitepplumaceyy. sp see chen eee enon acne
1. On the Sponge Leucosolemia contorta Bowerbank, A scandra
contorta Haeckel, and Ascetia spinosa Lendenfeld. By
HK. A. Mincnin, F.Z.8., University College, London.
(CER Tetb ea) eai-van ear: veh Se charts i ceotte Mpsaldalo Ss \sniomimphign ae ees
2. Some Notes upon the Anatomy of the Ferret-Badger,
Helictis personata. By Franx HE. Bepparp, M.A.,
TD Bide LesROEAONe AO) HOEY SOXGENY deonanadonbocososesqosonconese
3. Contributions to the Osteology of Birds.—Part VII.
ELurylenude ; with Remarks on the Systematic Position
of the Group. By W. P. Pycrart, F.Z.8., M.B.O.U.
(Gedy IES Ne Sane PPA ae ames ee sade Rela Rees Serie crt ue
Page
21
iV
May 16, 1905.
The Secretary. Report on the Additions to the Society’s
Menagerie during the month of April 1905 ...............
Mr. Oldfield Thomas, F.R.S. Description of a new Golden
Mole (Amblysomus corric) from Cape Colony
eeoeeteecore
Mr. H. B. Fantham, F.Z.S. Exhibition of microscopic slides
and description of a new Sporozoon, Lankesterella
ETUC OTIS oe otis s ct SIC EE RRR PE ae Eka en oe ede
1. A Contribution to the Knowledge of the Encephalie
Arterial System in Sauropsida. By Frank E. Bepparp,
M.A., F.R.S., Prosector to the Society
2. On the Nomenclature of the Anthropoid Apes as pro-
posed by the Hon. Walter Rothschild. By Sir H. H.
JOHNSTON, G.C.M.G., K.C.B., E.Z.S.
Seer ese re eee ase eeeseesve
(su)
. On some Bats of the Genus Rhinolophus, with Remarks
on their Mutual Affinities, and Descriptions of Twenty-
six new Forms. By Kyup Anpersen. (Plates
ITT. & TV.)
sRelleishese<shelslislviielisielelalalehelsleleielellalels)slalelelalelelelenulsislielelsisienstelsietenstetetale
iN
. On Stridulating Hemiptera of the Subfamily Halyine,
with Descriptions of new Genera and new Species.
By Dr. E. Bereroru, C.M.Z.S., Tammerfors, Finland...
5. On the Anatomy of Limicoline Birds; with special
Reference to the Correlation of Modifications. By
P. Cuaumers Mrrcuun, M.A., D.Sc. (Oxon.), Secretary
to the Society
Seo vere reer were ee eeseeeaeseesere eee eseeerereseesen
fer)
. Observations upon a Female Specimen of the Hainan
Gibbon (Hylobates hainanus), now living in the
Society's Gardens. By R. I. Pococn, F.LS., F.Z.S.,
Superintendent of the Gardens. (Plate V.)............6:.
June 6, 1905.
The Secretary. Report on the Additions to the Society’s
Menagerie during the month of May 1905 ...............
Page
58
59
70
75
146
155
169
Vv
Mr. Oldfield Thomas, F.R.S. Description of a new Bush-
buck (Tragelaphus haywoodt) from British Hast Africa .
Mr. Oldfield Thomas, F.R.S. Exhibition of specimens of
Mammals and Birds fron, Japan and description of a
new Marten (Mustela melampus bedfordt) .............0604
Mr. R. I. Pocock, F.L.S. Exhibition of a Jamaican
Scorpion (Centrurus imsulanus) carrying young on
DGS HOA C Ke Waseca sine Nate sate svide leat inate cpa sa eee tartans S02 Gs Me
. P. Chalmers Mitchell. Notice of a memoir entitled
“On the Intestinal Tract of Mammals”....................5
1. Rough Notes on the Natural History of the Country
West of the Victoria Nyanza. By Lt.-Col. C. Detmn-
VAD CLENRE MIEN sO) sao HeAiSiiecee eset cate cas seiaeee mee ere eta ien
. The Distribution of Mexican Amphibians and Reptiles.
By ERAN Ss CoADOW, BckusOey Uc ZnSneo: sca easeseemeaes ccc cer
. Descriptions of new Reptiles discovered in Mexico by
Dr. H. Gadow, F.R.S. By G. A. Boutencsr, F.R.S.,
VERO Zi Sr Ce laibestVAUarda Vali encase un stn. cee ee reee ae
. On a Collection of Batrachians and Reptiles made im
South Africa by Mr. C. H. B. Grant, and presented to
the British Museum by Mr. C. D. Rudd. By G. A.
IBOUMENGER HARES lV isi Anon eeaecey nea ne sian sas ac Welaaese
. Some Notes upon the Anatomy of the Yellow-throated
Lizard, Gerrhosaurus flavigularis. By F. H. Bepparp,
HBR ee rosector touulelSocletiys wicca datescse cee taechon
. On two Points in the Anatomy of the Lacertilian
Brain. By F. EH. Bepparp, F.R.S., Prosector to the
OCIS biypme nr its marae cues A ceras lenis cters.« osicoie aalniemaninan owate Ne
. On new Coleoptera from South Africa collected by Dr. H.
Brauns and others—Serricorinua, Hndomychide, Hro-
ylides) ay Min Sen GOREPAM EZ: Sore eran sce ee Jere
. On the Foetus and Placenta of the Spiny Mouse (Acomys
cahirinus). By Ricnarp AssHeron, M.A., F.ZS.,
Lecturer in Biology in the Medical School of Guy’s
Eospitaly University, of Womdomtus essen: cea sctreshe
Page
180
182
183
184
184
191
245
248
256
271
v1
Page
9. Remarks on the supposed Clavicle of the Sauropodous
Dinosaur Diplodocus. By Francis, Baron Nopcsa,
1 Ee Ban Be Ae ERO HE RE ORO UPN seis) Ononue arecanaacade 289
November 14, 1905.
The Secretary. Report on the Additions to the Society’s
Menagerie during the months of June, July, August,
Sepuembenpand October lIOd eee weandee cee. sneer 295
Col. W. H. Broun. Exhibition of mounted heads of a
White Waterbuck and two Rhinoceroses ................-- 296
The Hon. Walter Rothschild, F.Z.S. Exhibition of speci-
mens of a rare Marsupial (Dactylopsila palpator) ......... 297
The Hon. Walter Rothschild, F.Z.8. Exhibition of two
HUIS ROTI, VAM OV ERINOWE, 9S) sdoogsde danaccdddoussaboouccnsoeboed 340 297
Mr. A. 8. Hirst, F.Z.S8. Exhibition of microscopic pre-
parations of a new Hemosporidian (Halteridiwm
(GTO OLUTION sete cM GE prc Ins C Obve AER NGAIOR cl oa OaR ER Sdc AGA aa 297
Dr. Walter Kidd, F.Z.8. Exhibition of lantern-slides
illustrating the Papillary Ridges in Mammals ............ 297
Dr. P. L. Sclater, F.R.S. Letter from Mr. W. Rodier on
GING) Ieey ol omneOSSe UO JETISEMNES, Soc cocnooaansocsondsceocasconDose 298
Mr. Henry Scherren, F.Z.S. Exhibition of lantern-slides of,
and remarks upon, old pictures of Anthropoid Apes ... 298
1. On a Collection of Mammals brought home by the Tibet
Frontier Commission. By J. Lewis Bonuors, M.A.,
AB ES 3 ZS ic dress ok ee sete 2 iadeatecas aan /acre sols clarhis e ne 302
2. Notes on the Geographical Distribution of the Okapi. By
Dr Shinar UONNBERG-» CHMEZASs aaa. Serer ee eeeer eee eer 309
3. Notes on the Goral found in Burma. By Major G.
H. Evans
4, On the Mammals of Crete. By Dororuna M.A. Bate ... 315
vii
November 28, 1905.
Mr. J. T. Cunningham, M.A., ¥.Z.8. Exhibition of photo-
graphs of, and remarks upon, a horse bearing horn-like
structures
Pree emer eee eset eres essere sesseessosoeesesesseosereseesees
Mr. Frank Slade, F.Z.S. Exhibition of photographs of a
Sea-Anemone in the process of division ..................65
Mr. Douglas English. Exhibition of an albino Field-
BV iG CRMC RPA tar heh eter oo eA WM oy Onak 3 5 lw Sonos
Mr. G. A. Boulenger, F.R.S. Exhibition of, and remarks
upon, a melanistic specimen of the Wall-Lizard .........
Capt. Albert Pam, F.Z.S. Remarks upon a living specimen
of the Violet-cheeked Humming-bird...................00055
Mr. W. R. Ogilvie-Grant, F.Z.8. Exhibition of a series of
Tonielaslrawms) gore URVORRD, ceocsoscaasousaseoosesongonsoubcoone sean
1. Colour Evolution in Guereza Monkeys. By R. LyDEKKER.
9. The White-maned Serow. By R. LypExKsr. (Plate
WADUL) ocaves-cocccbneconcnscoaoncnsanesccosdgocdpenccoosnsbepcoae:
3. The Duke of Bedford’s Zoological Exploration in Eastern
Asia.—I. List of Mammals obtained by Mr. M. P.
Anderson in Japan. By Ouprrenp Tuomas, F.R.S.
(Blatee IDNs) Meee teeta pe cese erie rte ten cmen sce cri
4, A Revision of the Fishes of the Family Galaxiide. By
0. Tare Reeay, B.A., F.Z.8. (Plates X.—XIIT.).........
5. The Mammalian Fauna of China.—Part I. Murine. By
J. Lewis Bonnore, M.A., B.LS...........cccccere ene eee ee ees
6. Descriptions of new Species of Phytophagous Coleoptera
of the Genera Homopheia, Asphera, and Oedionychis.
By Martin Jacosy, F.E.S. (Plates XIV. & XV.)... 398,
7, Some Additions to the Knowledge of the Anatomy, prin-
cipally of the Vascular System, of Hatteria, Crocodilus,
and certain Lacertilia. By Frank E. Bepparp, M.A.,
F.R.S., Prosector to the Society .........s.ee ce eeceeeeeeee eens
Page
324
324
324
320
331
363
384
591
461
Vill
December 12, 1905.
The Secretary. Report on the Additions to the Society’s
Menagerie during the month of November 1905 .........
The Secretary. Exhibition of a coloured print of Polito’s
My.
My.
Mr.
Mr.
Mr.
Dr.
Royal Menagerie at Exeter Change ...............0.000000
A. H. Cocks, F.Z.8. Exhibition of a series of photo-
graphs of Whales taken in Hast Finmarken ............ .
Geo. P. Mudge, F.Z.8. Exhibition of, and remarks upon,
a Dogfish with abnormal viscera .................ceceeeseenens
Geo. P. Mudge, F.Z.8. Exhibition of, and remarks upon,
an Harihwormswaph Dilan eee. tee eee ee eee eee
H. B. Fantham, B.Sec., F.Z.S. Exhibition of, and
remarks upon, microscopic preparations of a new Heemo-
sporidian of the genus Piroplasma. ............0cecceceeeeeees
Oldfield Thomas, F.R.S., F.Z.8. Exhibition of, and
remarks upon, tails of Dormice showing regeneration of
the vertebree
ee ee i ee oo |
W. G. Ridewood, F.Z.8. Exhibition of microscopic
preparations of the regenerated vertebra of the tails of
Dormice
i ee i a ee od
1. On the Habits and Reactions of Crabs bearing Actinians
in their Claws. By J. E. DurrpEen, Ph.D., A.R.C.Sc.
(Lond.), Professor of Zoology, Rhodes University
College, Grahamstown, Cape Colony
Pewee cere etre rece r reserve
' 2. Notes on a Collection of Snakes from J. apan and the Loo
Choo Islands. By Captain F. Waut, O.M.Z.S., Indian
Medical Service
ee ee ee ce ery
3. Description d’un Ophidien nouveau du Mexique (Morenoa
orizabensis, g. et sp.nn.). Par AurreD Duais, M.D.,
C.M.Z.S.
a i ee ee ed
4. On a Collection of Mammals from Persia and Armenia
presented to the British Museum by Col. A. C. Bailward.
By Ouprietp Tomas, F.R.S., F.Z.8. (Plate XVI.) ...
Page
490
490
490
49]
491
494
494
511
517
519
1x
. On the Colour- Variation of the Beetle Gonioctena variabilis.
IBY LE DONCASTERA MEAG BER ZS cn prrenn se Meas secnitenelescess
. On Species of Crustacea of the Genera Ptychognathus
Stimps. and Palemon Fabr. from Christmas Island. By
Dr. J. G. bE Man, of Terseke, Holland. (Plates XVII.
FEES VSIA IS rere ites sens ocala ae estan titiantnse sos pene nae
. Note on Heredity in Pigeons. By Ricuarp SrTapLes-
BRON AUB MELE ZS cee ec sma: c+ tncnie warcihios tek na nes eae ease Neeee See ERE
. On a new Species of Worm of the Genus Pontodrilus from
the Shores of the Red Sea. By Frank KH. Bepparp,
MEAG Hao ye KOSCeLor bo Uhe SOclebygee. arenas assert:
. On a new Enchytreid Worm (Henlea lefroyi, sp. n.) from
India destructive to the Eggs of a Locust (Acridiuwm sp.).
By Frank EH. Bepparp, M.A., #.R.S., Prosector to the
SOCIO BYE dese tay vel nance oem mraatele te skee ene te Vaiochs ual. lemenateler
10. On new and rare British Mites of the Family Oribatide.
By Crecin Warsurton, M.A., F.Z.8., and Nicen D. F.
IPI NKOI Wi lwa.. (lel bnes OCIDGo13 90-6) cennnssnosnnoneeeene
11. On some South Australian Spiders of the Family Lycoside.
IB yy daly Tihs IBIOVc ey UIs AS cr poenpeemnoseonor anc saccoodooas
Page
528
598
569
ALPHABETICAL LIST
OF THE
CONTRIBUTORS,
With References to the several Articles contributed by each.
ANDERSEN, KNUD.
On some Bats of the Genus Ahinolophus, with Remarks
on their Mutual Affinities, and Descriptions of Twenty-
six new Forms. (Plates IIT. & TV.) ..........:0:-s--es0e
Assueton, Ricnarp, M.A., F.Z.8., Lecturer in Biology in
the Medical School of Guy’s Hospital, University
of London.
On the Fetus and Placenta of the Spiny Mouse
(Acomys cahirinus) ..........crcecreeee eect rece teste eee eeeteeen eee
Bats, Miss DororHes M. A.
@negherviammal sro Oreteneneceteee seer ee ase cer:
Page
75
xii
Page
Bateson, Witiiam, M.A., F.R.S., F.Z.S.
Exhibition of, and remarks upon, specimens of Fowls
illustrating peculiarities in the heredity of white plumage. 3
BepparD, Frank E., M.A., F.R.S., Prosector to the Society.
Some Notes upon the Anatomy of the Ferret-Badger,
JETS TARO THOR Mpegs don qeerions Sate ono OTE Ne Pe aoc 21
A Contribution to the Knowledge of the Encephalic
ARSE! SSW SUCH IUD SERUTROOSNCEY Jo.ccoccoscoacscedsocss0n0n 00000 59
Some Notes upon the Anatomy of the Yellow-throated
lizard, Gerrhosaurus flavigularis .......c0c.0.0sececseeese scons 256
On two Points in the Anatomy of the Lacertilian
AES Teeatn gy sees te secs wie va iors Samaceisz aac oe MORRO fe on area ee 267
Some Additions to the Knowledge of the Anatomy,
principally of the Vascular System, of Hatteria, Crocodilus,
and certain Lacertilia........... Spas ic reece neers 461
On a new Species of Worm of the Genus Pontodrilus
rromauheshorestomtiae kvedi Sear see ee 558
On a new Enchytreid Worm (Henlea lefroyi, sp. n.)
from India destructive to the Eggs of a Locust
(AGHAMUMISD.)arteostocs bate hak DT Be ean eae 562
Bererotu, Dr. E., C.M.Z.S., of Tammerfors, Finland.
On Stridulating Hemiptera of the Subfamily Halyine,
with Descriptions of new Genera and new Species......... 146
Bonnorte, J. Lewis, M.A., F.LS., F.Z.S.
On a Collection of Mammals brought home by the
dhibetirontier Commission ie... .e eee ene 302
The Mammalian Fauna of China.—Part I. Murine ... 384
xill
BouLEeNGER, GrorcEe ALpnrr, F.R.S., V.P.Z.S.
Descriptions of new Reptiles discovered in Mexico by
Dr. H. Gadow, F.R.S: (Plates VI. &) VILE.) o:.:- 20...
On a Collection of Batrachians and Reptiles made in
South Africa by Mr. C. H. B. Grant, and presented to
the British Museum by Mr. C. D. Rudd .....................
Exhibition of, and remarks upon, a melanistic specimen
Gi Tiey WVeillel laiaaiee lO eka ke coesdcoetandcnbonceioodumceboactoloecns
Brown, Col. W. H.
Exhibition of mounted heads of a White Waterbuck
SUN! UNO LR MUnIKOCEIAOSES | Bosdos asses aodoaderoouaosonodudoomesgaoonn
Browne, RicuarD Strarius-. See SrapLEs-BROWNE.
Cocks, ALFRED Hrnuacn, F.Z.S.
Exhibition of a series of photographs of Whales taken
rat Sa deen aaneneleeeval gua aeyes yy eh lene MMi ied dose ite a auos
Cunnineuam, J. T., M.A., F.ZS.
Exhibition of photographs of, and remarks upon, a
horse bearine horn-like structures! .......:.5.4.5..eccsesreee-
Deumé-Ravcurrre, Lt.-Col. C., M.V.O., F.Z.8.
Rough Notes on the Natural History of the Country
WVGSIIGE ules Waretroraie, INWVEINZE, — Gocesoncagpooncononovanocnbocasne
pE May, Dr. J. G., of Ierseke, Holland.
On Species of Crustacea of the Genera Ptychognathus
Stimps. and Palemon Fabr, from Christmas Island.
(IBlboinals SOONG ts OSG IMUI SN 6 ooo Coes ence casnokonc-s2rdacnegeapnc
Page
245
248
324
296
490
323
184
537
xiv
Doncaster, Lronarp, M.A., F.Z.S.
On the Colour-Variation of the Beetle Gonioctena
DAT ULOUCS aioe ce GEN ak 6 cic He ue eae RE Ee a ee eee
Duerpen, J. H., Ph.D., A.R.C.Se.(Lond.), Professor of
Zoology, Rhodes University College, Grahamstown,
Cape Colony.
On the Habits and Reactions of Crabs bearing Actinians
AT GEL G LAWS). .c/gocieea seme meet marae oat lacs a eee ra ae
Duets, Atrrep, M.D., C.M.Z.S.
Description dun Ophidien nouveau du Mexique
(Morenoa orizabensis, &. Cb SP. MN.) .....c...sseeceresecrere ess
EneuisH, Doue.as.
Wedonlonmoin Or aia ellommo THENCE WOE sssonaancoascooocneooned
Kyans, Major G. H.
Notes on the Goral found in Burma ......................
Fantuam, H. B., B.Sc., F.Z.8.
Exhibition of microscopic slides and description of a
new Sporozoon, Lankesterella trttonts ........1eseeeeeeee neers
Exhibition of, and remarks upon, microscopic pre-
parations of a new Hemosporidian of the genus
TEN RO/DICISIIOGS. Go00680 50060000055 sooo 0b05q00G0aEOnGDAGNDAOGIGGDT IARC
Gapow, Hans, M.A., Ph.D., F.R.S., F.Z.8.
The Distribution of Mexican Amphibians and Reptiles .
Page
528
494
517
324
311
58
491
191
KV
Page
Goruam, The Rev. H.S., F.Z.8.
On new Coleoptera from South Africa collected by
Dr. H. Brauns and others—Serricornia, Endomychide,
DU RGWOUSTED wonoconchoosasonsaenpden sos oo oeodococbonuenoadébocoqDgnAD 271
Grant, W. R. Ocitvis-. See OGinvin-GRAnNT.
Hirst Al S:, E:Zs:
Exhibition of microscopic preparations of a new
Hemosporidian (Halteridiwm crumeniwm) ......eseersereees 297
Hoce, Henry R., M.A., F.Z:8.
On some South Australian Spiders of the Family
OOSUTED 060 anceoncosnderococ pe 2aadosdcannn coosccaaneoouor cc c7040s 569
Houpine, R. H.
Exhibition of, and remarks upon, a series of the first-
year antlers of certain Deer ............:sesceeeeeeeeeeeeeeeeens 1
Jacopy, Martin, F.E.S.
Descriptions of new Species of Phytophagous Coleo-
ptera of the Genera Homopheta, Asphera, and
Oedionychis. (Plates XIV. & XV.) ........cceeeeeeeeees 398, 591
Jounston, Sir Harry H., G.C.M.G., K.C.B., F.Z.8.
On the Nomenclature of the Anthropoid Apes as
proposed by the Hon. Walter Rothschild ................., 70
Kipp, Dr. Water, F.Z.8.
Exhibition of latern-slides illustrating the Papillary
Ridges in Mammals .........-sseeereesreeseeresenernesenneera ees 297
Xvi
Lonnpere, Dr. Ernar, C.M.Z.S.
Notes on the Geographical Distribution of the Okapi.
LypEexKer, RicuarD, B.A., F.R.S., F.Z.8.
Colour Evolution in Guereza Monkeys ..................
The White-maned Serow. (Plate VIII.) ...............
Mincutn, Prof. HK. A., F.Z.8., University College, London.
On the Sponge Leucosolenia contorta Bowerbank,
Ascandra contorta Haeckel, and Ascetta spinosa Lenden-
fold “MCP lave Wy) ea sececare wena sage ston eerie ache cectanny season ees
Mircuent, P. Cuaumers, M.A., D.Sc., Secretary to the
Society.
Exhibition of photographs of Hippopotamuses swim-
AQUI OSes sista steve ior means ans ale em lntnl: vintietaneci chine anomie sch cavyeme ner kals
Report on the Additions to the Society’s Menagerie
during the montuhioty Aprils OO a knees ease eee
On the Anatomy of Limicoline Birds; with special
Reference to the Correlation of Modifications ............
Report on the Additions to the Society’s Menagerie
Ghoverraver Hae wavoraiiln, CHE Wea INOS, coecdosacnasdoonoceassson00nce
Notice of amemoir entitled ‘On the Intestinal Tract
Cree ER TODLTEEh (Ss eee ee am RMA MAROC esa oadanasasdoavecdoonaed sobOncor
Report on the Additions to the Society's Menagerie
during the months of June, July, August, September,
and ‘October 1900 » ks. 1. See ene tere tect ne seco ee
Report on the Additions to the Society’s Menagerie
during the month of November 1905 -..0..2..2).00 22.2...
Exhibition of a coloured print of Polito’s Royal
Mienagerteyat HxeterChancerias.wiaaessee eae eeeeeeee eee
Page
309
325
329
155
180
184
295
489
XV1l
Page
Muper, Grorce P., F.Z.S.
Exhibition of, and remarks upon, a Dogfish with
abnonmalevisceray (tetas: soa. soetoaee sania <Boa Ae eae ane 490
Exhibition of, and remarks upon, an Earthworm with
JeyORUG Ge WIL ee Sea ead Ua oy een Ene er a inca ge aoe a ie en tae 490
Norcsa, Baron Francis, Ph.D.
Remarks on the supposed Clavicle of the Sauropodous
WimosatunewPr pl OV OCs nasa sas EA e aca kn Site eee ae aces 289
OGILVIE-GRAN7, W. R., F.Z.S.
Exhibition of a series of bird-skins from Japan ......... 324
Pam, Capt. ALBERT, F.Z.8.
Remarks upon a living specimen of the Violet-cheeked
TE licurowarne vee horned Shen one saaseodate eiedlnnelecders «kta ots vied Mee Ee 324
Prarce, Nice D. F., M.A., and Wareurton, Ceci, M.A.,
EE ZES:
On new and rare British Mites of the Family Oribatide.
(GBlates) XK NOX Fan oO ceeda casauiat va suse sbeoele 564
Pocock, Reeinaup innzs, F.L.S8., Superintendent of the
Gardens.
Exhibition of a specimen cf the Spanish Tarantula ...... 3
Observations upon a Female Specimen of the Hainan
Gibbon (Hylobates hainanus), now living in the Society’s
Carcdens "(Plate AVG \is econ tinsc atm nyu amare: aes 169
Exhibition of a Jamaican Scorpion (Centrurus insu-
Lonats NearevINS VOUNS OW 16S) DACk sree a-eeeeer slece seen 183
Proc. Zoou. Soc.—1905, Vou. LI. b
XVill
Pycrart, W. P., F.Z.8., M.B.O.U.
Contributions to the Osteology of Birds.—Part VII.
Hurylemide; with Remarks on the Systematic Position
of the Group. (Plate IT.)
eee meee reece est eee eee see eee eee sesees
Ravcuirre, C. Detm&-. See DeEtM&-RaADcLIFFE.
Reean, C. Tats, B.A., F.Z.8.
A Revision of the Fishes of the Family Galaxiide.
(Plates X.—XIIT.)
Cee i eo i ee i i i ce eed
RipEwoop, W. G., D.Sc., F.Z.S.
Exhibition of microscopic preparations of the regene-
rated vertebre of the tails of Dormice
See wee wee eee e eee ee ree
Roruscuinp, The Hon. L. Watrer, M.P., D.Se., Ph.D.,
E.Z8.
Exhibition of specimens of a rare Marsupial (Dacty-
lopsila palpator)
sHelejaishejeleveheis) eheleisleleieiajelelslacalelelslielsrejclslelelelsiisiis/aiajerelelclelerelajetsie
Exhibition of two tusks from Abyssina
SCHERREN, Henry, F.Z.S.
Exhibition of lantern-slides of, and remarks upon, old
pictures of Anthropoid Apes
See eee nese es ece eres es eeeeeerssens
SciaTer, Pattie Luriny, M.A., D.Sc., F.R.S.
Letter from Mr. W. Rodier on the Rabbit-pest in
Australia
DP ODN IO SIO OOOO OCOOFCOODUOOOOCOOSCUOODUOS OO Ae COUDDDDOODOKOUSS
SLADE, FRANK, F.Z.S.
Exhibition of photographs of a Sea-Anemone in the
process of division
ohekeheieiesaye)aksis)efe(eisaielejaletelelejelelsisivisielelaisisletsielisislclalensinien iets
Page
30
363
494
297
297
298
298
Xix
Page
StapLEs-Browne#, RicHarp, F.Z.8.
INote‘on! Hereditysnm Breeons® Ses. .)--65.083)- ssc eee 550
THomAs, OLDFIELD, F.R.S., F.Z.S.
Description of a new Golden Mole (Amblysomus corric)
bromine @ anes COlOmyg met cane. sce cen duscn sees sansiemennnd tier ee aes D7
Description of a new Bush-buck (7ragelaphus haywoodi)
frOMpiDciLishe Hash Adricay | le cdiciocs sous ects socensnemnene 9: 180
Exhibition of specimens of Mammals and Birds from
Japan and description of a new Marten (Justela
TELOMUDUS! DEE SOTLOO)o ei sacilev ae toss ecient oles ecm acces 182
The Duke of Bedford’s Zoological Exploration in
Kastern Asia.—lI. List of Mammals obtained by Mr. M.
Ie Jame leasolim deysran (ellen) IDC5)\bo46 non souosabonbaossusoes 331
Exhibition of, and remarks upon, tails of Dormice
showing regeneration of the vertebrae ...................0000 49]
On a Collection of Mammals from Persia and Armenia
presented to the British Museum by Col. A. C. Bailward.
(ler te SNOW ALE) ih. tae certain May RENE SE ob ama tneouns cena 519
Watt, Capt. F., C.M.Z.S., Indian Medical Service.
Notes on a Collection of Snakes from Japan and the
WMoowhoorlslands) Er eaticsc.cecesocmetece took wales oases ata 51]
Warsurton, Cecin, M.A., F.Z.8., and Pearce, Nicet D. F.,
M.A,
On new and rare British Mites of the Family Oribatide.
(Plates XTX. & XX.) ieee cesses sees cece seca eee eee eeerne ees d64
LIST OF PLATES.
1905.—Vot. II.
Plate Page
eC lathrinaxcontonbapeipe ed. (spec ewe he eh ean 3
Il Osteology of the Burylemid@ ..........0+,.+csss ss, 3
Il.
IV SIRUUIS OF LEOMO MDs wucocdosseecuoobiesesocccepnceés 75
Wo. JEOMOO MOS TATTOO” Sages Coda sweeney oc aches 6: 169
VI, 1. Anohs gadown. 2. Anolis hogaster ................ l oar
VII. 1. Sceloporus gadovie. 2. Leptodira guilleni .......... z
VIII. White-maned Serow (Nemorhedus argyrochetes) ...... 329
EXC ee Maisielamelanypusl Ged {oral nee a4 aa ee del
X. 1. Galavias affinis. 2. G. huttoni. 3. G. punctifer.5
ib CRUD LOLE Bas coca Bare cht ed Be nee ec MEIN te RES
XI. 1. Galavias weedoni. 2. G. waitii. 3. G. olidus. 4. G.
DEA CIIIS eee aol acura eietoo HSS iGiGen es ois Meee 303
XII. 1. Galaxvias attenuatus. 2. G. coxii
XII. 1. Galaxias auratus. 2. G. attenuatus. 3. G. findlay?. |
a New species of Bladder-clawed Halticide ............ 398
XOV CHORUS AOS WMD “sv owaceob who doodbo dbs so bobh deo 519
XVII. Figs. 1-5. Ptychognathus pusillus. Fie. 6. P. barbatus . >
XVII. Figs. 7-15. Palemon (Eupalemon) lar, var. Figs. 16-19, +537
ula CLA DUCUEINOM)) pUAMe: raleread cca s caked Heron eee )
XIX.
a BES OR CaHA ee eae a ae cn eee 564
Dare ww
LIST OF TEXT-FIGURES
1905.—Vot. II.
lirst-year antlers of certain species of Deer...... sede blo
Spicules of a specimen of Clathrina contorta from Roscoft
Spicules of two specimens of Clathrina contor/a {rom Banyuls. .
Spicules of the ‘ spinosa” variety of Clathrina contorta ......
Spicules of Leucosolenia, Sycon, and Clathrind 1... ccs. cece es
Abnormal gigantic spicules of the class of the monaxons from a
specimen of Clathrinu contorta from Banyuls. . .
CC ee et
Brain of Helictis personata, dorsal aspect ...............00
Brain of Helictis personata, ventral aspect, with the arterial
system shown in thicker cit thinner black lines .........
Pancreas and adjacent regions in Helictis personata ..........
. Pancreas and adjacent region in Galictis barbata ..........4.
. Intrathoracic aorta of A. Helctis personata; B. Galictis
TOURS ee 006 Breese shaeans ane: Mera Uhre diego
Intrathoracic aorta of Suricata tetr adect “Ale done ence ok ie
Sternum of Calyptomena, showing the Sines (animmcnted)
SPUMAROX LORNA OLE. ana. crater Restrain bapa se aionrces te ut 219100 01d OND
Portion of the shoulder-girdle of Ca branes Maton atin vaults :
. Dissection of arm, dorsal aspect, of Hwrylemus ochromelas ....
Eumeces algeriensis. Ventral aspect of brain, showing chief
EL OTIOS 0015 sesamin SH OCU COLAO THOODE OKs Cb dn ae :
Gerrhosauus flavigularis. ‘enim aspect of brain, showin ing
Chietfarteniesma canmcicrriar a5 SRN RCE annie eda epee
Tupinambis nigropunctatus. V anne aspect of brain, esiendth ing
Chiehanteniesia see een Sasa ema Mss he FERRO HONS He
. Python molurus. Ventral aspect of brain, owine chief arteries.
. Testudo vicina. Ventral aspect of brain, clowdass chief arteries .
. Testudo vicina. Lateral aspect of brain, showing chief arteries .
Side views of nose-leaves of Bats, showing the principal forms of
the connecting process in the Rhinolophus simplex group (a)
aavel Waa Jia, Lemans eiamnyy (O, GC!) oovhdacednoodondasoons 2M
XXIV
Page
. Wing-structure of Chionts alba ........ 0. sees seen ee eee 156
24. Diagram of intestinal pattern of Rhynchea capensis .......... 157
25, Diavram of intestinal pattern of Hydrophastanus chivurgus .... 158
. Shoulder-muscles of Gtdicnemus scolopav ....... eee veen, 159
pBicepsior (OA7a7ts) a 10c: iterate elke ffenestr 161
DS, Wine ners or Claws GL cooacecnnogcndcen00gs2055 05% 166
} Wileyniart MIGROS aA s eo aso ucokoo cud oes eweBaae OD 3 ea ee 193
. Diagram of the distribution of 250 Mexican species according to
WA WRAVECTEN Cn toe cene a eR RENS eSNG tio BLO: O DIG ERO ERS PNP se 39:9 020 "0 229
. Diagrams to illustrate the contours of Mexico at different geo-
ios Gell: SYS as ota, cal erecinoip.2.ckaie sean Mibtbhele ohare ReO oe Acre o's 235
2, Diagrams to illustrate the contours of Mexico at diferent geo-
logical CEC ah cient tan cen as DIA ee GSS MTOM SO Octo > 236
. Liver of Gerrhosaurus flavigularis, ventral aspect ............ 259
. Liver of a second example of Gerrhosaurus flavigularis, ventral
AGUOGE cooocrongooonaoracaopgnsee000b000 aianeacsasekaroteeaene 259
. Gastro-hepatic ligament of Gerrhosaurus flavigularis, showing
COUMNS Ort wemsomllaye lyme, co ceanAcancaccucascasdoauover 261
36. Pancreas of Lacerta ocellata and of Gerrhosaurus flavigularis .. 262
. Aortic arches and first part of dorsal aorta of Gerrhesaurus
LORUTOUNDIOS “a obavccseosecbaasonsaasasccanguvaeconacoar 268
. Abdominal region of aorta of Gerrhosaurus flavigularis ...... 264
. Lateral view of brain of Varanus exanthematicus and of Tupi-
JOCHMOS TOU SUIVOKDUIS. ga got ecg egoeoosoooebensanouaene 268
. Dorsal view cf brain of Varanus evanthematicus ............ 268
, Whe ka OP AlGDMOS COUOMUB soo 00cncscedcossbccoucecadan 981
2), hs jalan Grvslenmays ooo asdpockoaheacoosnnaso ses boo 0G0- 282
3. A section of a portion of the placenta of Acomys ............ 983
. A section through the junction between trophoblast and tropho-
sponpia of Acomys ......... 220 eee eee eee eee ee 284
. A diagram of a section through the centre of the placenta of
ACT Gs o one 000 poganeon an sorb de soaedsassaaenoncodeoe 285
. Supposed clavicula of Diplodocus ..................... 0005 290
, Seine Ione Git IDG WOCOGNSs onc osc on ns codon cs edooecsopodbor BOO
. Diagram of penis of Struthio ..... 66. eee eee eee eee 291
. Os penis of European Otter ................. 0. seen eee 292
5), Wine Sages cadhens OF Uwlhyms 0. sb sccooocanseaassneccsoccs 299
51. Early figure of Chimpanzee, from Astley’s ‘Travels’ ........ 301
52. A, lateral, and B, upper view of the skull of Vulpes ferrilatus.. 304
53. A, upper, and B, lower right molar series of Mecrotus waltoni.. 307
Rul, Wing lBlaelke Cineneves (COMO SHUICUS) sob ehoccoeenct dns ses6e 325
55. The Mantled Guereza (Colobus palliatus) ..................5. 326
56. Sharpe’s Guereza (Colobus sharpet) ..... 1.60... eee eee eee, 527
57, The White-tailed Guereza (Colobus caudatus) ........6.++.. 327
58. The White-thighed Guereza (Colobus vellerosus) ..........45 328
59, Principal arteries of Hatteria ..........----+++2++s+2 sees 463
60. Anterior abdominal and portal veins of Hatteria ............ 465
61, Heart and aortic trunks of Ophisaurus, to illustrate mode of
OMIM, Oh CAMOUCL A bebgduoe cvcodcodadaceanccannecansaac 469
XXV
Page
62. Intestinal arteries and portal of Ophisawrus, from left side ATL
Gaueenalearteries) of Opnisarncsmam ead tyes. al eter rats) =e . 478
64, Hepatic portal system of Ophisaurus ........... 2550 ee Sede ACO
65. Renal veims! of Ophisaurus . 1.02.1 ee ee ee ee eee 47
66. Membranes uniting vena cava and left lung in Amphisbena
UVR & 0 bho 0 Oke DH Denes CONMe dG woo OG ODOUUpOOCooN 481
67. Liver of Amphisbena brasiliana, ventral view ..........+++- 485
68. Kidney, testis, and intervening veins of Amphisbena brasiliana, 486
69, Origin of subclavian in Amphisbena brasiliand 1.1... 6.0. eee 486
70, Tail-vertebree and regenerated appendix of a species of Central
EXSY JUNCTIONS 0B Sneed ode'9 00.0.8 Hib oo olla ole Go OcleIDIb 0.4 493
71. Tail of a species of Graphiurus from Fernando Po showing
regenerated appendix ........... see eee eee esters ees : 493
72, Melia tessellata from Mauritius, holding an actinian in oucla
Claw wari ers fe eenitaictieets eee rihchat ation aaetare cet afcomel ca eet wo. 495
73. a. Melia tessellata from the Maldive and Laceadive puidefipalie-
goes, bearing in each claw a sea-anemone, 0. The “ hand”
Joollionayer hil Byateaalons; Gh oeooconnnodoac Be al hen ROE 496
74, Melia tessellata from the Hawaiian Islands, bearing an expanded
actinian in each claw ...... Sie he toa a Gnionn pions Liao anots Crete 498
75. Claw of Melia tessellata showing the two rows of spines ...... 500
76. Melia tessellata dislodging a feed actinian by means of its first
mmo wa cory: Ianb ie ey telesales SRSA Eee PLU ancien 3 mrt 502
77. Téte de Morenoa orizabensis, en dessus et de profil.,.....-... , 618
78. Ventral view of Pontodrilus crosslandt......60. 11sec eens soo WSO)
79. Ventral view of Pontodrilus laccadivensis ........+-++.eeveees 560
80. Lycosa tasmanica ........ DD a Bean vcs Rnmestrtethey cme pee Gn cog 572
Sil, Jiyaose HN Re oa Ae poo yous Orage dope 5 yaa t 574
G2) Eycosa) MOlNeULD neo ee ee se eee oe 575
SB, JUNCOST COSMMNAD .whbs took one deaccacad . O77
Sul. IGNGOSE GiwkS gon odoovabardvonos daa coeeson soot oos conc Doe 579
Sa, IMGT WOOP papas encboces gates cobhenoactogo Non Donen lak 581
SO, JONCICU GUGUE Baannbneeds sees 008000 Ans > Oud oC Omu a anCD 6 582
Gils ILpICOSe GHATS Vo one bbs be ce moce ss eroor uuu ouoDCuon oan oOr 085
SSN cosa arenanis no esaaee- esses esos Sdver seas oso nso do 587
SOs eMolamedes Wabtusinnn 1 saute aul an > ys ae CY Ren CCRC Ea 588
Proc. Zoou. Soc.—1905, Vou. II.
LIST OF NEW GENERIC TERMS
PROPOSED IN THE PRESENT VOLUME (1905, vol. I1.).
Page
Dryomys (Mamm.) ............... 348
EHurynannus (Hemipt.) ......... 153
Glirulus (Mamm.) ............... 347
Page
Hedonistes (Coleopt.) ............ 278
| Levenna (Hemipt.) ............... 151
| Morenoa (Ophid.) ......... 517, 518
PROCEEDINGS
OF THE
GENERAL MEETINGS FOR SCIENTIFIC BUSINESS
OF THE
ZOOLOGICAL SOCIETY
OF LONDON.
1905, vol. IL.
PART I.
CONTAINING PAPERS READ IN
MAY ann JUNE.
OCTOBER 1905.
PRINTED FOR THE SOCIETY,
SOLD AT THEIR HOUSE IN HANOVER SQUARE.
LONDON :
MESSRS. LONGMANS, GREEN, AND CoO.,
PATERNOSTER-ROW.
a [Price Twelve Shillings} _ 5S
lS OF 90 ON aN ES:
1905.—Vot. IT.
Parr I.
May 2, 1905.
The Secretary. Exhibition of photographs of SEUNG Swindining’ st... |. ana
Mr. R. E. Holding. Exhibition of, and remarks upon, a series of the first-year ‘riggs of
adil ID Se Sad Gas OOP RIGNe Oconto 6 Man ms SoA OG MOU b Oeics Sr bhd ae CaN oie:
~ Mr. R. I. Pocock, F.Z.S8. Exhibition of a specimen of the Spanish Tarantula
Mr. W. Bateson, F.R.S. Exhibition of, and remarks upon, specimens of Fowls illustrating
peculiarities in the heredity of white plumage ..+......---.. ec eee cece eee tee
i On the Sponge Leucosolenia contorta Bowerbank, Ascandra contorta Haeckel, and
Ascetia spinosa Lendenfeld. By E. A. Mincuiy, F.Z.S8., University mae London.
(Plate L.) cee cece cee eee ee cee tere eee e ee cece ee eee etree nets ensue ee
[2x]
2, Some Notes upon the Anatomy of the Ferret-Badger, Helictis personata. ae Reine K.
BHDDARD, MuAT HORS, eb rosector tO tae SOCIeby, cr. )cive No a Sunita cre 'enelis Weve lelsuaiereiaiare ti
3. Contributions to the Osteology of Birds.— Part VII. Hurylemide ; with Remarks on
the Systematic Position of the ne, By W. P. Pycrart, E.ZS., M.B.0.U. -
7 TSES GU, Vy a RRO ani neh ATT Marner eh OU CA beta UNSEEN A Ba
May 16, 1905.
The Secretary. Report'on the Additions to the Society’s Menagerie during the month of
iparp PM Getic af teks al ere bbeifare ju 6 Oak cue tere Ste Ne PSUR Ce es ciet bio egate’' «ta! « s 9
Mr. Oldfield Thomas, F.R.S. Description of a new Golden Mole (Amblysomus corrie)
Hyori ibl CFs 0\2. Offa Uh as Maeno naaresce ba era cis Monnet rein Stic) SA CnG eMmnyERE: -\cr0
Mr. H. B. Fantham, F.Z.8. Exhibition of microscopic slides and description of a new
Sporozoon, Lankesterella, tritonts.. 2. +2. cece cece eee ete cee cet eee teens
1. A Contribution to the unwise of the alte Arterial System in Sauropsida.
By Frank E. Bupparp, M.A., F_BS., Brosector tothe, Societyacace sane toes ao.
2. On the Nomenclature of the Anthropoid Apes as proposed by the Hon. Walter
Rothschild. By Sir H. H. Jounsron, G.O.M.G., K.C.B., F.Z.8. .-..c0cs cece ee eeee
3. On some Bats of the Genus Rhinolophus, with Remarks on their Mutual Affinities, and
Descriptions of We nis new Forms. By Kyup Anpursen. (Plates III. & SAV 2) te
59
4. On Stridulating Hemiptera of the Subfamily Halyine, with Descriptions of new ©
Genera and new Species. By Dr. E. Bercrowu, C.M.Z.S., Tammerfors, Finland .
146
Odiiaas continued on page 3 of Wrapper.
PROCEEDINGS
OF 'THE
GENERAL MEETINGS FOR SCIENTIFIC BUSINESS
OF THE
ZOOLOGICAL SOCIETY OF LONDON.
1905, Vol. II. (May to December).
May 2, 1905.
Dr. W. T. Buanrorp, C.I.E., F.R.S., Vice-President,
in the Chair.
The Seeretary exhibited three large photographs (now in the
Society’s Library), presented to the Society by Mr. Howard B.
Turner, of Hippopotamuses swimming in a river in their native
haunts. ae
Mr. R. EH. Holding exhibited and made remarks upon a series
of antlers of the first year of the Roebuck, Red Deer, Fallow Deer,
and Wapiti. The exhibit had special reference to a paper read
by Mr. Martin A. C. Hinton at the meeting of the Society held
on March 21st, on some antlers of the Red Deer (Cervus elaphus)
which were obtained from the Post-Pliocene deposits in the
South of England, and in which it was stated that “these antlers
belonged to individuals that had suffered testicular injury at an
early period of life, by which the characters of youth were
retained for a longer period than usual.”
Mr. Holding pointed out from the specimens exhibited
(text-fig. 1, p. 2) that the long pedicle, suppression of tines, and
presence of rudimentary offshoots were characteristic of the
antlers of all the Cervide at the first year or “ pricket” stage, and
were not therefore due to testicular injury, and that any inter-
ference or injury to the generative organs, as in castration, did
Proc, Zoou, Soc.—1905, Vou. I. No. I. 1
ON FIRST-YEAR ANTLERS OF CERTAIN DEER. [May 2,
Text-fig. 1.
First-year antlers of certain species of Deer.
A, Red Deer; B, Wapiti Deer; C, Fallow Deer; and D, Roebuck—showing adven-
titious points marked X not being analogous to or the predecessors of the
characteristic “tines” of the adult antler. E, lower portion of a pair of
antlers of an aged Fallow buck, showing reappearance at the base of the left
antler at X of one of these points or characters of the immature stage.
IP 409,90 Saro HL 211
ale & Damelsson [tt
B
CLATHRINA CONTORTA
1905. ] ON THE SPONGE CLATHRINA CONTORTA. 3
not prolong or retain youthful characters of the antlers, but, quite
the contrary, caused them to grow irregularly or had the effect, of
entire suppression of the antler.
He stated that very frequently an aged Stag or Fallow buck
would throw up supernumerary snags at the base of the antler
(text-fig. 1, E) or along the side of the beam, which somewhat
resembled, and were probably a reversion to, these immature
characters, and that there were several records of aged or barren
hinds growing the simple “ pricket” antlers of the first year.
Mr. R. I. Pocock, F.Z.S., exhibited and made remarks on a
specimen of the Spanish Tarantula, Lycosa hispanica, that had
died in the Society’s Gardens.
On behalf of Mr. R. C. Punnett, F.Z.S., and himself, Mr. W.
Bateson, F.R.8., F.Z.8., exhibited specimens of Fowls illustrating
peculiarities in the heredity of white plumage, and made the
following remarks :—
A pure white breed such as White Leghorn, crossed with a dark
breed such as Brown Leghorn, gives a cross-breed substantially
white, the colour being recessive. The White Rose-comb Bantam,
however, crossed with a coloured breed gives coloured cross breeds,
the white being recessive. But in every specimen examined
carefully these recessive whites were found to have one or more
minute ticks of black pigment. Though, superficially regarded,
these ticked whites would be classified as white, experiment proves
them to be entirely different in nature. These facts elucidate the
paradoxical accounts given by Darwin and others that Black and
White Bantams crossed together give both blacks and whites;
for the black may fully dominate over the white in this particular
Case.
The following papers were read :—
1. On the Sponge Leucosolenia contorta Bowerbank, Ascandra
contorta Haeckel, and Ascetta spinosa Lendenfeld. By
H. A. Mincamy, F.Z.8., University College, London.
[Received March 16, 1905.]
(Plate I.* and Text-figures 2-6.)
The Calcareous Sponges have been a very unfortunate group,
from the systematic point of view. From the time when Haeckel
swept away all previous generic names, in order to found his so-
called natural system, up to the present day, scarcely any two
* Wor explanation of the Plate, see p. 20.
|*
4 PROF, E, A. MINCHIN ON THE [May 2,
authors have been in agreement as to the names to be employed
for the genera or as regards the grouping of the species, especially
in the more primitive and interesting section of the Calcarea
Homoceela.
The characters, for instance, by which Breitfuss defines the
genus Leucosolenia of Bowerbank (1864) are suchas would exclude
from it all, or nearly all, the species which I should refer to it,
including, as I have shown elsewhere, even Bowerbank’s type
species of the genus, LZ. botryoides ; while Lendenfeld has always
consistently declined to make any use at all of the oldest generic
name amongst the Ascons. In short, with the exception, perhaps,
of the malarial parasites, there is probably no other group in the
animal kingdom in which the nomenclature is in so confused a
state as in the Homocela. The species which forms the subject of
the present memoir illustrates well the statement just made.
It is a veritable comedy of errors that I have to set forth.
The name Leucosolenia contorta was given by Bowerbank in
1866 [1] to certain small sponges from the Channel Islands—
Guernsey, and the Guliot Caves, Sark. It is not very clear,
however, what Bowerbank considered the distinctive characters
of his species, since his diagnosis would apply to almost any Ascon,
He states that “the form of this sponge is so distinctly different
from that of Z. botryoides that ....it cannot well be mistaken
for that species... . Z. contorta always appears to consist of a
mass of contorted inosculating fistule.” Further, that “the
external surface of Z. contorta is also sparingly furnished with
recumbent acerate spicule, mostly disposed in a longitudinal
direction, and I have never observed like spicule on the surface
of L. botryoides.” He was a little doubtful if his sponge were not
really identical with Spongia complicata Montagu (1816), but
came to the conclusion that Montagu’s figure of complicata was
“really a very characteristic figure of Spongia botryoides of Hillis
and Solander,” and that therefore the name complicata was to be
rejected. Finally, Bowerbank remarks that contorta and coriacea
might be mistaken for each other in the dried condition, but that
‘“‘the total absence of defensive spicule on the cloacal cavity of
L. coriacea” (meaning apparently the gastral rays of the quadri-
radiates) readily distinguishes it,
If we put Bowerbank’s description into more modern terms, it
amounts to this—that Z. contoria was characterised (1) by form
and appearance (contorted inosculating tubes), (2) by the presence
of triradiate, quadriradiate, and monaxon spicules. The term
“equiangular ” applied by him to the triradiate systems need not
be taken into account, since he applies the same term to the
sagittal spicules of botryoides. It is not necessary to point out
that the characters given by Bowerbank are not sufficient to define
a species of Ascon; and when it is seen that botryoides always
has monaxon spicules, as [ have shown elsewhere, and that contorta
may frequently lack them; that the specimen of botryoides from
which Bowerbank figured spicules (Brit, Spong, 111. pl, iii, figg, 3, 4)
1905, | SPONGE CLATHRINA CONTORTA, 5
was really a specimen of variabilis, while the specimen of contorta
of which the spicules were figured (U. c. figg. 8, 9, 10) was really a
specimen of complicate ; and that amongst nine of Bowerbank’s
specimens examined by me I have found four distinct species
confused together—to wit, complicata, variabilis, coriacea, and
“ Ascetta spinosa Lendenfeld”: I think it is not necessary to say
more in support of the statement that Bowerbank’s species
contorta was of absolutely no systematic value whatever, but
represented merely an ill-defined jumble of different species.
In 1872 Haeckel, in his ‘ Kalkschwiimme’ [2], used Bowerbank’s
specific name contorta for a sponge which he described in detail.
Haeckel pointed out quite rightly that the external characters of
contorta as set forth by Bowerbank were no guide whatever to its’
identification, since a quite similar mode of growth characterises
other Ascons. Haeckel therefore diagnosed contoria by details of
its spiculation. The diagnosis given is incorrect in two points,
namely, in stating that “the monaxons possess a lance-head at
their distal extremity, and that the gastral rays of the quadri-
radiates are “curved oralwards”; two statements that lead me to
suspect that Haeckel’s material of contorta was, like Bowerbank’s,
contaminated by admixture of Lewcosolenia complicata. Haeckel, in
his description, also affirmed, in his usual manner, definite characters
in the spiculation without taking into consideration the variability
which is so marked a feature of the sponge. It is a puzzle to me
how Haeckel arrived at the definition which he gave of Ascandra
contorta, since the specimens named and identified by him which
I have seen do not agree with his description, and belong, indeed,
to other species—a fact which easily explains any errors of
description on his part. It is even more mysterious that Haeckel
should have considered his contorta identical with Bowerbank’s
contorta, since, of Bowerbank’s specimens examined by me, eight
in all, not one agrees with Haeckel’s diagnosis! These enigmas
are not, however, of importance to the present enquiry. Taking
Haeckel’s description as it stands, and allowing for a certain
margin of inaccuracy, I have been able without difficulty to refer
to Haeckel’s Ascandra contorta a sponge extremely abundant on
the Mediterranean coasts of France, and occurring elsewhere
also. As I have stated in a previous memoir, I consider that
where previous writers leave us in doubt as to the characters of a
species, Haeckel’s description fixes the application of the name.
J will proceed now to describe the sponge which I regard as the true
contorta, and then to consider the synonymy and application of
the name.
Ascandra contorta H. is a species which, for reasons stated
elsewhere [4, &c.], I refer to the genus Clathrina Gray (1867). It
has a closely reticulate mode of growth, equiangular triradiate
systems, collar-cells with basal nucleus, and parenchymula larva ;
all these being characters which make up my diagnosis of the
genus Clathrina.
6 PROF. E. A. MINCHIN ON THE [May 2,
The specimens of this sponge which I have studied nearly all
came from Banyuls-sur-Mer, where this species is extremely abun-
dant. By the kindness of Monsieur Topsent, however, I have
seen a specimen from Roscoff, not differing in any respect from the
Mediterranean specimens. ‘The sponge therefore has a wide range
of distribution, and is almost certainly to be ranked as a member
of the British Fauna, though it does not appear to be common on
our coasts. Hanitsch has, indeed, recorded it from Liverpool :
I have no reason to doubt the correctness of this record
beyond the fact that my experience of specimens labelled contorta
by the most eminent authorities has left me very sceptical as to
the correctness of any identification of this species which I have
not checked ; a scepticism heightened, in the present instance, by
the fact that Hanitsch names his specimens Ascaltis contorta. I
may add that the sponges named Ascandra contorta by Breitfuss
in various memoirs have nothing to do with this species, and
should not therefore be taken into account in considering its
geographical range.
At Banyuls-sur-Mer Clathrina contorta is not only one of the
commonest, but also one of the largest Ascons occurring there.
Colonies frequently measure 8 centimetres or more across. They
consist of a massive or spreading growth of twisted anastomosing
tubes, running in all planes, and forming a dense feltwork from
which arise at intervals the short, straight, not very conspicuous
oscular tubes, which reach two or three millimetres in height,
and are of slightly larger calibre than the body-tubes, as the basal
growth may be called. The body-tubes are centred round the
oscular tubes more or less distinctly, and in the region of the
oscular tube the basal system of tubes is usually slightly raised up
to form a conulus bearing the oscular tube on its summit; but
these conuli are generally very shallow, so that the upper surface
of the spreading colony is nearly flat, not lobulated like that of
cerebrum, nor cushion-like, as in reticulwm—two species occurring
commonly with contorta, but both very easily distinguished from it
at sight. Photographs will make the external characters of contorta
clearer than any description (Plate I.). Of its allies, it is perhaps
coriacea with which contorta might be most easily confused, on
simple inspection ; the latter, however, with its greatly developed
gastral rays, is not found contracted up, with closed oscula, like
coriacea, and when expanded its body-wall is much thicker and
less delicate.
The spiculation of Clathrina contorta comprises in typical
specimens all the three kinds of spicules found in calcareous
sponges.
The triradiate systems are equiangular, with the rays straight,
tapering imperceptibly for the proximal half or two-thirds; after
that tapering more rapidly to a sharp or moderately blunt point
(text-fig. 2, 1a-1f). The distal extremities of the rays are often
irregular in outline, sometimes markedly so. ‘The rays vary in
length from 80 to 130, in different specimens, but may be said
to average 90-100. The breadth at the proximal end of the
1905.] SPONGE CLATHRINA CONTORTA. 7
Text-fig. 2.
1) , ie
/
Spicules of a specimen of Clathrina contorta from Roscoff.
Figg. 1a, triradiate; 1 6-1 e, quadriradiates in facial aspect; 1, abnormal quadri-
radiate with one basal ray wanting; lg-17, quadrivadiates in side view,
showing gastral rays in profile; 1j-1m, monaxons (the spicule represented
by 1, being too long for the page, has been drawn in two pieces).
8 PROF, E. A. MINCHIN ON THE [May 2,
ray is usually 8 or 9 u, but may reach 12; speaking generally,
slender triradiate systems, with rays not exceeding 10p in
breadth, can be distinguished from thick ones with rays exceeding
10 (text-fig. 3,2a-2f). In some specimens the triradiate
systems are all, or nearly all, of the slender type; in others,
triradiate systems of the thick type are more abundant.
Some of the triradiate systems develop gastral rays, becoming
quadriradiates, and others do not. Asarule the quadriradiates
are more abundant than the simple triradiates.
Im some specimens there is a tendency for the simple
triradiates to be of rather stouter build than the quadriradiates,
but in other specimens this cannot be noticed.
The gastral rays of the quadriradiates are attached at the
centres of the triradiate system, and are remarkable for their
slenderness and usually also for their length (text-fig. 2, 1 g-1 2).
Arising from a slightly expanded base, the gastral ray sometimes
tapers rapidly to a point, then reaching a length equal to about
one-half or one-third of that of the basal rays; but more usually
the gastral ray is prolonged to a considerably greater length than
the basal rays, reaching 130, 140, or even 150 » in length.
The gastral ray then becomes excessively slender for the distal
half or two-thirds of its length, and ends ina sharp point; it is
not bent oralwards as Haeckel describes it, but it is either quite
straight or irregularly curved. Haeckel’s figure of a quadri-
radiate (Kalkschwamme, iii. pl. 14. fig. 6c) obviously represents
a spicule of LZ. complicata (compare his fig. 1 e on pl. 15, l.c.).
Quadriradiates are also to be found in which, with gastral rays of
great length, are found basal rays much shorter than usual
text-fig. 2, 1g; text-fig. 4, 4e); these are probably young forms
in which the rapid growth of the gastral ray * has caused it to
attain its full length before the basal rays have done so.
In the thick quadriradiates found in many specimens, I have
observed a curious point with regard to the gastral ray, when
seen in the facial aspect of the spicule. When the basal system
is focussed so that the bases of the rays show sharp contours, the
origin of the gastral ray appears as a dark central spot roughly
triangular in outline, each side of the triangle being transverse
to the base of one of the rays of the triradiate system, and the
angles of the triangle rounded off (text-fig. 3, 2a, 2). If now
the focus is slightly raised, the base of the gastral ray appears as
a sharp ring, within the triangle. The dark triangle appears to
be the expanded base of the gastral ray, but it is only to be seen
in the case of the thickened triradiate systems, not in the slender
ones.
The monaxon spicules of Clathrina contorta vary in the most
singular manner, constituting the most remarkable feature of the
species. The variations are best considered, first, from the point
* As I have described in a former memoir (Quart. Journ. Micr. Sci., n.s. xl.
pl. 42. fig. 55), the elongated gastral rays of contorta are covered by a plasmodial
mass containing four nuclei, more than I have observed on the gastral rays of any
other Ascon.
1905. | SPONGE CLATHRINA CONTORTA. 9
Text-fig. 3.
gh
Ga
eh
Spicules of two specimens of Olathrina contorta from Banyuls.
Figg.2a@ & 6, thick quadriradiates; 2¢ & d, slender quadriradiates; 2e & f,
triradiates; 2g, quadriradiate showing gastral ray in profile; 2/,a monaxon,
3a & b, quadriradiates of another specimen ; 3 c-3 h, monaxons.
10 PROF, E. A. MINCHIN ON THE [May 2,
of view of substantive variations of form and size; secondly, as
regards numerical variation, that is to say abundance of monaxons
compared with other types of spicule.
The monaxons are all of large size, being at least twice as
thick as the basal rays of the triradiate systems, and not less than
300 » in length, allowing for those which are apparently not full-
grown. But in some specimens the monaxons reach a size which
can only be called gigantic. In a specimen from Banyuls sent
me by Topsent (which I will refer to as Topsent 12¢), the
monaxons, when drawn to the same scale as the other spicules
figured here, come out 32 centimetres in length, corresponding to
an actual length exceeding 1000p (1 mm.), with a breadth of
about 50 at the thickest part. Even these proportions are
exceeded by a specimen in my collection from Banyuls, in which |
the monaxons when drawn to scale measure 75 centimetres in
length, corresponding to an actual length of 2343 (2°3 mm.).
I do not think that spicules of such size have been recorded from
any Ascon. The large monaxons of Ascandra densa and A. parus
figured by Haeckel (J. c. pl. 14. figg. 2c, 3,f) fall far below those
that I have mentioned in dimensions. With these extraordinary
variations in size, the form and characters of the monaxons are
fairly constant (text-figg. 2 and 3, 1j-lm, 2h, 3c-3h). They
are spindle-shaped, pointed at both ends, slightly curved, some-
times distinctly so when more slender, or nearly straight when
very thick. There is no lancet-head present at the distal ex-
tremity, as figured by Haeckel; his figure (/.c. pl. 14. figg. 6 d,
6 ¢) almost certainly refers to complicata (compare his figg. 1 g—-1 k,
on pl. 15). It is, indeed, impossible to say which is the distal end
of these monaxons, as they do not project from the sponge like
the true (primary) monaxons of other Ascons. Near the middle of
the spicule, sometimes at about one-third of the length from one
end, a slight constriction can be observed, sometimes very distinct,
in others very shallow, in others again represented by an annular
thickening, and sometimes not to be made out at all. This con-
striction is more distinct in young spicules, and appears to become
more or less obliterated with growth. In big spicules the
contours are often so sinuous and irregular that the primary
constriction may be masked by secondary curves. I consider this
primary constriction, as I propose to call it, of great morphological
importance, as indicating probably that these spicules are not
primary monaxons*, comparable to those of Leucosolenia
conyplicata, for example, but in reality derived from a triradiate
by loss of one ray and shifting of the two others into approxi-
mately the same straight line. In very young monaxons of
contorta I have noticed a delicate transverse line in the region of
the constriction (text-fig. 3, 3¢), and I have also found a spicule
of which it would be difficult to affirm whether it is a young
* A primary monaxon is derived from a single mother cell which divides into two
formative cells, thus originating in exactly the same manner asa single ray of a
trivadiate system.
1905.] SPONGE CLATHRINA CONTORTA. 11
monaxon or an abnormal triradiate (text-fig. 3, 3); probably it
is both! My friend Mr. Alford has also found, in the slide of
Topsent 12 e, four abnormal monaxons which have additional rays
growing out laterally and thus become triradiates (text-fig. 6,
9a-9c). In one of these (96) the three rays are approximately
equal in size and meet at the angles of an ordinary triradiate.
For all these reasons I consider there is much to be said for
regarding the monaxons of contorta as secondary monaxons
derived from a triradiate system by suppression of one ray and
hypertrophy of the two remaining, which become piaced in the
same straight line, or nearly so.
The numerical variation in the monaxons is not less re-
markable. In some specimens scarcely any monaxons are to be
found; in others they are extremely abundant. Thus in a
specimen recently examined by me, I took a fairly large piece of
the sponge, separated the spicules with Eau de Javelle, and
mounted all I could get up with the pipette, covering three slides.
After prolonged searching I found five monaxons to many
thousands of triradiate systems. In another specimen in which
IT could find no monaxons, Mr. Alford by careful searching found
two. It is often extremely difficult to be certain if a specimen
has monaxous or not. Mr. Alford has kindly undertaken for me
the task of counting the numbers of each kind of spicule found
in different specimens, with the following results :—
Triradiates. Quadriradiates. Monaxons.
| Kind of | 5°21 2
Specimen. | Actual |—Per- | Actual | Per- | Actual | Per- Moerene of
number | centage | number | centage number centage servee: | Spicules.
counted.'of whole.| counted. |of whole. counted. of whole. |
sea “yi Pace aerial Pn =o
Alea 93 | 3-278 27 | 96:128 5 Large. | 2837
(Zz 3.a-3h). 3 | 3278+] 272 23+) 17 599+ arge. 3
MIO. 311 | 8304+] 3423 |91402 | 11 | 204+) Lar 3745
(z2a-2h) +| 342 02 aes ae || arge. 3)
INI@ B soosos 886 |12°512+| 2658 |86158+ 41 | 1329+ |Very large.| 3085
No. 4 o47 | 5835+/ 3965 |93668+ 21 | “496+ Very large.| 4233
y
(Plate I. B). | |
IN@s 6) coonee 146 5'144+| 2686 | 94°644+ 6 | ‘211+ | Gigantic. | 2838
No. 6 |
Cow 267 |10°349+] 2188 |84:806+, 125 4-844 | Gigantic.) 2580
12 e). |
Total for ; : Ad
Spacing, } 1450 7506 | 17647 | 91°35 221 1144 19318
These results were obtained in the following way :—‘“ Hach
specimen was put into Eau de Javelle to separate the spicules,
and after careful washing, and being allowed to stand for some
12 PROF. E. A. MINCHIN ON THE [May 2,
considerable time after each washing, the spicules were transferred
to the slides by means of a pipette.
“Hach slide, when ready, then had marked upon its under
surface twenty circular areas, each being brought into the micro-
scopic field in turn and all spicules in each area carefully counted.
When all the spicules were counted the circle was erased and the
next circular area dealt with.
“The counting was done with the aid of a camera lucida and
three differently coloured crayons, thus ensuring that all spicules
were counted and counted once only.
“Hach quadriradiate spicule had a number in blue marked upon
it; the triradiate spicules were marked with successive red
numbers and a green number noted a monaxon. At each
counting a check could be made, and the counting was complete
when each spicule was seen to have one number of a special
colour upon it.”
The spiculation of Clathrina contorta thus shows, on the one
hand, comparatively slight variation in the triradiate systems, and,
on the other hand, extraordinary differences in number and size
of the monaxons in different specimens. The variability is so
marked, and the monaxons are frequently so difficult to find, as
to suggest at once a possible extreme of variation in which the
monaxons would be totally absent. Were this to occur we should
have a variety of the sponge characterised by a type of spiculation
which would lead to its being placed, in many current systems of
classification, in a genus distinct from the variety in which
monaxons occur.
As a matter of fact, I may state at once that the variety of
contoréa in which monaxons are completely lacking is very common,
and it has been described by Lendenfeld from the Adriatic under
the name of Ascetéia spinosa, This is no mere surmise on my part ;
I have been able to examine, in the collection of Canon Norman,
a slide obtained by him from Lendenfeld, and bearing in Len-
denfeld’s handwriting the label “ Ascetéa spinosa.” Text-fig. 4,
5 a—5 h, vepresents some spicules drawn by me from this slide.
As will be seen, the spiculation differs in no single particular from
that of the true contorta, except for the lack of monaxons. Since
the preparation consists of tubes of the sponge mounted whole, it
was not possible to obtain profile views of the gastral rays, except
at the torn ends of the tubes, and in no case was I able to see an
unbroken gastral ray in side view, but the fragments which I have
drawn (5/5 h) are sufficient to prove that the gastral rays of this
specimen attain the degree of length and slendernegs characteristic
of the species. Lendenfeld’s specimen is, in fact, identical in
character with other specimens of “spinosa” which I have from
Banyuls (text-fig. 4, 6 a6 g), and these again differ in no respect
from the true contorta except for the absence of monaxon spicules.
If Ascetta spinosa Lend. is to be regarded, as I believe, merely
as a variety of Ascandra contorta H., how is this variation to be
explained? The specimens of spinosa that have come under my
notice agree perfectly in external characters with contorta, but are
1905. | SPONGE CLATHRINA CONTORTA. 13
Text-fig. 4.
62
Spicules of the “ spinosa” varicty of Clathrina contorta.
Figg. 4a-4f. Spicules of Bowerbank’s type of Leucosolenia contorta in the British
Museum (Bowerbank Coll. 988), showing gastral rays with tendency to irregular
curvature.—Figg. 5 a-5 h. Spicules of a specimen in Canon Norman’s collection
labelled “ Ascetta spinosa” in Lendenfeld’s handwriting ; the elongated gastral
rays (5f-5h) are broken off.—Figg. 6 a-6g. Spicules of a specimen from
Banyuls.
14 PROF. E, A, MINCHIN ON THE [May 2,
all of small size. The big, spreading colonies of contorta always
have monaxons. It is my belief that the absence of monaxons is
simply a juvenile feature, so to speak, of the sponge, and that they
are only formed when the sponge has grown to a certain size.
Such changes of spiculation with age are probably more frequent
in sponges than is usually supposed. Fora parallel case I need
only refer to Topsent’s observations on Cliona celata.
A point which requires brief discussion, however, is why
Lendenfeld found only the spinosa-form in the Adriatic, and not the
contorta-form, if these two forms are really only age-variations in
one species. Are we to suppose that in the Adriatic the sponge
does not acquire monaxons? In my opinion the explanation of
this point is to be sought in quite a different manner. In his
‘ Kalkschwiimme der Adria’ [3] Lendenfeld describes another
species of Clathrina occurring commonly in the Adriatic, namely
C. reticulum. I have also found this species very abundant at
Banyuls, and I possess many specimens of it; but my experience
of this species at Banyuls differs sharply in one respect from
Lendenfeld’s observations upon it in the Adriatic. I find reticulum
to be more constant in external form and characters than any
other species of Ascon. All the specimens I have seen—and at
one time I had some hundreds of specimens, collected in order to
obtain the larval development—are compact, rounded, cushion-
like masses of slender, closely-knit tubes, forming a dense and
finely-meshed reticulum from which arise one or more oscular
tubes of much larger calibre than the tubes forming the body of
the sponge. I have figured such a specimen elsewhere (4, p. 6,
fig. 6). In short I have never had the slightest difficulty in
recognising reticulum at sight, though its spiculation often
approaches that of contorta very closely. My astonishment was
therefore great to find that Lendenfeld describes this sponge as
occurring (at Sebenica and Lessina) in nearly all the forms generally
found in Ascons. There is thus a great discrepancy between Len-
denfeld’s observations and mine with regard to this species,and I am
inclined to think that this is to be explained simply by Lenden-
feld not having recognised the true contorta, but having confused
it with reticulum. This is a supposition which I am unable to
prove or test; but if correct, it would explain why Lendenfeld
did not find the true contorta occurring in the Adriatic as well as
spinosa, and also why he finds vedtiewlwm so variable in form when
in my experience it is so extremely constant. I may add, finally,
that the figures of monaxons of reticulum given by Lendenfeld
(3, pl. viii. figg. 7 e-7f) are more like those of contorta than those
of reticulum, though not exactly like those of either, as these
sponges are known to me.
I will now describe some of the historically important specimens
to which I have had access, and I begin with the type-specimens
of Bowerbank’s Leucosolenia contorta in the British Museum
(Bowerbank Coll. 988). The “type” consists of seven dried
specimens, all very small, stuck on a card, The largest specimen,
1905. | SPONGE CLATHRINA CONTORTA. 15
Text-fig. 5,
Spicules of Leweosolenia, Sycon, and Clathrina.
Figg. 7 a-7 1. Spicules of a specimen in Norman’s collection, received from Bower-
bank with label Leuwcosolenia contorta and identified by Haeckel as Ascandra
contorta ; showing spicules of Leucosolenia variabilis (7 a-7j), mixed with
spicules of Sycon sp. (7k, 71).—Figg. 8a-8m. Spicules of a specimen in
Norman’s collection received from Bowerbank with label Leucosolenia contorta ;
showing spicules of Leucosolenia complicata (8 a-8j) mixed with spicules of
Clathrina coriacea (8 k-8m),
16 PROF, E, A. MINCHIN ON THE [May 2,
the original of Bowerbank’s fig. 7 on pl. ii. of Brit. Spong. vol. i11.,
is at the top over the middle of the card; the other six arein two
vertical rows of three each to right and left. As I have stated
elsewhere, J have examined six out of these seven specimens, and
all of them, except the larger one at the top, are quite typical
specimens of Lewcosolenia complicata ; the large specimen alone is
atrue Clathrina. 1 give figures of its spicules (text-fig. 4, 4 a—4/),
and it is not necessary for me to describe them in detail, for it is
evident from the figures that this specimen agrees with the true
contorta in all respects but one, namely, in that the monaxons are
wanting. In short, Bowerbank’s type-specimen of ‘“ Leucosolenia
contorta,” or, to be more accurate, the only one of his type-
specimens which does not belong to a species of prior standing,
is a specimen of “‘ Ascetta spinosa” Lendenfeld !
I have also examined two other specimens of Bowerbank’s*,
given by him to Canon A. M. Norman, and now in the latter
gentleman’s collection. The first of these was sent by Canon
Norman to Haeckel, and returned by him after examination. It
has the following label in Norman’s handwriting :—
“ Teucosolenia contorta Bow.
““ Guernsey
“(A type-specimen from Dr. Bowerbank).”
Also a label in Haeckel’s handwriting :—
“ Ascandra contorta H.
ue (Leucosolenia contorta Bwhk.)
“ Guernsey, Bowerbank.”
If any specimen in the world ought to have been a specimen of
contorta, surely this ought, bearing, as it does, a double testimonial
to character from the two founders of the species. What, then,
was my astonishment, on examining the spicules, to find it a quite
typical example of Leucosolenia variabilis Haeckel! I figure its
spicules in text-fig. 5, 7a—-71. The only point to notice about them
is a certain admixture of Sycon spicules (7%, 71), which, as I have
set forth in another place, frequently occurs in preparations of
variabilis.
The second specimen in Canon Norman’s collection bears a
label in Bowerbank’s handwriting as follows :—
“ Leucosolenia contorta, Guernsey.”
According to information furnished me by Canon Norman, this
particular specimen was not sent to Haeckel, but it is one of the
same lot as the type sent to him, and has an equal claim to be
regardedas atype. Examination of the specimen shows a mixture
of Leucosolenia complicata and Clathrina coriacea (text-fig. 5,
8 a-8 m).
* Bowerbank in his Monograph mentions twenty-eight specimens of contorta, but
I have had access to only nine of them, Ido not know what has become of the
others.
1905. | SPONGE CLATHRINA CONTORTA. 17
From the foregoing it will be seen, I think, that the name-
question, in the case of the species under consideration, isa tangled
problem, one, indeed, which I feel some diffidence in approaching.
IT could wish, in fact, as I have said elsewhere, that there were in
existence some sort of International Hague Tribunal to which
these knotty points of nomenclature could be referred for arbitra-
tion and authoritative settlement. In the absence, however, of
any such body, I extract from the facts above set forth the
following conclusions :-—
(1) Bowerbank’s Leucosolenia contorta was a jumble of different
species, and his description could not be used for identification of
any particular species. Hence Leucosolenia contorta Bowerbank
is a nomen nudum, of no systematic validity.
(2) Haeckel’s Ascandra contorta, though not in all respects
correctly described, can be applied to an existing species of Ascon,
which can be identified by his description. This I consider the
true contorta: ought the species, however, to be written contorta
Bwk.or contorta H.? Pending the constitution of the International
Nomenclature Tribunal, in order to settle this important point, I
content myself in following Haeckel in calling it contorta Bwk.
(3) Ascetta spinosa Lend. is probably the young form, without
monaxons, of contorta.
IT arrive therefore at the following synonymy and diagnosis :—
CLATHRINA CoNTORTA (Bowerbank).
? Nardoa spongiosa Kolliker *, 1864, [cones Histologice, Abth. 1.
pp. 63, 64, pl. vil. fig. 10, pl. ix. fige. 6-8.
Leucosolenia contorta Bowerbank 1866, Mon. Brit. Spong. 11.
pp. 29-32; 1874, op. cit. 111. pp. 7-8, pl. 11. figg. 5-10.
Leucosolenia (Nardoa) contorta Gray, 1867, P. Z. 8. p. 555.
Leucosolenia (Leuciria) contorta Haeckel, 1870, Jen. Zeitschr.
v. p. 243.
Ascandra contorta Haeckel, 1872, Kalkschwiimme, ii. pp. 91—
93, 11. pl. 14. fige. 6 a6 e.
? Ascaltis contorta Hanitsch, 1890, Tr. Biol. Soc. L’pool, iv.
pp. 195 & 233.
Ascetta spinosa Lendenfeld, 1891, Zeitschr. wiss. Zool. liii.
pp. 203-205, pl. vii. figg. 2, 16, 21, 22.
Leucosolenia contorta Topsent, 1891, Arch. Zool. Exp. (2) ix.
p. 925; Bull. Soc. Zool. France, xvi. p. 128; 1892, Résult. Cam-
pagnes Sci. Albert 1°, fase. 11. p. 22; 1894, Rev. Biol. Nord
France, vii. pp. 7 & 22.
Clathrina contorta Minchin, 1896, Ann. & Mag. Nat. Hist. (6)
Xvlil. p. 399.
* Nardoa spongiosa Kolliker has been put by Haeckel as a synonym of either
Ascaltis cerebrum or A. gegenbawri, but the figures of the external form, no less than
those of the spiculation, given by Kolliker, seem to me to indicate that the author
was dealing with the spinosa-form of contorta. I have discussed this point elsewhere
(Quart. Journ. Micr. Sci. n.s. xl. p. 533, footnote).
Proc. Zoou. Soc.—1905, Vou. II. No. II. 2
18 PROF. E. A. MINCHIN ON THE [May 2,
Clathrina spinosa Minchin, ibid.
Leucosolenia spinosa Breitfuss, 1898, Arch. f. Naturges. lxiu. 1,
pels.
(The following references, on the other hand, probably do not
relate to the true contorta.)
Ascandra contorta Barrois, 1876, Ann. Sci. Nat. (6) 11. Article
11, p. 35, probably refers to Leuwcosolenia complicata.
Leucosolenia contorta Carter, 1880, Midland Naturalist, 11.
p- 195. The author remarks that ‘ Bowerbank’s illustration of
the linear spicule is defective. There are two forms, quite different
from each other and from Dr. Bowerbank’s figure.” I consider
it probable from this statement that Carter was dealing with a
specimen of Leucosolenia complicata.
Ascandra contorta Breitfuss, 1898, Arch. f. Naturges, lx. 1,
. 214, refers to a specimen of Leucosolenia complicata ; so pro-
bably also the sponge described and figured by the same author in
Mém. Ac. St. Pétersbourg, 1898 (vili.) vi. p. 15, pl. i. fig. 1, and
cited by him in other memoirs.
And finally it should be mentioned that the numerous specimens
sent out from Sinel and Hornell’s Zoological Station, Jersey, are
all, so far as I have seen, specimens of Lewcosolenia complicata.
Diagnosis.—Trivadiate systems equiangular, with or without
gastral rays; the quadriradiates generally more numerous than
the simple triradiates. Rays of the triradiate systems tapering
imperceptibly for the proximal half or two-thirds, then narrowing
more rapidly to a sharp or moderately blunt point. Gastral rays
sometimes short, more usually longer than the basal rays, very
slender, sharp, and straight or irregularly curved.
Monaxons at least twice as thick as the basal rays of the tri-
radiate systems,—varying in different specimens from a moderate
size to gigantic proportions, spindle-shaped, usually slightly curved,
and usually with a distinct constriction near the middle of their
length ; sometimes very few in number, sometimes absent
altogether.
The chief objection that can be made, it seems to me, with
regard to my treatment of the species, relates to the position of
spinosa. Naturalists concerned chiefly with the arrangement
of specimens in bottles'on shelves will perhaps object to my
“lumping” together two forms which can be separated by a definite
character, although by one only. Those who reason thus will, no
doubt, prefer to retain spinosa as a “species” distinct from
contorta ; in that case the type of Bowerbank’s contorta belongs
to the former species, a fact which raises alarming problems of
nomenclature. The range of variation seen in contorta has its
natural and logical termination in the form spinosa, and justifies,
in my opinion, placing the latter asa synonym. Moreover it is
often extremely difficult to be certain that monaxons are really
absent in a specimen of “ spinosa.” They may be so scarce that
they have been simply overlooked.
After arriving at the above conclusions with regard to the
1905. ] SPONGE CLATHRINA CONTORTA. 19
identity of contorta and spinosa, it is hardly necessary for me to
express my opinion with regard to those systems of classification
which define not only species but even genera of Ascons by the
presence or absence of monaxon spicules. Before such a character
as the presence or absence of monaxons can be used for systematic
Text-fig. 6.
Abnormal gigantic spicules of the class of the monaxons from a specimen of Clathrina
contorta from Banyuls (Topsent 12¢). Magnified about 150 lincar (i. e. half as
much as the spicules figured in text-figg. 2-5),
purposes, it is necessary to understand clearly what is meant by a
monaxon spicule. In calcareous sponges a spicule of this class may
be one of two perfectly distinct things. It may be, on the one hand,
2%
20 ON THE SPONGE CLATHRINA CONTORTA. [May 2,
a primary monaxon spicule, derived from a single mother-cell,
and developing exactly in the same way as a single ray in a tri-
radiate system, with which it is strictly homologous. It may be,
on the other hand, a secondary monaxon, derived by modification of
an entire triradiate system by loss of one ray, perhaps in some cases
two rays. Good examples of monaxons undoubtedly of secondary
nature aie the elbowed monaxons in the stalk of Clathrina lacunosa
Johnston (renamed Ascandra angulata by Lendenfeld). TI believe
also, as stated above, that the monaxons of contorta are to be regarded
as secondary. It is clear that a character which is sometimes one
thing, in other cases quite another thing, cannot be usefully
employed for purposes of systematic classification, not, at least,
until more is known about it.
If Ascetta spinosa be put as a synonym of Clathrina contorta,
it is seen that the species has a wide range, extending from the
Adriatic round the coasts of France into the English Channel, and
probably also on to the coasts of Great Britain.
Tt is my pleasant duty finally to express my thanks to friends who
have assisted me in the preparation of this memoir, put together
from observations for the most part of long standing, at a time
when the stress of other work, caused by preparations for my
departure for the Tropics, was very great. My friend Mr. G. R.
Alford, who is making a special study of the variation of this
sponge, has given me valuable assistance, as will be evident from
the facts I have quoted from him above. Mr. Alford has also
kindly undertaken to see this memoir through the press for me.
My friend and pupil Mr. L. R. Crawshay has given me great help
in preparing the illustrations. Finally, I have to thank Monsieur
Topsent, of Caen, for his kindness in sending me specimens from
Roscoff and elsewhere and for answering many queries.
BIBLIOGRAPHY.
(1) Bowrrsank, J. 8. A Monograph of the British Spongiade,
London, Ray Society, 3 vols.: 1864-1874.
(2) Harcken, E. Die Kalkschwimme. Berlin, 1872; 3 vols.
(3) LeENDENFELD, R. v. Die Spongia der Adria: I. Die Kalk-
schwimme. Zeitschr. wiss. Zool. li. (1891) pp. 185-321
361-433, pls. vill.—xv.
(4) Mincuin. EK. A. Sponges in: Lankester, ‘A Treatise on
Zoology, London, 1900.
p)
Other references are cited in the list of synonymy, p. 17 above.
EXPLANATION OF PLATE T.
Clathrina contorta from Banyuls.
A from above; B from above, and C from the side, to show the oscular
tubes (O).
1905. ] ON THE ANATOMY OF THE FERRET-BADGER. 21
Some Notes upon the Anatomy of the Ferret-Badger,
Flelictis personata. By Frank E. BeEpparp, M.A.,
F.R.S., Prosector to the Society.
| Received March 21, 1905. ]
(Text-figures 7-12.)
The dissection of a female example of //elictis personata, which
was acquired by the Society on the 4th and died on the 14th
November, 1904, enables me to lay before the Society some new
facts in the anatomy of this genus of Carnivora.
So far as Iam aware, the only zoologist who has investigated the
anatomy of the soft parts of the genus Helictis is the late Prof.
Garrod *, whose memoir deals with the essentials in its structure.
The species examined by him was Helictis subaurantiaca. It is
not therefore unnecessary to report upon the anatomy of another
species, though the differences between the two are, as might be
expected, but slight. I deal, moreover, with a few points upon
which Prof. Garrod did not touch in his account.
S Brain.
The brain of Helictis swbawrantiaca has been described and
figured (in dorsal and lateral view) by Prof. Garrod in his memoir
already referred toy. The figure of the brain of Helictis personata
submitted herewith (text-fig. 7, p. 22) shows certain differences,
which I regard as worthy of record in view of the little knowledge
which we possess upon the matter.
The most salient difference which this brain shows from that of
H. subaurantiaca is the very slight appearance upon the dorsal
surface of the intercalary prolongation of the calcarine sulcus.
This furrow, as will be seen in the figure (text-fig. 7), only
appears dorsally for a short distance quite at the posterior end of
the hemispheres, and also of course anteriorly where the two sulci
join the crucial sulci.
The precrucial sulcus in my specimen is not so fully developed,
particularly upon the left side (text-fig. 7, Pc.S.), as in Garrod’s
specimen of Helictis subaurantiaca. It does not entirely delimit
the ursine lozenge in front.
The Sylvian fissure on both sides of the brain joins the supra-
sylvian, the gyrus anterior tothe Sylvian beingapparently depressed
below the surface of the hemispheres. There is a hint of this in
Garrod’s figure, but hardly in that of Dr. Eliot Smith, though it
refers, I imagine, to the same brain. The remaining fissures agree
absolutely with those of Helictis subaurantiaca. 1 pass on therefore
* “Notes on the Anatomy of Helictis subawrantiaca,” P.Z.S. 1879, p. 305.
+ This brain is also figured in the Catalogue Physiol. Series Roy. Coll. Surgeons,
vol. ii. (2nd ed.) p. 273, by Dr. Elliot Smith.
22 MR. F, E. BEDDARD ON THE [May 2,
to the arteries of the brain, which are most satisfactorily injected
in my specimen and which show all the Arctoid characters*.
The rhomboidal area formed by the bifurcation of the anterior
spinal and its junction with the basilar is of considerable calibre
and uniform throughout, as in all Carnivora which have been
examined.
The vertebral arteries are, however, peculiar in their mode of
joining this rhomboidal vessel. Each vertebral artery in fact
divides before joining the rhomboidal, and each branch opens
separately into it, as is shown in the accompanying figure (text-
fig. 8). The carotids join the circle of Willis just before the
middle cerebral arteries are given off.
Text-fig. 7. Text-fig. 8.
Text-fig. 7—Brain of Helictis personata, dorsal aspect.
Cr. Crucial fissure; Za¢. Lateral fissure; Orb. Orbital fissure; Pe.§S. Precrucial
fissure; S.S. Supra-Sylvian fissure.
Text-fig. 8—Brain of Helictis personata, ventral aspect, with the arterial system
shown in thicker and thinner black lines. The dotted lines delimit regions of
the brain.
b.a. Basilar artery ; Ca. Carotids; Call. Callosal arteries ; P.c. Posterior
cerebellar; v.a. Vertebral arteries.
Anteriorly the circle of Willis is completed by the fusion of the
two callosal arteries, that of the right side being distinctly smaller
than that of the left.
* Beddard, P, Z.S. 1904, vol. i. p. 183.
1905. | ANATOMY OF THE FERRET-BADGER. 23
The posterior cerebellar arteries are asymmetrical in their
origin from the basilar, the left being considerably in front of the
right.
The middle cerebellar arteries arise in front of the sixth nerve.
$ Some Notes on the Muscles.
The muscular anatomy of the Carnivora has been lately treated
of in an exhaustive fashion by Messrs. Windle and Parsons*, As
a supplement to that paper (which does not deal with Helictis) I
am able to offer a few notes upon the musculature of Helictis
personata.
The Sterno-mastoid consists from the very beginning of two
parts: the larger of these is inserted on to the mastoid next and
superficial to the cleido-mastoid muscle; the smaller part crosses
the cleido-mastoid and joins the cephalo-humeral. This latter
portion of the muscle has been spoken of as a portion of the
trapezius, with which, indeed, it is plainly confluent above.
The Sterno-hyoid and Sterno-thyroid appear to arise from the
sternum as one muscle. I could find no tendinous intersection.
The Omohyoidis apparently completely absent. I could find no
trace of it. This muscle is usually present in Mustelide.
The Omotrachelian has exactly the relations described by Windle
and Parsons.
The Rhomboideus profundus, which arises from the supra-spinous
fossa of the scapula near to the root of the spine, is a slender muscle
inserted on to the atlas deep of the omotracheal. It is perfectly
distinct at its origin from the Rhomboideus cervicalis. Its
discovery in Helictis gives further support to Messrs. Windle and
Parson’s belief that the muscle is eminently characteristic of the
Mustelidee.
The Rhomboideus capitis has only asingle origin in common with
the Rhomboideus cervicalis, not the double origin of Jctonya (a near
ally of Helictis) as figured by Windle and Parsons.
The Dorso-epitrochlear is contiguous to and hardly if at all
distinguishable from the extra head of the Z’riceps occurring in
this as in many other Carnivora. The Dorso-epitrochlear itself is
of course part of the Latissimus dorsi; in passing by the scapula it
receives a mass of fibres from the lower border of that bone and
thence becomes continuous with a sheet of fibres arising from the
Teres and constituting, as I imagine, the “extra head” of the Z'riceps
of Messrs. Windle and Parsons, which those anatomists state to be
characteristic of the Mustelide.
The iceps has only one head.
Helictis appears to possess two distinct Palmaris longus muscles.
The Sartorius is Single and fused at its insertion with the also
single Gracilis.
The Pectineus, often a double muscle, is single in Helictis.
* P. Z.S. 1897, p. 370, & 1898, p. 152.
24 MR. F. E. BEDDARD ON THE [May 2,
I found it impossible to subdivide the Adductor mass.
The Semimembranosus is divided into two muscles for some way
in front of its obviously double insertion on to the tibia and the
femur. I could not find, however, that this muscle was divided
at its origin from the ischium,
The Scmutendinosus, as in some other, but not in all, Mustelidee,
has a very distinct caudal head. There is no Agitator ‘eaudee.
The Zenwissimus is plainly present.
The Zbialis anticus is single.
§ Lungs.
As Prof, Garrod pointed out in H. subauwrantiaca, the lungs in
H. personata consist of four lobes on the right side and two on
the left. Prof. Garrod, however, made no observations upon the
relative sizes of the several lobes. On the right side the first lobe
is rather larger than the second; the third is the biggest of all
and quite twice the size of the first; the fourth or azygos lobe 1s
the smallest of all.
The two lobes on the left side are more nearly equal in size, but
the second or lower lobe is the larger.
§ Lier.
The liver of this species appears to be much like that of
H. subaurantiaca. The enormous right central lobe is deeply *
fissured and exposes the gall-bladder on the diaphragmatic side.
This lobe is quite twice the size of the left lateral lobe, which is the
next largest ; this lobe again is larger than the right lateral, which
does not show any great difference of size from either the left
central or the caudate. The Spigelian lobe is minute.
§ Pancreas.
The pancreas of Helictis is almost exactly like that of the Tayra
(Galictis), with which Arctoid I have specially compared it. It is
not clear from Garrod’s description what is the precise form of the
gland in the species investigated by himself. In H. personata
there is a circular portion of the pancreas running right round the
duodenal loop +; this ends in a straight piece running parallel
with the spleen. The chief difference which Helictis shows from
Galictis is in the mesenterial attachment of the straight part of
the pancreas. In Galictis a transparent mesentery, apparently
anangious, 1s attached to the whole length of the straight region
of the pancreas, and is inserted on to the mesocolon along a
line which commences in front of and ends behind the left kidney.
* But not quite so deeply as in Galictis.
+ As in many Carnivora, cf. e.g. Owen’s Comp. Anat. vol. ili. p. 496.
1905. | ANATOMY OF THE FERRET-BADGER. 25
In Helictis, on the other hand, this membrane is of much less
extent. It is only attached to about half the length of the
pancreas and is inserted on to the mesocolon along a line which
begins a little before the left kidney but ends at about its middle.
This characteristic difference is illustrated in the figures (text-
Imes, Wh, 10),
Text-fig. 9.
P
Pancreas and adjacent regions in Helictis personata.
D. Duodenum ; P. End of pancreas; K. Kidney; S¢. Stomach.
$ Ovary and Broad Ligament.
As is very frequently, if not constantly, the case with the
Arctoidea, the ovary is completely encapsuled and thus continuous,
anatomically, with the Fallopian tube.
An interesting point concerns the suspension of the ovary and
oviducal canal. The mesoarium is continued forwards for a short
distance in front of the ovary, running attached to the parietes
to the outside of the kidney. In Galictis there is the same
forward prolongation of this fold, which has the same position in
relation to the kidney, but it extends much further forward on
26 MR. F, E, BEDDARD ON THE [May 2,
both sides, in fact nearly to the diaphragm. In Cynictis
levaillanti and Arctictis binturong, which I examined for purposes
of comparison, the eonditions are a little different. In the former
the fold of peritoneum in question runs over the kidney instead
of avoiding it, and ends on the parietes a little way in front and
outside of that gland. In the Binturong the mesoarium on the
right side extends nearly up to the diaphragm, passing over the
Text-fig. 10.
Pancreas and adjacent region in Galictis barbara.
Lettering as in text-fig. 9.
kidney and being naturally attached to it on its passage. On the
left side, this fold of peritoneum actually reaches the diaphragm,
passing also over the kidney of its side. I will not assert at
present that there are here characters which serve to differentiate
the Arctoid from the Ailuroid Carnivora, but they do as a matter
of fact differentiate certain Aluroids from certain Arctoids.
1905. | ANATOMY OF THE FERRET-BADGER. 27
§ Arterial System*.
The Aortic arch gives off first an innominate artery and then
the lefé subclavian ‘separately. These matters are not mentioned
Text-fig 11.
Intrathoracic aorta of A. Helictis personata; B. Galictis barbara.
Ao. Aorta; L. Branches to lung; es. Branches to cesophagus; v. Intercostals ;
zg. Azygos vein; 7’. Branch to trachea; D. Phrenic arteries.
by Garrod in his account of Helictis subaurantiaca, and indeed
* The arteries of the brain are dealt with under the description of that organ.
28 MR. F. E. BEDDARD ON THE [May 2
he gives no account of the vascular system at all. The innominate
first gives off the left carotid, and then very shortly after divides
into the right subclavian and right carotid. The aorta in the
thoracic region gives off eleven pairs of intercostal arteries, the
Text-fig. 12.
Intrathoracic aorta of Suricata tetradactyla.
Lettering as in text-fig. 11.
eleventh being just in front of the diaphragm. It is important
to notice that these arteries are paired throughout, each artery of
the pair arising separately from the aorta: important because in
some mammals (e. g. Chinchilla) the intercostals arise as single
1905 | ANATOMY OF THE FERRET-BADGER. 29
arteries and afterwards divide into right and left halves. The
first pair of intercostals corresponds to the first branch of the
Azygos*, The first six pairs of intercostals lie entirely to the
left of the Azygos; the 7th artery on the right side and those
which follow le to the right side of the Azygos. This point, I
take it, is where originally the now missing right aortic arch
joined the left aortic arch. In this region the aorta also gives
off a number of fine slender branches to the cesophagus and to
the lungs. The first of these branches arises a little way down
the first right intercostal and supplies the windpipe; from or in
the immediate neighbourhood of the next four right intercostals
‘arise twigs for cesophagus and lungs; then follows a gap of two
intercostals, the last twigs arising thon the 8th right intercostal.
From the last intercostal in front of the diaphragm arises a
diaphragmatic artery on each side; another diaphragmatic artery
springs directly from the aorta behind the diaphragm, and
independently of an immediately following suprarenal artery.
I have carefully and, I hope, exactly compared the pre-
diaphragmatic arteries of Helictis with those of its ally Galictis
and with those of the Afluroid Swricata.
The former, as might be expected, shows greater resemblances to
FHlelictis than does the latter. There are, however, also difterences.
There are 10 instead of 11 pairs of intercostals in front of the
diaphragm, or, to be more absolutely accurate, 10 on one side and
9 on the other; for the first intercostal has not a fellow and
belongs to the left side. The fifth right intercostal is the first
which passes to the outside of the Azygos vein. The pulmonary
and esophageal branches arise in every case from the right
intercostal vessels, and I counted four of them which have the
following position: the first three arise from the first three
right intercostals; the fourth springs from the fifth right
intercostal.
In Suricata tetradactyla there are 12 intercostals on the right
side in front of the diaphragm and two additional ones on the
left side. The most important pulmonary and cesophageal arteries
arise separately from the aorta, though some spring “from right
intercostals. The 8th right intercostal is the first which passes
over the Azygos vein.
* This vessel, as in most mammals, is present only on the right side.
30 MR. W. P. PYCRAFT ON THE [May 2,
3. Contributions to the Osteology of Birds.—Part VII.*
Hurylemide ; with Remarks on the Systematic Position
of the Group. By W. P. Pycrart, F.Z.S., M.B.0.U.
[Received March 30, 1905. |
(Plate I]. + and Text-figures 13-15.)
CoNnvTENTS.
i. Introductory Remarks, p. 30. vil. The Pelvic Girdle, p. 48.
ii. The Skull of the Adult, p. 30. viii. The Pectoral Limb, p. 48.
ili. The Skull of the Nestling, p. 40. ix. The Pelvic Limb, p. 49.
iv. The Vertebral Column, p. 43. x. Summary, p. 50.
v. The Ribs, p. 45. xi. List of Literature referred to, p. 56.
vi. The Sternum and Shoulder-girdle, xii. Explanation of Plate II., p. 56.
p. 45.
1. LnrropucTORY REMARKS.
The present paper is intended to form the first of a series on
the osteology of the Passeres, and, in order to increase its value
to the systematist, characters other than osteological will be
discussed where necessary. By this means it is hoped that that
most difficult of ornithological problems—the classification of the
Passeres—will be materially aided.
The labours of Garrod, Forbes, and Firbringer have resulted in
the accumulation of a considerable pile of facts concerning the
soft parts of the Kurylemide, but comparatively little has been
done in the way of osteology.
My work, it may be. as well to state here, has been hampered
by paucity of material, since several genera are entirely
unrepresented in the Collection of the British Museum (Natural
History). Doubtless these gaps will be filled in course of time,
and the lacune, unavoidable in this contribution, can then be filled
up. Skeletons of nestlings are especially wanted.
11. THE SKULL OF THE ADULT.
The skull of the Eurylemide is remarkable for the extreme
specialisation which it displays, though these birds are of an
undoubtedly primitive type. ‘That changes so considerable as
are here to be noticed should have taken place in the skull is
unfortunate, since thereby valuable evidence on questions of
ancestry has been lost.
It is not an easy matter to express exactly what are the
characteristic features of the Eurylemid skull, or, rather, it is not
easy to set down diagnostic characters, since it presents considerable
and often wide differences in d werent genera. Superficially it
* For Part VI. see P. Z.S. 1903, vol. i. p. 258.
+ For explanation of the Plate, see p. 56.
H.Grénvold, del.
OSTEOLOGY or
P.Z.S ISOS pvGli0L iL J0
Bale & Danielsson, L* coll.
THe BURY AMID zs.
1905. ] OSTEOLOGY OF THE EURYL/EMID#. 31
presents an undoubted resemblance, in some respects, to the
aberrant Procnias, in others to the Swallows.
The following characters will, however, probably suffice :—
The beak is of great size, nearly as broad as long, and joins the
cranium by a more or less perfect nasal hinge; free lachrymals are
wanting, save in Calyptomena; palate egithognathous; palatines
short, broad, wide apart, and produced backward into prominent
spurs; vomer truncated, much reduced and terminating posteriorly
in a pair of slender limbs; pterygoids and palatines articulating
by means of an oblique joint; maxillo-palatine processes reduced
to long slender rods slightly expanding at their termination
beneath the vomer; basipterygoid processes wanting; postorbital
processes obsolete ; squamosal process prominent
The Occipital Region.
The foramen magnum is cordiform, its apex rising only slightly
above the level of the superior margin of the rim of the tympanic
cavity. The plane of the foramen inclines downwards rather
than backwards, as in the Capitonide, but not to such an extent
asin the Bucconide. The base of the foramen is not raised above
the level of the basi-cranial axis. The supra-foraminal ridge is
barely traceable.
There is no lambdoidal ridge, such as is met with in the
Capitonidee for example, but the cranium above the occipital
foramen presents a fairly prominent cerebellar dome, bounded on
either side by a subcircular depression (the supraoccipital fossa).
Above this region the skull rises considerably and presents a
gently rounded surface.
The tympanic wings of the exoccipital are considerably developed
to form a pair of downwardly directed plates, the processus ale
exoccipitalis inferior, having a convex border and a convex surface
with recurved free edge: through these plates the semicircular
canals can be faintly traced.
The Cranial Roof (Pl. 11.).—The cerebral rises vertically above
the cerebellar dome and is of considerable width, being wider than
long. In regard to the position of the cerebral with relation to the
cerebellar dome, the Kurylemide agree with the typical Passeres
and the Cypseli, and differ from the Capitonide, for example,
wherein the cerebral les tm front of the cerebellar dome. The
parietal region is marked by a moderately well-defined temporal
depression, the “‘ temporal fossa,” which, however, does not extend
further inwards than the outer margin of the supraoccipital fossa.
This is a Passerine feature; in the Coraciiformes these fossee
usually meet in the middle line, forming a more or less well-
marked sagittal crest.
The temporal fossee in the Eurylemide are mainly responsible
for the formation of the well-marked squamosal prominences.
The interorbital region is marked with a more or less distinct
median groove, sometimes with alow ridge. Immediately behind
32 MR. W. P. PYCRAFT ON THE | May 2,
the base of the beak it expands considerably and is supported from
within by outstanding antorbital plates. Lachrymals, except in
Calyptomena, are absent, and consequently take no share in the
formation of the preor bital region of the skull. In this particular
the Kurylemide agree with the bulk of the Passeres, in which,
however, vestiges of the lachrymal are frequently present.
The Re ontalsy terminate abr uptly i in front, not extending beyond
the level of the anterior border of the mesethmoid. The nasals
and nasal-processes of the premaxilla are also sharply truncated
caudad ; thus, at their meeting with the frontals and mesethmoid
a freely moving nasal hinge is formed (Pl. IT. figs. 26, 3a, 4).
The incipient stages in the development of such a hinge can be
studied in Chasmor hynchus—one of the Cotingide.
The Base of the Skull.
The basitemporal plate is shghtly hollowed in the middle line,
and is continued forward for some distance on to the parasphenoidal
rostrum; owing to the small size of the brain its free edge
projects beyond the level of the brain-case. To appreciate this
point the skull of one of the Eurylemidz should be compared
with say that of Menwra or Corvus, where, it will be found, the
basitemporal plate fails to conceal the brain-case when the skull is
seen from below. The edge of this plate is free only at its apex.
Not even vestiges of the basipterygoid processes remain.
The parasphenoidal rostrum is long and slender.
The occipital condyle is spherical and depends from the roof of
a shallow pre-condylar fossa.
The Lateral Aspect of the Cranium. (Pl. IT. fig. 2.)
The tympanic cavity is small, shallow, and has little or no floor,
The constriction of the skull-wall in the temporal region, to form
the “temporal fosse,” gives the tympanic cavity the appearance of
the aperture of a tube, the cylinder of which is formed by the
‘¢squamosal prominence” and lateral occipital wing.
The roof of this cavity is formed by the under “surface of the
processus 2 gomaticus squamosi. Its floor in part by the lateral
occipital wing and in part by the ossification of tissue extending
between this wing and the external angles of the basitemporal
plate; but this region is much cut away.
Within the cavity three apertures will be found in the dried
skull after the removal of the tympanic membrane. The largest
of these is the mouth of the recessus tympanicus anterior.
Immediately outside this, and below the otic articular surface for
the quadrate, is the fenestral recess : this is very small, and neither
the fenestra ovale nor the rotunda can be distinguished within it,
though the columella is in position above; and behind the fenestral
recess a cluster of minute pneumatic apertures will be found,
corresponding to a similar group commonly found in the higher
1905. ] OSTEOLOGY OF THE EURYLEMIDA, 33
Passeres. In shape and position, however, this group of foramina
more nearly resembles its counterpart in ‘the Bucconidee. These
foramina form a sort of cribriform plate guarding the mouth of
the recessus ty ympanicus posterior, which is much reduced. The
recessus tympanicus superior is of small size, and opens externally
into the tympanic cavity by a small aperture lying between the
squamosal and otic heads of the quadrate. The aperture is
bounded externally by a short, pointed processus articularis
SqUamosi.
The Squamosal Prominence.—It has already been pointed out
(p. 32) that the constriction of the temporal region of the
cranium has given the tympanic region a sort of individuality not
met with in the skulls of the higher Passeres, but common among
the lower types, and among the Coraciiformes,
In the Huryleemidz the free edge of this prominence projects
shelf-like beyond the head of the quadrate. It is continued
forwards into a hastate processus zygomaticus squamosi directed
downwards and outwards. From the base of the inferior surface
of this process projects a short. pointed processus articularis
squamosi; between these two processes the head of the quadrate
is firmly grasped.
The temporal fosse are especially deep in Corydon. As in other
genera, they are linguiform in shape and do not extend inwards
beyond the outer border of the supraoccipital fossa.
The trigeminal foramen pierces the skull-wall at about the level
of the otic articular process for the squamosal, but some con-
siderable distance mesiad thereof.
The orbito-sphenoid does not ossify. The inéerorbital septum 1s
largely fenestrated.
The interorbital region of the frontals is generally very narrow
so that the orbits are only very partially roofed. In front the
orbit is bounded by a f--shaped antorbital plate. In Calyptomena
the interorbital region is wide.
The lachrymal, in Calyptomena (Pl. II. fig. 2, U.), has the form
of a sigmoid rod more or less clubbed at each endl The upper end
would perhaps more correctly be described as hammer-shaped, and
is completely overshadowed by wide expansions of the frontal.
The whole ossicle is embedded in a groove carved out of a very
much swollen antorbital plate. The close resemblance between
the lachrymal of Calyptomena and that of Chasmorhynchus is
most remarkable. Both are embedded in the antorbital plate, and
both have the same sigmoid flexure. Only in the larger size of the
orbital end can the lachrymal of Chasmorhynchus be distinguished
from that of the HKurylemid Calypiomena.
In all the other Eurylemide, however, the lachrymal appears
to have been lost; further, the antorbital plate has been reduced
to a thin e-shaped plate.
The Ethmoidal Region.—The mesethmoid is greatly reduced by
the fenestration of the interorbital septum. The antorbital plate
which bounds the orbit in front is -shaped and attached to
Proc, Zoot, Soc,—1905, Vou, Il. No. ILI. 3
34 MR. W. P, PYCRAFT ON THE [May 2,
the mesethmoid by a horizontal plate of bone, almost rod-like
in some species. “The vertical, hamulate portion of the plate, by
its upper limb, considerably adds to the width across the frontal,
the lower, descending, process turns outwards to reach the
quadrato-jugal bar. In the extraordinarily wide-mouthed genus
Corydon, however, the quadrato-jugal bar stands far from this
descending process.
The olfactory chamber, owing to the extremely reduced con-
dition of the maxillo-palatines, in the macerated skull is without
a floor, in the majority of the genera of this group; but in two
skulls, Zurylemus and Cymbirhynchus, in the British Museum Col-
lection, this is more or less filled up by the ossification of a pair of
turbinals, one on either side of the septum nasi, which apparently
answer to the concha media. Pyriform in shape, each extends
from the narial aperture backwards to the anterior horn of the
vomer, where it becomes attached. Above and behind this is an
oat-shaped and laterally compressed turbinal answering to the
concha posterior.
The nasal septum, in Calyptomena, is formed by a thin sheet of
bone running along the whole length of the under surface of the
nasal process of the premaxille. In Hurylemus, Cymbirhynchus,
and especially in Corydon, this septum becomes greatly swollen
and grooved on its under surface.
The Cranial Cavity.—The mesencephalic fossa is capacious.
Tts floor sweeps rapidly upwards to form astrongly marked basin-
shaped cavity. This upward rising of the floor is much more
conspicuous than in some other genera, e. g. Menura or Corvus.
The internal auditory meatus is represented only by a shallow
depression. Immediately above and somewhat in front of this
lies the trigeminal foramen. ‘This, opening under a strong ridge,
leads immediately into a deep groove across the floor of the
mesencephalic fossa and thence through the under wall of the
skull. All the branches of v leave by this foramen. There is no
separate foramen for the ophthalmic (v’) (orbito-nasal); and in
this respect the Hurylemide appear to agree with all the other
Passeriformes. The vagus foramen lies at the bottom of a deep
fossa.
The cerebellar fossa is small, relatively to the cerebral, sharply
defined, and has the supra-occipital region marked with prominent
horizontal ridges. The floccular fossa forms a conspicuous
moderately deep and more or less pyriform depression, sharply
bounded caudad by the anterior semicircular canal.
The mesencephalic fossa is of considerable size and, as in other
Passeriformes, extremely well defined by a strong vertical ridge
above, and an equally prominent ridge formed by the pro-otic
below.
The pituitary fossa takes the form of a narrow tube rising
vertically from the floor of the skull. The dorsum selle is reduced
to a knife-like edge. The pre-pituitary region is produced into a
moderately well-defined optic platform, triangular in shape,
1905. ] OSTEOLOGY OF THE EURYLEMIDA. 35
The cerebral fosse are relatively of considerable size, though
relatively smaller than in Corvus for example. Thus, in the
Hurylemids the cerebral fossa is only distinguishable from the
mesencephalic fossa by reason of the boundary-line of the
tentorial ridge. In Corvus the mesencephalic fossa forms a
totally distinct basin-shaped cavity, lying as it were within the
cerebral fossa, which dips down to the outer side and below the
level of the fossa in question in the form of a deep pocket.
Menura represents a half-way stage between the Corvide and
Kurylemidze. In Menura, moreover, the roof of the cerebral
fossa is marked by a low ridge roughly dividing the fossa into
two equal parts.
There is a well-developed bony falx.
The olfactory fossee are reduced toa pair of small pits. But
there are strong impressions of an olfactory tube to be found in
the fore part of the cerebral fossa of the Eurylemide.
The Premaxilla.
The premaxilia in the Eurylemide forms the major part of the
upper half of the beak. Hooked at the tip, and of extreme
breadth, it recalls in many respects that of many of the Coraciide,
e. g. Hurystomus, on the one hand, and of some Caprimulgi,
e. g. Podargus, on the other. When these several types come to
be compared, however, these resemblances will be found to be but
slight.
More significant is the close resemblance to the Cotingide.
This is well brought out in the skull of Calyptomena, which, as
will be shown presently, presents many features in common with
Chasmorhynchus. 'The number of other skeleton characters which
these two forms possess in common suggest affinity between the
two groups, rather than homoplasy.
In Calyptomena, which I propose to take as the typical
Kurylemid for the purpose of comparison, the body of the pre-
maxilla is moderately large. The nasal process, fusing with the
nasals, is sharply truncated caudad, and articulates with the
frontals by a hinge. In this respect the Kurylemid skull re-
sembles that of the Podargide, and not of the Coraciide.
The low position of the skull of Calyptomena is indicated by a
comparison of the narial aperture with that of the skulls of other
Eurylemid genera.
In Calyptomena the nasals are of the typical holorhinal shape
with an obliquely sloping descending process. The nasal fossa,
in the dried skull, is a long oval aperture showing, within the
cavity, a narrow ridge of bone continued from the palatal border
forwards to meet a low septum hanging from the middle line of
the nasal process of the premaxilla. The septum represents the
ossified remains of the septwm nasi; the small plate of bone
running inwards from the level of the tip of the palatine is a
portion of the alinasal cartilage which has become ossified.
3*
36 MR. W. P. PYCRAFT ON THE [May 2,
Corydon, Hurylemus, and Cymbirhynchus differ conspicuously
from Calyptomena in this matter of the narial aperture, as may be
seen by a comparison of figs. 26, 3a, 4, Pl. IT.
Tn all three genera the nasal is reduced to its smallest possible
limits, little more than an arcuate bar being left. Of this, one
half represents the descending process of the nasal, the other the
body of the bone,—now merely a rod joined at its inner end to
the nasal process of the premaxilla, and affording the means of
articulation with the frontals. This, as I have remarked, takes
the form of a nasal hinge. In Hwrylemus and Corydon the nasal
fossa, as in Calyptomena, is open in the dried skull, the actual
position of the nasal orifice in the living bird being indicated by
semicircular grooves in the anterior border of the nasal fossa.
The circle completing the rest of the fossa in the living bird
was roofed by the alinasal wall. In Cymbirhynchus this wall
almost completely ossifies, leaving an oval narial aperture, and
a small semilunar space immediately in front of the nasal (fig. 3
Pl. IT.).
In the Kurylemide the floor of the olfactory chamber is open
behind, revealing in Calyptomena an ossified sheet-like nasal
septum, which in Corydon becomes immensely swollen.
In the Coracie, certain Caprimulgi and Pici the floor of the
olfactory chamber is more or less ossified. In Hurystomaus and
the Bucconide there is a long palatal fissure, which at first sight
appears to correspond to the huge palatal cavity of Hurylemus.
An examination shows, however, that this vacuity leads into a
spacious cavity underlying the olfactory chamber and formed by
the inflation and absorption of tissue of the nasal septum. In
Podargus the palatal surface of the premaxilla is completely
ossified, and the olfactory chamber is reduced to the smallest
possible limits.
In Corydon the nasal process of the premaxilla is immensel
swollen and rises far above the level of the nasal hinge. The
frontal is similarly swollen immediately above this hinge. The
intermediate stages between this condition and that found in
Calypiomena can be studied in Cymbirhynchus. Corydon, indeed,
would appear to have reached the high-water mark of speciali-
sation in the matter of the jaws, among the Eurylemide.
b)
The Ma«illo-jugal Arch.
The maxilla, as usual, is in the adult completely fused with the
premaxilla. In Corydon the maxillary region of the jaw is highly
developed and forms a large semicircular plate, the convexity
forming its free edge and projecting downwards far beyond the
level of the quadrato-jugal bar.
The mawillo-palatine processes in Calyptomena take the form of
a pair of delicate rods projecting backwards at a very marked
angle from the body of the maxilla, which, at this point, is
perforated by small pneumatic apertures. These rods, on each
1905. | OSTEOLOGY OF THE EURYLEMIDE. 37
side of the skull, terminate immediately beneath the free end of
the vomer.
That these processes are degenerate there can be no doubt.
They have probably been derived from a condition precisely
similar to what obtains in Chasmorhynchus. In the latter, these
processes are swollen and spongy in character. Arising from the
maxilla at a point almost immediately below the descending
process of the nasal (in Calyptomena they arise distad of this
point), they extend backwards so as to run on either side of and
beneath the vomer for nearly one-fourth of its length.
In Corydon and Cymbirhynchus these processes are more
slender than in Calyptomena. In Cymbirhynchus they are hook-
shaped.
Probably, as I have remarked, the maxillo-palatines of
Calypiomena at an earlier stage closely resembled those of
Chasmorhynchus. It seems also highly probable that these, in
turn, were derived from yet more primitive and much more
extensive triangular plates such as have been retained by the
‘Tyrannide. The palate of Vityra, indeed, shows how easily the
Eurylemiform palate could have obtained its peculiar maxillo-
palatines.
The quadrato-jugal bar in Calyptomena as in Chasmorhynchus
is sigmoidally curved, as much so as in some Spheniscide. In
Corydon and Cymbirhynchus it is straight. There are no separate
elements distinguishable in this bar.
The Vomer, Palatines, and Pterygords.
The vomer (Pl. 11. fig. 2a), in Calyptomena, is roughly oar-
shaped in front and terminates caudad in a pair of long, slender
limbs, bowed outwardly so as to enclose a space through which the
parasphenoidal rostrum may be seen, and fused completely with
the palatines. The free end of the blade is truncated, and has the
angles produced into minute processes, thus showing that the
vomer was earlier of a more pronounced Aigithognathous type.
In Corydon the vomer is much reduced, being represented by a
short, broad, oblong body produced caudad into a pair of widely
separated and slender rods which articulate with the palatines.
The free end of the vomer is squarely truncate with prominently
produced angles. The dorsal aspect of the vomer is closely applied
to the base of the septum nasi.
Oymbirhynchus resembles Corydon in the shape of the vomer,
but differs therefrom in that it is slightly constricted between the
free end and the origin of the posterior cornue, which fuse com-
pletely with the palatines, forcing the parasphenoidal plates thereof
away from their normal relationship to the parasphenoid.
In the Coraciidee the vomer is either wanting or reduced to a
mere spicule, e. g. Hurystomus.
In Chasmorhynchus the vomer is larger than in the Kurylemide.
Aigithognathous anteriorly, it terminates posteriorly ma a pair of
38 MR. W. P. PYCRAFT ON THE [May 2,
broad limbs indistinguishably welded with the palatines, agreeing
in this with Calyptomena and Cymbirhynchus.
The palatine (Pl. LI. fig. 2a) in Calyptomena is a long bone:
anteriorly rod-shaped, it extends backwards as far as the
under surface of the antorbital plate, when, after sending out-
wards a prominent, rounded elbow—“ transverse bone ”-—it turns
abruptly inwards, ultimately forming a roughly spatulate plate,
bent upon itself so as to form a long linear surface running along
the parasphenoid rostrum, and fusing mesiad with the vomer and
a free downwardly hanging curtain to form a cavernous space in
the roof of which is the base of the vomer.
The palatine of Chasmorhynchus differs from that of Calypto-
mena in the greater width of the hinder laminated portion and the
more extensive development of the inferior free edge, forming the
cavernous space beneath the vomer. This edge now appears
rather as a shelf-like projection developed from the inner border
of the shaft of the palatine.
In Cymbirhynchus the palatine shaft is broader than in
Calyptomena, and this increased breadth is especially noticeable
at its junction with the body of the premaxilla. The latter, as
has already been pointed out, is much more conspicuous than in
Calyptomena and terminates in a doubly crescentic free edge
synchronously with the palatines. Thus a relatively enormous
oblong space is enclosed. In Corydon these features are still
more exaggerated, the “‘ elbow” is also more strongly marked.
In broadness and the truncated form of the shaft of the
palatines, the more specialised Kurylemide recall the Podargide,
wherein the body of the premaxilla is still more developed and the
truncation of the palatine distally more marked. Both in the
specialised Hurylemide and the Podargide the truncation of the
vomer appears to have been brought about to facilitate the move-
ments of the nasal hinge, which in both types les immediately
above the anterior ends of the palatines, while in the more
generalised Calyptomena, which lacks a nasal hinge, the palatines
run far forwards.
The pterygoid in Calyptomena (PI. II. fig. 2a) is a long,
slender, rod-shaped bone, laterally compressed, and perforated by
a pneumatic foramen at its articulation with the quadrate. At
its anterior end it meets its fellow of the opposite side in the
middle line; and immediately sends upwards and forwards a sub-
crescentic plate which, embracing the parasphenoidal rostrum by its
plane surface, affords attachment along its inferior border to the
vomer. Late in life the articulation with the vomer is succeeded
by anchylosis. Certain points concerning the morphology of the
end of the pterygoid will be discussed in the section dealing with
the nestling skull (p. 43).
In Chasmorhynchus the anterior ends of the pterygoids do
not meet in the middle line but impinge instead directly against
the parasphenoidal rostrum, forming therewith a pedate articu-
lation, which is largely augmented by “ hemipterygoid” elements
1905. ] OSTEOLOGY OF THE EURYLEMIDS. 39
corresponding to the sub-crescentic plates of Calyptomena. These
hemipterygoids, in both the Eurylemid and Cotingid forms,
articulate with the palatines, in the adult, by means of an oblique
suture.
Corydon and Cymbirhynchus difter in no essential features from
Calyptomena.
The quadrate is peculiar in that, in common with the Tyrannide
and some other Passerine forms, it sends out a strong spur for the
articulation of the quadrato-jugal bar. This spur projects like a
buttress laterad of the outer condyle for the lower jaw. The
squamosal and otic heads are closely approximated. The former
is wedged in between a prominent processus articularis squamosr
behind, and an equally well-developed processus articularis zygo-
maticus in front. In Corydon these processes are expanded
laterally so as to overhang the head of the quadrate, but at the
same time they afford this element a greater freedom of movement
than in Calyptomena. Cymbirhynchus and Eurylemus are inter-
mediate in character in this respect.
The Mandible.
The mandible, in the Eurylemide, is much bowed outwards
to a very considerable extent. In Calyptomena it has only a
relatively small symphysis: is truncated posteriorly, and shows
little or no trace of the separate elements of which it is composed.
The internal angular process is moderately well developed, and is
perforated by a small pneumatic foramen. The rami, in their
general shape, are rod-like, and slightly compressed laterally.
In Corydon and Cymbirhynchus, however, there is an abrupt
transition between the malar region of the mandible and that
portion covered by the rhamphotheca, which is most markedly
thicker and broader than the hinder region. The symphysial
region is very broad and spoon-shaped. ‘The internal angular
process is more spine-like than in Calyptomena, and there is a
feebly-developed posterior angular process.
The Hyoid.
The hyoid of the Eurylemide resembles that of the higher
Passeres. The basihyal (os entoglossum) is made up of a pair of
boomerang-shaped ossifications placed dos @ dos, so that a long
free process is produced backward beyond the articulation with
the basibranchial 1. Basibranchials 1-2 are fused; the latter,
however, is a long cartilaginous style. The ceratobranchial and
epibranchials are of moderate length; the latter are cartilaginous
at the free ends.
In Corvus, for example, among the higher Passeres, the basi-
hyals are long and straight, and run parallel with one another,
yet so as to leave a median space between them.
40 MR. W. P. PYCRAFT ON THE [ May 2,
iii. THE Skuxt or THE Nustiine. (PI. IT. figs. 1 & 1a.)
It is a matter for regret that the British Museum Collection of
nestling skulls of Hurylemide is limited to half-grown specimens
of Hurylemus ochromelas, and these have suffered somewhat
severely as a consequence of having been preserved in formol.
a. Cartilage-bones.
The basioccipital cannot, in these skulls, be more than imper-
fectly traced, having become fused with the lateral occipitals.
The exoccipital, or lateral occipital, is a large, more or less
linguiform plate presenting a broad convex external border, the
inferior segment of which forms the tympanic cavity, while the
superior arc of the curve is applied in part to the base of the
squamosal and in part to the parietal. It is bounded mesiad
by the supraoccipital and the occipital foramen, which excavate
a considerable moiety from its internal border. Inasmuch as the
exoccipital comes into contact with the parietal, it resembles that
of the Cuculide.
The supraoccipital is short antero-posteriorly, and is not yet
ossified ; its superior margin being W-shaped and leaving a large
fontanelle between itself and the parietals. Laterad it has fused
with the lateral occipitals, leaving only a faint tell-tale notch to
indicate the junction.
The pro-, epi-, and opisthotic bones are now completely concealed
when the skull is viewed externally.
The basisphenoid is also concealed, being underfloored by the
basitemporal plate.
The alisphenoid appears as an oblong plate, having its long
axis horizontal.
The orbito-sphenoid is still membranous, while the presphenoid
has fused with the basisphenoid.
The mesethmoid has only just commenced to ossify, and is
represented by a small linguiform plate supporting the yet carti-
laginous antorbital plate, and bounded in front by the cranio-
facial fissure. The interorbital septum formed by the backward
extension of the plate is as yet only outlined in cartilage.
The olfactory cavities occupy less than half of the so-called
anterior narial apertures as seen in the dried skull. The actual
anterior nares, in Hurylemus ochromelas for example, are small
and round, and placed at the extreme anterior angle formed by the
divarication of the nasal and maxillary processes of the premaxilla.
The superior segment of this circle is formed by membrane, and
this extends backwards and inwards as a subtubular sheet to be
attached to the antorbital plate. Mesially this tube is shut in by
the nasal septum, and inferiorly by membrane forming the roof
of the palate.. Within the chamber thus formed lies a long,
somewhat spatulate cartilaginous turbinal extending backwards,
by a short stalk, to the anterior end of the vomer, ‘The free end
1905. | OSTEOLOGY OF THE EURYLEMID. 4]
of the spatulate process lies on a level with, but mesiad of, the
external aperture. Without this chamber is a large sinus roofed
by the rhamphotheca, floored by membrane supported by the
maxillo-palatine process, and closed posteriorly by the antorbital
plate lying external to the nasal chamber. In the dried skull
this sinus is included as part of the external narial aperture.
The guadrate, though not yet completely ossified, differs in no
material particular from that of the adult.
b. The Membrane-bones.
The parietal is roughly quadrangular in shape; its superior
external angle is drawn upwards into a point, its inferior external
angle forms a sweeping curve. Its mesial border is not yet
ossified in the skull now described. A small portion of its inferior
border, lying between the supraoccipital and squamosal, comes into
actual contact with the exoccipital.
The frontal along its posterior border follows the curve of the
parietal: anteriorly, in the mid-orbital region, it becomes reduced
to a narrow band, and finally terminates in a strap-shaped process
underlying the nasals. Before leaving the cranial cavity its free
edge passes downwards and inwards to join the alisphenoid
inferiorly. The rim of this inturned plate is overlapped by a long
tongue-shaped process of the squamosal (PI. II. fig. 1 a).
The sguamosal is a somewhat remarkable bone. Roughly
i-shaped, the horizontal region overlaps, mesiad, the lateral
occipital and extends so as nearly to reach the supraoccipital ;
laterad it overhangs the tympanic cavity and terminates in
a pointed processus zygomaticus squamost. ‘The vertical shaft
arising from this base is roughly sword-shaped, with a slightly
decurved pointed tip. About one-third of this blade arises above
the level of the parietal to overlap the frontal as already described.
Immediately above the level of the superior border of the ali-
sphenoid this blade develops a barely perceptible prominence,
which supports a small cartilaginous nodule—the anlage of the
postorbital process.
Another most noteworthy feature of the squamosal in this
skull is the fact that the greater part thereof appears on the
inside of the skull: only, indeed, the extremities of the horizontal
and vertical portions being excluded. Compare figs. 1, 1@ (PI. I1.).
In the most primitive types of Avian skull, it will be re-
membered, the squamosal is either entirely excluded from any
participation in the formation of the brain-case, or only a very
small area is admitted. Originally a quite superficial bone, it has
gradually absorbed the underlying osseous tissue, till eventually
it has forced itself into the very walls of the cranial cavity, and
this is especially the case in the skull of Hurylemus ochromelas.
I am unfortuately unable at the present time to make any
extensive series of comparisons between the form of the squa-
mosal in the Hurylemide and that of the Coraciiformes, or the
42 MR. W. P. PYCRAFT ON THE [May 2,
Menuride and other Passeriform types, owing to lack of material.
Such a comparison I believe would be valuable.
So far, the peculiar squamosal of the Eurylemide resembles
most nearly, among the Coraciiformes, that of the Capitonide.
But the likeness is but general, and seems to point to the Capi-
toniform type as being the more primitive. Herein, this element
is roughly quadrangular in type, but has the antero-dorsal angle
produced into a point, which, however, does not extend on to the
frontal. Its mesial border is, indeed, exactly coterminous with the
external lateral border of the parietal. The alisphenoid in this
skull is prominent and forms a large triangular block fitting into
the deeply concave anterior border of the squamosal on the one
hand, and overhung by the postorbital region of the frontal on
the other. The postorbital process appears to be formed in part
by the alisphenoid, and in part by the frontal. The squamosal
takes no part whatever in its formation. These relations can be
seen in the skull of Calorhamphus.
The resemblance to the squamosal of the Passeriformes is close,
but is of a kind such as to leave little doubt but that this element
in the Eurylemid is much the more specialised: a fact which is
somewhat surprising, and is at the same time not without
significance.
Comparing the squamosal of Hurylemus ochromelas with that
of the Rook (Corvus frugilegus), it will be found that in the latter
this element is of considerable size, conical in form, and rises
superiorly to overlap the frontal as in Hurylemus. The base of
this cone is broad, and its postero-internal angle is produced
backwards and inwards to form a wedge between the parietal and
lateral occipital.
It is from a squamosal of this type that the squamosal of Hury-
lemus has been derived. This evolution has resulted in a much
greater extension of the base mesiad, between the parietal and
exoccipital, and in the lateral reduction of the body of the bone so
as to transform the sometime cone into a xiphoid shaft springing
from a broad base. These changes will become the more apparent
by a reference to fig. 1 a, Pl. IT.
The nasal varies considerably in form in this group. Unfor-
tunately, I have not material at my command which will enable
me to make a comparison of the early stages of growth of these
several varieties.
The lachrymal is not yet ossified.
The premaailla apparently lacks palatine processes. What appear
to be vestiges of these seem rather to be ossifications of the mem-
brane forming the floor of the anterior region of the nasal chamber.
This point can only be solved by a further examination of well-
preserved material.
The masxilla appears to be unusually large in the skull, but the
decalcification caused by the formalin in which this specimen was
preserved has almost obliterated the premaxillary and quadrato-
jugal sutures,
1905. ] OSTEOLOGY OF THE EURYLEMID&. A3
The quadrato-jugal is long, extending to beyond the middle of
the orbit.
The vomer is not yet ossified.
The palatines difter from those of the adult in that the trans-
palatine elements (?) are as yet membranous.
The pterygoid is rod-shaped, bent at its posterior extremity at
an obtuse angle, so as to fit closely to the parasphenoidal rostrum.
The free end of this rod is pointed, and bears a small pointed
piece of cartilage. Whether this represents the hemipterygoid,
or, as seems more likely, the unossified extremity of the shaft, is
a point which can only be determined by the examination of
somewhat older skulls.
The palatine extends backwards beneath these bent limbs of the
pterygoid.
The apparent absence of the hemipterygoid is a point of con-
siderable interest. The interpretation to be placed upon this fact
is, I think, not that the pterygoid shaft retains its primitive
integrity, but that the hemipterygoid element has been Jost, just
as it has in many other groups of birds. My reason for this view
is that the vomer, which shows various grades of reduction in the
Eurylemide, is supported entirely by the palatines, as in all other
cases where the hemipterygoid has been greatly reduced or is
wanting.
There is nothing remarkable in the absence of this element,
because, as has been shown, the skull in this group is highly
specialised in many ways.
The elements of the mandible are as yet distinct.
iv. THE VERTEBRAL CoLUMN.
All the presynsacral vertebree are heteroccelous and free.
The cervical vertebre are characterised by the deeply incised
neural plates of the 6th—10th vertebrae, where the posterior
zygapophyses are borne upon the under surface of the free ends
of long beams.
The atlas has the odontoid ligament perforated.
The axis bears a large tooth-like neural spine and a large pair
of hyperapophyses. The second and third have large quadrangular
neural plates, the hinder angles of which in the third vertebra are
produced upwards into strong hyperapophyses. The outer borders
of these plates are pierced, on each side, bya smallforamen. The
hyperapophyses of the 5th to 8th vertebre are placed about
midway between the neural spine and the posterior zygapophysis.
From the 5th to 11th vertebra the neural plates are deeply incised
both before and behind the neural spine. The neural spines
gradually decrease in size from before backwards, so that from the
9th to the 12th they are represented only by the merest tubercle.
Hypapophyses are borne by the 2nd, 3rd, 4th, and 5th vertebre ;
the 7th to 10th bear catapophyses, feebly developed ; hypapo-
44 MR. W. P. PYCRAFT ON THE [May 2,
physes again succeed from the 11th vertebra and are continued
backwards to the thoracic.
The cervical vertebrae are 12 in number. There are three
cervico-thoracic; that is to say, there are three vertebre bearing
free cervical ribs. The Ist pair are reduced to the merest vestiges ;
the 2nd pair are long, bear vestigial uncinates, but no sternal
segment; the 3rd pair bear large uncinates and a long styliform
sternal segment, which does not, however, reach the sternum.
Thus, it is obvious that, at no distant date, these three vertebre
formed part of the thoracic series and articulated with the
sternum. ‘They differ, moreover, in form from the true cervicals,
and resemble the thoracic series in having broad outstanding
diapophyses.
The cervical and cervico-thoracics of the Eurylemide differ
conspicuously from those of the Menuride and of the Coracii-
formes, and resemble rather those of the higher Passeres.
The thoracic vertebree, six in number, have moderately developed,
quadrangular, neural spines. Only the Ist thoracic bears a small
hypapophysis. The centra are pierced by pneumatic foramina.
The last thoracic has been incorporated with the synsacrum.
Twelve vertebrz enter into the composition of the synsacrum in
Calyptomenaand Cymbirhynchus; 13in Corydon. The numerical
differences are as follows :-—
Calyptomena. Cymbirhynchus. Corydon.
Mnoraciel.....: 1 1 1
umbar ...... 2 2 3
Lumbo-sacral 3 2 2
acral ease ee 2 2 2
Caudaleeeneess. 4+ 8freecaudal 5+8free caud. 5+ 8free caud.
Total ae: 12+8 uF 1248 = 13+8 on
Thus Calyptomena appears to have lost 1 post-sacral and
Cymbirhynchus 1 pre-sacral. Corydon would appear to express the
primitive number of these segments.
The 2nd lumbar in Calyptomena bears a large pair of ventri-
lateral processes abutting against the pre-ilia. The Ist sacral
vertebra lies immediately caudad of the hinder margin of the
acetabulum. The dorsi-lateral processes of the sacral and caudal
vertebre are long, and, by the ossification of the tendinous tissue
overlying them, form a broad bony plate dividing the innominates.
There are 8 free caudals, including the pygostyle. The diapophyses
of those immediately following the synsacral series are not
embraced by the innominate, owing to the fact that these are kept
apart by the outstanding dorsi-lateral processes of the synsacral
series.
Corydon and Cymbirhynchus differ from Calyptomena chiefly
in that the dorsi-lateral processes of the sacral and post-sacral
1905. | OSTEOLOGY OF THE EURYLEMID&, AD
components of the synsacral vertebra are shorter, so that the
diapophyses of the first precaudal are overlapped by the hinder
ends of the innominate.
Well-marked intercentra appear on caudals 5-7, in each of the
three genera here described.
v. Tur Rips.
The cervical ribs extend from the 4th to the 12th vertebre.
The Ist and 2nd, 10th and 12th, are represented by little more
than broad pleurapophysial lamelle; in the remaining vertebre,
however, these lamelle are narrow and band-like, and the ribs
slender and styliform, extending the whole length of the centrum.
There are 3 cervico-thoracic ribs. ‘The first is reduced, only the
capitulum and tuberculum remaining connected by a common base.
The second is long, but bears no uncinate ; the third bears a short
sternal segment, which, however, does not reach the sternum.
There are 5 thoracic ribs, of which 4 only reach the sternum.
The uncinates are long and extend backwards to reach the 3rd rib
from their base of attachment.
In Corydon the sternal segment of the 5th rib articulates by a
special facet with the sternal segment of the rib next in front.
vi. THE STERNUM AND SHOULDER-GIRDLE.
(Text-figs. 13, 14, pp. 46, 47.)
The sternum of the Hurylemide is typically Passeriform, and
presents no very close resemblances to that of any other group. In
some features it recalls that of the Cuckoos, in others of the
Caprimulgi, but these are not of a nature likely to cause difficulty
in confounding the sterna of either of these groups with Passerine
sterna.
In the Kurylemide the corpus sterni is short and broad—the
breadth nearly equal to the length. The posterior lateral processes
are long, extending forwards to a point corresponding to a trans-
verse line through the middle of the corpus sterni; the free ends
of these processes are spatulate. The metasternum has its free
border squarely truncate, so as to form a continuous line with the
free ends of the posterior lateral processes; broken only by the
notch enclosed by this process. ‘The anterior lateral processes in
Calyptomena have their free ends truncated and curved slightly
backwards. In Corydon these processes are long, pointed and
directed forwards. Cymbirhynchus is intermediate in this respect,
the process being long, truncate, and directed forwards. The
articular surfaces for the sternal ribs are confined entirely to these
processes,
There is no spina interna. The spina externa shows only the
faintest indication of the bifurcate free end which prevails among
the Passeriformes (text-fig. 13, s.e.). In Cymbirhynchus and
Corydon this spine is triangular in section; in Calyptomena it
46 MR. W. P. PYCRAFT ON THE [May 2,
should rather be described as blade-shaped, the dorsal edge of the
blade being much thickened ; in other words, the ventrally placed
keel of the triangle seen in Corydon has in this genus extended
downwards, The median line of the dorsal surface of the corpus
sterni is deeply grooved, and pierced anteriorly by a large
pneumatic foramen. In Cymbirhynchus, and to a less extent in
Calyptomena, the groove is laced across by narrow, irregular bars
of bone.
The carina is deep, and has the free (ventral) edge produced
forwards, The anterior (vertical) border bears a hollow groove for
the reception of the hypocleideum.
The coracoid grooves look directly forwards, and do not meet in
the middle line. The dorsal lips are prominent and thickened ;
the ventral lips are well-defined, but have knife-like edges con-
tinued inwards on to the spina eaterna.
Text-fig. 13.
Sternum of Calyptomena, showing the simple (unbifurcated) spina externa, s.e.
a.l.p., anterior lateral process; c., carina; p.l.p., posterior lateral process.
The coracoids are long; as long as, or longer than, the corpus
sterni. The procoracoid process, though reduced, is still moderately
large, and forms a narrow flange of bone, arising beyond the
middle of the coracoid shaft and having its free edge directed
downwards, Cephalad it articulates with the scapula, and with
the clavicle forms the foramen triossewm. The procoracoid of the
Eurylemide is larger than in the Cotingide. In the Picide the
procoracoid appears to be wanting, and in the higher Passeres it
is reduced to the merest vestige, e.g. Corvus. The breadth of the
base of the coracoid is increased by narrow phalanges of bone, one
on either side extending forwards, for about one-fourth the length
of the shaft. On the dorsal aspect of the shaft a prominent
tongue of bone is sent up to abut against the dorsal lip of the
coracoid groove. This at least obtains in Calyptomena; in
Corydon and Cymbirhynchus it is less marked.
The scapula is long, narrow, and scimitar-shaped. The furcula
1905.] OSTEOLOGY OF THE EURYLHMIDA. AT
is long, slender, gently arched, and bears a large hypocleideum,
roughly quadrangular in form, and articulating with the anterior
edge of the carina. The free ends of the furcula are expanded to
form flat plates articulating with the acrocoracoid, procoracoid, and
acromion process of the scapula (text-fig. 14), thus enclosing the
JSoramen triossewm.
In the form of the sternum and shoulder-girdle the Eurylemide
closely resemble the Cotingide, especially in the form of the spina
externa, which is simple, and thereby differs from the typical
Passerine form wherein it is forked. In the Eurylemide this
process is more or less spike-shaped, whereas in the Cotingide it
appears to be generally flabellate. In Chasmorhynchus the
posterior sternal notches are not so deep as in the Eurylemide.
The hypocleideum articulates nearer the antero-ventral angle of
the carina; and the coracoids do not develop the internal basal
flange found in the Eurylemide.
Text-fig. 14,
Portion of the shoulder-girdle of Calyptomena, to show the meeting-point of the
scapula, coracoid, and clavicle, forming the inner wall of the foramen triosseum.
se., scapula; ac., acrocoracoid ; f., furcula.
In the relations of the articulations between the procoracoid,
furcula, and scapula, where these unite to form the foramen
triosseum, the Hurylemide are distinctly Passerine, though this
arrangement also obtains among the Picide—a fact of some
significance.
In Calyptomena, for instance, the acromion process of the scapula
extends downwards along the anterior border of the free edge of
the procoracoid, and affords an articular surface cephalad, for the
posterior angle of the expanded free end of the fureula. In
Chasmorh ynchus this articulation for the furcula is markedly
increased ; and this increase apparently reaches its maximum in
the Corvide, where the acromion forms a long beam-like roof
to the foramen triosseum, and a very extensive articular surface
for the furcula,
\
48 MR, W. P. PYCRAFT ON THE [May 2,
vil. Tae Petyic GIRDLE.
Outside the Passerine series the pelvic girdle of the Kurylemide
resembles most nearly that of the Capitonide ; from which, however,
it may be distinguished by the fact that whereas in the Hurylemide
the post-acetabular ilium is produced caudad into a spine, in the
Japitonide this backward extension is broad and bifurcate.
Among the Passeres it approximates most closely perhaps to that
of Chasmorhynchus. Cymbirhynchus only, among the Kurylemide,
appears to possess even a vestige of the pectineal process. In
Calyptomena the pre-acetabular ilium is broad throughout its whole
length, and sharply truncated anteriorly. The inferior bor der
thereof is markedly sinuous. The pre-acetabulz of the right and
left sides are widely separated one from another ; and rise so as to lie
nearly level with the ridge of the neural crest of the synsacrum,
thus forming a large, open, canalis dleo-lumbalis. The post-
acetabular region of the ilium is expanded to form a broad dorsal
plane, and passing backwards terminates in a long spine, which, in
Cymbirhynchus and Corydon, is closely applied to the free ends of
the transverse processes of the post-synsacral caudal vertebre.
The ischiwm in Calyptomena is long, produced backwards consi-
derably beyond the level of the post- acetabular region of the ilium,
and terminates in adownwar dly-directed hook- -shaped process which
fuses with the pubis. Cymbirhynchus differs but slightly from
Calyptomena is this respect. In Corydon the ischium is shorter
antero-posteriorly, and deeper, than in the two genera just described,
and does not project beyond the level of the free end of the post-
acetabular ilium. Further, the dorsal border of the pre-ilium is
much cut away anteriorly so as to expose a great portion of the
synsacral neural crest.
The ischio-pubic fissure is closed im all three genera here
described ; the obturator foramen is shut off therefrom by a bony
bar.
The pubis is long and straight, and projects beyond the level
of the ischium, especially so in Calypiomena.
The close approximation of the post-acetabular ilium to the
transverse processes of the free caudal vertebre is due to the
shortness of the transverse processes of the synsacral vertebrze
already referred to.
The fovea lumbalis is small; and the fovea ischiadica and
pudendalis are confluent.
vill. THe Pecrorat Lime.
The pectoral limb of the genera here described presents no
marked differences by which they can be distinguished one from
another.
It resembles that of the Coliide and Capitonide in that
metacarpal IT. sends backwards from its proximal end a small
triangular bony spur (intermetacarpal process) to abut against
1905. ] OSTEOLOGY OF THE EURYLEMID#. 49
metacarpal ITT. In the Eurylemide this spur is, however, much
larger than in the Coraciiform genera referred to.
The humerus only is pneumatic; and is subequal to, or shorter
than, the manus. The forearm isthe longest segment of the limb.
The sulcus transverswm ov covaco-humeral groove is shallow. The
crista superior is triangular in form.
The incisura capitis is fairly sharply defined; the fossa
subtrochanterica is large. There is a small ectepicondylar process,
which, it is to be noted, is not forked as in the higher Passeres ;
the entepicondylar process is still smaller. Ventrad of the
tuberculum ulnare is a prominent spur-like blunt-pointed tubercle
directed backwards and outwards so as to interlock with the
olecranon process of the ulna in the extended wing.
On the palmar surface immediately above the radial condyle is
a small tubercle for the attachment of the inner head of the
extensor metacarpi ulnaris.
The ulna has a prominent, pointed, olecranon process, and bears
a row of small tubercles, for the attachment of the secondary
remiges, along its postaxial border.
The radius is slender and slightly bowed. The forearm is the
longest segment of the wing.
The manus is well developed. As in the Capitonide and the
normal Passeres, the base of Me. II. sends backwards a bony
plate to overlap and fuse with the base of Mc. III. In the
EKurylemide this plate (intermetacarpal plate) is of considerable
size, 1ts base extending down the shaft for some distance.
In some Coraci, e. g. Hurystomus, there is also an intermeta-
carpal plate, but feebly Abvalieea! and not fused with Mc. IIT.
ix. Tae Petyvic Limes.
The pelvic limb, in the Eurylemidze, has, in common with the
Cotingidee, a syndactyle pes ; and in this respect these two families
resemble many of the Coraciiformes. None of the bones are
pneumatic ; in which respect the Eurylemide differ from the
Cotingide, which have a pneumatic femur, and resemble many of
the Coraciidee.
The femur islongand slender. The popliteal fossa is represented
only by a shallow depression.
The tibio-tarsus has moderately well-developed ecto- and ento-
cnemial crests and a long fibular crest. The shaft is curved first
forwards, then inwards, so that the distal end thereof is markedly
inflected. The extensor bridge is ossified. The intercondylar
gorge is deep. The fibula extends to below ple level of the middle
of the shaft of the tibio-tarsus.
The tarso-metatarsus is moderately long. The hypotarsus is
complex. The distal end of the shaft is flattened from before
backwards, and laterally expanded to form the condyle for digits
II-IV. These condyles all extend forwards to practically the
same level, the middle condyle scarcely projecting beyond the level
Proc. Zoou. Soc.—1905, Vor. II. No. 1V 4
50 MR. W. P. PYCRAFT ON THE [May 2,
of those on either side. In section the shaft is subeylindrical.
Me. I. is long, as in the Passeres.
The pelvic limbs of the Eurylemide and Cotingide can be
distinguished from the limbs of the syndactyle members of the
Coraciiformes by the fact that, m the latter, the tarso-metatarsus
is either broad and flat, or deeply grooved anteriorly, and is more
or less triangular in section. Further, the cnemial crests of the
tibio-tarsus are, in the Coraciiformes having this type of feet, but
feebly developed.
x. SUMMARY.
Regarded, by common consent, as. the most lowly of the
Passeriformes, the Eur ‘ylemidz are at the same time an extremely
specialised group ; much more so than has been hitherto recognised.
Such a condition might have been expected indeed, inasmuch as
this is a common feature among primitive groups.
Nowhere is this specialisation more conspicuous than in the
skull. The basipterygoid processes have entirely disappeared ;
the maxillo-palatines have been reduced from broad triangular
plates to rod-like splints; and a singularly perfect fronto- nasal
hinge has been developed. In some genera, as in Corydon, the
beak has vastly increased in size, and has acquired a markedly
hooked shape, as well as a great increase in breadth. Nor is this
all. The vomer presents a number of gradations in the direction
of reduction and degeneracy ; and this is true also of the nasals,
whereby the anterior narial fossa—which, by the way, is only in
fact a narial fossa in so far as its extreme anterior end is concerned—
is enormously enlarged. The lachrymal has been reduced to a
mere vestige embedded, though still free, in the anterior face of
the antorbital plate as im Calyptomena, or it is wanting as in
Corydon. The palato-pterygoid articulation is also specialised ;
so too is the nature of the vomerine support, this haying been
transferred from the pterygoids to that of the palatines. The
hemipterygoid element appears to be wanting, but traces of this
may turn up in the nestlings of Calyptomena.
Evidence of yet further specialisation is obtained from a study of
the nestling skull. Besides the disappearance of the hemipteryg oid
just referred to, the squamosal gives unquestionable proof in this
direction; yet, at the same time, having preserved the essential
characters of its shape, this element, more than any other bone
in the skull, affords testimony of no uncertain kind as to the truly
Passerine character of the group. Roughly L-shaped, there can
nevertheless be no doubt, from the general contours of the bone,
that it has been derived from a larger and more conical plate
resembling that which obtains in the Corvide for example.
Further, as in all the Passeres, the long axis of this bone is
continued upwards and forwards beyond the parietal so as, in short,
to overlap the frontal. So far as I have yet been able to ascertain,
such an extension does not obtain anywhere among the Coracii-
1905. | OSTEOLOGY OF THE EURYLEH MIDE, 51
formes. A further indication of specialisation is the fact that
the squamosal, in all the Passeriformes and most of the Coracii-
formes, has absorbed the underlying bones so that it now
appears, almost in its entirety, within the cranial cavity. The
remarkable variations which obtain in the Class Aves, mm the form
and arrangement of the membrane-bones are of considerable
interest. These changes seem to follow along certain definite
lines, and are the more remarkable because, save for the first few
weeks of the bird’s life (the nestling period in short), these bones,
as separate entities, cease to exist, being fused to form one
homogeneous tissue. Yet progressive evolution is as obvious as in,
say, the sternum or pelvis; though they cannot be individually
influenced by the strains and stresses incident to the struggle for
existence in the same way as if they maintained their individuality
throughout life, or for at least some considerable time after leaving
the nest. This is a point to which I propose to return later.
So far we have described only the specialised features of the
skull; what of the primitive? It is difficult to speak with any
degree of certainty on this point. The small size of the
anterior, posterior, and superior tympanic recesses, and of the
tympanic cavity, may be reckoned in this category; and so too,
probably, should the long narrow vomer as seen in Calyptomena.
The close approximation of the otic and squamosal heads of the
quadrate is an undoubtedly primitive character. These, in the
mee are barely separated ; in the Corvide, for example,
they are comparatively wide apart. These few points seem to sum
up all the evidence that is obtainable on this question.
How far specialisation has gone in the skulls within this group
may be seen at a glance by comparing the skull of Calyptomena
with, say, that of Cor ydon. In the latter the antorbital plate is
oveatly reduced in size and thickness, and the lachrymal is
wanting. The beak is markedly wider, more hooked, and
articulates with the frontal by a more pronounced nasal hinge,
while the nasal septum is obliterated by the inflation of the nasal
processes of the premaxilla.
The simple, unforked condition of the spina externa of the
sternum is undoubtedly a primitive character; and in the form
of the pelvic girdle this group is less advanced than in the
remaining Passeres.
Before proceeding to discuss the relationship of the Hurylemid
to the remaining Passeres, it would be well to saya few words as to
the wider question, of the probable allies of the Hurylemide
outside the Passeres. This is a matter on which it is impossible
to dogmatise ; at most, one can but throw out suggestions, of a
very nebulous character.
It will be found, probably, that Fiirbringer (3) has come nearest
to the solution of this problem. He points to a relationship
between the Hurylemide and the Cypseli, and a yet closer alliance
with the Pici. Affinities to the Coraciidse he regards as remote
indeed.
A*
52 MR. W. P. PYCRAFT ON THE [May 2,
My own work most certainly tends to support Fiirbringer’s
conclusions. it 1s possible that the Hurylemidz will prove to
be related both to the Caprimulgi and Cypseli. As regards the
connection with the Pici, it is significant to note that the squamosal,
in the nestling, closely resembles that of the Passerine type, mas-
much as it overlaps the frontal, an arrangement which does not
appear to occur elsewhere among the Coraciiformes.
Coming now to the question of the relationship of the Eury-
lemide to the remaining Passeres, I would remark, at the
outset, that there seems scarcely sufficient ground for separating
the former so widely from the latter as has been done by many
during recent years. This separation foreshadowed by Garrod,
and consummated by Forbes, has been widened even further than
either of these distinguished workers would have considered
justified.
Forbes, just twenty-five years ago (2), summarised the main
features of the Eurylemide, from the systematic point of view,
as follows:—“.... They are not Tracheophone; and in that
they possess the sciatic instead of the femoral artery, they differ
from the Pipride and Cotingide, with which they have so often
been associated. From these, too, they differ, as uey do from
the Tyrannide, Pittide, and Rupicola, in the details * of the syrinx
as well as in the simple manubrium sterni and other points. As
has already been stated, they differ from all the other Passeres in
the retention of a vinculum in the deep plantars of the foot... .”
In a second contribution to this subject during the same month
these views were repeated. After referring again to the syrinx
and syndactyle foot, he goes on to remark :—‘‘ The peculiarities
of the EKurylemide, and especially their oft-spoken-of retention
of the plantar vinculum, are sufficient, I think, to justify their
forming a main division of Passeres by themselves, as suggested by
Prof. Garrod, which may be termed Desmodactyli, in distinction
from the wunens. Eleutherodactyl . . .”
It seems to me open to question whether so wide a separation
is justified.
After all, the existence, or rather we may say the survival, of
the plantar vinculum is not so very surprising, not more so than
the persistence of basipterygoid processes for example—which
crop up sporadically among groups which have, as a whole, long
since lost them. In Calyptomena, according to Beddard, this
vinculum is wanting. Some importance has “been given to the
statement made by Forbes, that in Hurylemus ochromelas there
is a second vinculum : the additional slip “‘being given off lower
down, from the hallux tendon, which joins the tendon of the
digital flexor at the point where the latter, splitting into three,
receives the main vinculum.” Gadow (4), commenting on this
statement, remarks that this arrangement closely agrees with what
obtains in Upupa and Jrrisor, a fact which suggests the origin of
the Passerine plantars from this type.
* Italics mine.—W. P. P.
1905. | OSTEOLOGY OF THE EURYLAMID&. D3
Though I looked carefully for this slip, I failed to find it, yet I
examined three or four specimens.
Forbes showed that, in the matter of the syrinx, the Hurylemide
agree most nearly with the Philepittide of the Old World; and,
after that, with the Cotingide, Pipridee, and Tyrannide of the New
World. This organ is of the ‘ Mesomyodian,” “ tracheo-bronchial ”
type, or, to adopt Gadow’s term, the syrinx is tracheo-bronchial
and ‘“* Anisomyodean.”
Had the syrinx instead of the plantar tendons been adopted as
the basis of classification for this group, then the Cotingide
would have been regarded as the more primitive group, inasmuch
as in Lipaugus cineraceus the intrinsic muscle, according to
Beddard, is of great width, “which seems to foreshadow its
division in the Oscines into a complex of muscles... .”
The many characters which the Eurylemide and Cotingide
share in common—skeletal, muscular, syringeal, pterylological,
&e.—are surely proofs that these two groups are much more nearly
allied than is generally supposed to-day: the lkenesses are too
many and distinct to be put down to convergence or correlated
variation.
The fact that the spina externa of the sternum is simple is
generally bracketed together with the plantar tendons, and other
characters, so as to emphasise the primitive character of the
Eurylemide. But this same peculiarity of the sternum occurs
again in the Cotingide. The pterylosis of the Eurylemide is
generally regarded as peculiar : as a matter of fact, it is hard to
distinguish from that of the Cotingide. The syndactyle foot
again turns up—in the Cotingide. We have already described
the close resemblances which obtain in the skulls of these two
groups.
Turning now to the muscular system. The syringeal muscles
we have already referred to. They offer no striking peculiarities
of structure. Indeed, the only muscles which seem to call for
comment in this summary are the brevis and longus divisions of
the deltoidews. The separation of this muscle into two distinct
parts is nowhere so complete as in the Passeres.
In its primitive (archicentric) condition, this muscle arises, in
part from the acromion and inner face of the expanded free
end of the clavicle and in part from the os humero-scapulare and
crista lateralis of the humerus. It is inserted by a common
tendon into the base of the ectepicondyloid process; the tendon
forming the terminal of a practically homogeneous muscle.
I have not yet had time to study the apocentricities of this
muscle, but it would appear that as specialisation proceeds it
breaks up into two more or less equal and perfectly distinct
muscles terminating in a common tendon: later the brevis
portion becomes suppressed and the longus much shortened, each
receding farther and farther up the shaft of the humerus.
T have only just realised the potentialities of this muscle as a
factor in systematic work, and therefore have no large series of
54 MR. W. P. PYCRAFT ON THE [May 2,
data to support this interpretation. But the facts, in so far as they
are relevant to the present paper, seem to show that the primitive
(archicentric) condition is represented fairly well in, say, Paradisea.
In Corvus corax the longus portion is degenerate and fuses with
the brevis just below the middle of the shaft of the humerus, the
brevis portion then running downwards, ultimately becoming
tendinous and passing to its Insertion at the base of the ectepi-
Text-fig. 15.
Dissection of arm, dorsal aspect, of Hwrylemus ochromelas, to show the deltoideus
major longus and brevis. The longus portion has been cut through the middle,
and the two halves drawn in opposite directions. The brevis portion has now
become very degenerate and quite functionless.
d.m.b., deltoideus major brevis; d.m./., deltoideus major longus;
a., anconeus ; i., humerus: ., nervus radialis.
condylar process. In Séwrnws both portions are extremely well
developed, and perfectly separate until the distal end is attained,
where they fuse in a fleshy insertion in which may be traced two
distinct incipient tendons.
1905. ] OSTEOLOGY OF THE EURYLEMID#. DD
In the Eurylemidz and Cotingide—at least in so far as
Rupicola is concerned—the major portion is well developed, but
the brevis portion has now receded, not extending beyond the
middle of the humerus, and having an entirely fleshy insertion ;
the longus portion, on the other hand, is slender and terminates
in a long tendon.
This interpretation of the transformations of the deltoides
major et minor, it will be noticed, runs directly counter to that of
Dr. Chalmers Mitchell, who, in a paper “On the Anatomy of
Gruiform Birds” (6), contended that apocentricity in this muscle
was shown by the gradual extension down the shaft of the major
portion. It would seem, rather, as if the archicentric condition
were represented by the maximum downward extension, and that
apocentricity is represented by the gradual reduction of muscular
tissue.
That this reduction and inevitable suppression of the brevis
portion represents an extremely specialised condition there can be
no doubt; and the fact that it is shared also by the Cotingidee
seems to me, coupled with the numerous other points which these
two groups share in common, to show conclusively that the
EKurylemide and Cotingide must henceforth be regarded as very
closely related forms.
These two groups differ in some other myological characters, as
might be expected. The most noticeable is the fact that the
latissimus dorsi posterior in the Cotingide appears to be wanting,
though it must be remarked J have only been able to examine a
single specimen of Rupicola in this connection. In the Euryle-
mide both muscles are present, strap-shaped in form, and widely
separated ; therein differing from the Corvide, in which they are
of considerable size and shghtly overlap one another. But this
feature is one of many primitive characters which the Corvide
have retained.
The peculiar myological resemblances which these birds share
do not necessarily imply relationship ; but, as I have just remarked,
there are so many structures in which these two groups agree,
that it is impossible to entertain any notion of convergent
resemblance between the two. The poimts of likeness are so
peculiar, and affect such different, independent systems, that
correlated variation and convergence cannot be regarded as a
satisfactory explanation of the case. When two apparently con-
vergent forms come to be particularised, each new point of
resemblance which is brought to light is to be regarded as an
additional link in the chain of evidence, establishing the common
origin of the two forms in question.
Thus, then, I contend there is no evidence which will justify
the present isolated position which has been almost universally
assigned to this group during the last few years. It is quite
possible that further investigation will show that the Eurylemide
are entitled to rank no higher than a subfamily of the Cotingide.
56 ON THE OSTEOLOGY OF THE EURYLAMID&. [May 2,
But this point, as well as the status of the ‘‘ Passeres Clamatores,”
I propose to deal with in a further communication at no distant
date.
xl, List or LivERATURE REFERRED TO.
(1) Bepparp, F. E.—The Structure and Classification of Birds.
(2) Forses, W. A.—* Contributions to the Anatomy of Passerine
Bucdsy) Parts ies Ma ae Zias, es:
(3) Firprincer, M.—“ Zur vergleich. Anat. des Brustschultes-
apparates.” Jenaisch. Zeitschr. f. Naturwiss. xxxvi. 1902.
(4) Gapow, H.—Bronn’s Thier-Reich. Systemat. Theil, Band vi.
Vogel. 1893.
(5) Garrop, A. H.—‘ On some Anatomical Characters which bear
upon the Major Divisions of the Passerine Birds.” Part I.
IP, Ay So MSG.
(6) Mrrenent, P. C.—‘ On the Anatomy of Gruiform Birds.”
lin Mop LEO, WOls il, 10, O28).
(7) Suarpe, R. B.—A Review of Recent Attempts to Classify
Birds. 1891.
xii. EXPLANATION OF PLATE II.
Fig. 1. Inner aspect of skull of nestling Hurylemus showing the large area occupied
by the squamosal.
Ua, Outer view of same skull showing the peculiar form of the squamosal.
« Side view of Calyptomena viridis showing the peculiar lachrymal, large
narial aperture, and large and spongy antorbital process.
2a. Ventral view of same skull to show the vomer, maxillo-palatine processes,
and wide-set palatines.
2b. Dorsal aspect of same skull to show the large size of the nasal fossa and
the nasal hinge.
3. Ventral aspect of skull of Cymbirhynchus showing the slender maxillo-
palatine processes, short vomer, and sharply bent palatines. Note the
difference between the palatal surface of this species and that of
Calyptomena.
3a. Dorsal aspect of same skull to show the closing in of the nasal fossa and
the formation of pseudo-nasal apertures.
4, Dorsal aspect of the skull of Corydon to show the large size of the narial
apertures and nasal hinge.
Heplanation of Letters.
a.0.p. = antorbital process. na. = nasal.
als. = alisphenoid. n.h. = nasal hinge.
a.p.v. = anterior palatine vacuity. p. = parietal.
b.oc. = basi-occipital. pa. = palatine.
b.s. = basisphenoid. pa. = posterior nares.
ex. = exoccipital. /p.o.p. = postorbital process.
Jr. = frontal. pro. = prootic.
h.pt. = hemipterygoid. pt. = pterygoid.
1. = lachrymal. S.n. = septum nasi.
mes. = mesethmoid. sq. = squamosal.
ma.p. = maxillo-palatine. v. = vomer.
1905. ] MR. OLDFIELD THOMAS ON A NEW GOLDEN MOLE. 57
May 16, 1905.
G. A. BouLencer, Esq., F.R.S., Vice-President,
in the Chair.
The Secretary read the following report on the additions that
had been made to the Society’s Menagerie in April 1905 :—
The registered additions to the Society’s Menagerie during the
month of April were 205 in number. Of these 67 were acquired
by presentation and 19 by purchase, 104 were received on deposit,
9 by exchange, and 6 were born in the Gardens. The total
number of departures during the same period, by death and
removals, was 126.
Amongst the additions special attention may be directed to :—
A young female Chimpanzee (Anthropopithecus troglodytes),
deposited on April 8th.
A young female Giraffe from Northern Nigeria, probably
belonging to the race known as Giraffa camelopardalis peralta,
purchased on April 7th.
A young male Huanaco (Lama huanacos), from Punta Arenas,
Tierra del Fuego, presented by Mr. Moritz Braun and Capt. R.
Crawshay on April 10th.
A pair of Concave-casqued Hornbills (Dichoceros bicornis) from
India, purchased on April 4th.
Mr. Oldfield Thomas, F.R.S., exhibited examples of a new
- Golden Mole from Knysna, Cape ‘Colony, which had been obtained
by Mr. Grant in connection with Mr. C. D. Rudd’s exploration
of South Africa, and which he proposed to name in honour of
Mrs. Rudd, who had taken much interest in the results of the
exploration.
AMBLYSOMUS CoRRIZ Thos.*, Abstr. P. Z.S. No. 20, p. 5,
May 23, 1905.
Rather smaller than A. hottentotius. General colour dark
smoky blackish, darker than in 4. iris, with a beautiful iridescent
sheen, greenish to coppery violet, over the whole upper surface.
Sides and belly not or scarcely lighter, a slight brownish tone
occasionally present along the centre of the abdomen. Hairs of
back 8-9 mm. in length, their bases dark slaty grey, them ends
lighter and more brownish grey subterminally and their tips
iridescent blackish brown. Crown and forehead like back. Cheeks
paler, greyish or yellowish, but not conspicuously contrasted.
Limbs and upper surface of hind feet smoke-grey.
Skull (Pl. XVI. + fig. 3) in its general characters like that of
* (The complete account of the new species described in this communication
appears here ; but since the name and preliminary diagnosis were published in the
‘ Abstract,’ the species is distinguished by the name being underlined.—Hprror. |
+ P.Z.S. 1905, vol. i. p. 254. .
58 MR. H. B. FANTHAM ON A NEW SPOROZOON. | May 16,
A. hottentottus, but markedly narrower across the brain-case ;
and the zygomata less thickened at their posterior base. As a
result, the two skulls beg of about the same length, the general
outline was much less broadly triangular. Muzzle and inter-
orbital region narrow and delicate.
Outer edge of permanent teeth narrow antero-posteriorly, and
of milk-teeth broad with conspicuous cusps, as shown in the Plate.
The anterior premolar triangular, not extended transversely as
in A. obtusirostris and chrysillus.
Dimensions of the type, measured in the flesh :—Head and
body 129 mm.; hind foot 13.
Skull—ereatest length 28, basal length 22:6; greatest breadth
across brain-case 16°6; greatest height 12°6; imterorbital breadth
8; front of i to back of m* 10:5; palate, breadth across
premolars 8-1.
An adult female had a head and body length of 118 mm. ;
ereatest skull length 25:7.
Hab. Kuysna, 8. Cape Colony. ‘In Forest.”
Type. Oldmale. Original number 1021. Collected 25 January,
1905, by C. H. B. Gheats and presented to the British Museum by
Mr. ©. D. Rudd. Ten specimens examined.
This handsome little species was not only a very interesting
discovery in itself, but the fine series of it obtained by
Mr. Grant, of both sexes and different ages, had enabled
Mr. Thomas to identify with confidence the milk and permanent
dentitions of the specimen figured in the plate illustrating his
paper on the Zululand Mammals collected by Mr. Grant. No
proper knowledge of the respective characters of the two den-
titions had hitherto existed.
My. H. B. Fantham, B.Sc., F.Z.8., exhibited microscopic
slides of and made remarks upon Lankesterella tritonis, N. Sp., a
Hemogregarine parasitic in the red blood-corpuscles of a Newt,
Triton cristatus (Molge cristata). Blackboard sketches were made
illustrating the life-history of the parasite so far as was known.
This parasite was found some time ago by the exhibitor while
working in the Zoological Laboratory, University College, London.
Afterwards his observations were independently confirmed by
Dr. A. C. Stevenson. Up to the present the trophozoite and
schizogonous stages only had been seen, and the sporogony
pr obably took place in an intermediate host. Schaudinn’s and
Siegel’s recent observations on the sporogony of allied parasites
in the lizard and water-tortoise were quoted in support of this
view, and mention was made of the inaccuracy of Hintze’s account
of the sporogony of Z. ranarum in the intestine of the frog,
the cysts therein mentioned probably being Eimerian stages of a
Coecidian.
The trophozoites, vermiform in shape, were apparently 5 py to
6 » in length, and slightly over 1» broad. They became U-shaped
1905.] ON THE ENCEPHALIC ARTERIAL SYSTEM IN SAUROPSIDA. 59
and gave rise to “rosette-stages,” about 2°5 p to 3°5 jin diameter.
A “rosette” consisted of a schizont dividing up into merozoites.
This parasite was probably the smallest Hemogregarine yet
described, and it occurred in large red blood-corpuscles, those
of Triton cristatus being about 30, in long diameter. The
research on this parasite and allied forms was being continued.
The following papers were read :—
1. A Contribution to the Knowledge of the Encephalic
Arterial System in Sauropsida. By Frank E. Bepparp,
M.A., F.R.S., Prosector to the Society.
[Received March 29, 1905. |
(Text-figures 16—21.)
The following pages contain some facts relating to the principal
vessels of the arterial system of the brain in a number of Lizards,
in a Python, and in the giant Tortoise, Zestudo vicina. Some of
these have not been hitherto studied; some have been examined
by Rathke and others, and references to these anatomists will be
found in the proper place. Most of the brains which I describe
are now in the Museum of the Royal College of Surgeons. My
principal object has been, next to the recording of new facts, to
ascertain how far the characters offered by the distribution of
these vessels, which are undoubtedly of use in the systematic
arrangement of mammals, are also of use in the remaining
Vertebrata for a like purpose.
§ Brain of Varanus exanthematicus.
Although the cerebral arterial system of Varanus griseus has
been described by Corti*, I have a few notes to add to his
description and comparisons to make with the other genera treated
of in the present communication.
The two vertebral veins are strong and mark the posterior end
of the medulla, precisely as is the case with Jguana. The
posterior pair of cerebellar arteries arise, as in /gwana, from the
basilar artery at the middle of the medulla, and are larger than
the anterior pair, which arise from the fork of the basilar in front.
This fork is not quite so symmetrical as in Jguana. ‘The left side
and the left carotid are rather thicker than the right, and there
is thus a suggestion of the marked inequality of these arteries in
Python. The branches to the corpora bigemina and to the rest of
the brain are quite as in /guana; but the large size of the
ophthalmic arteries is a point of likeness to Python.
* De systemate vasorum Psammosauri grisei. 1853.
60 MR. F, E, BEDDARD ON THE ENCEPHALIC [May 16,
§ Brain of Iguana tuberculata.
The plan of the cerebral arteries in this Lizard differs in a
number of particulars from that which will be shortly described.
The anterior spinal artery, though of considerable size, is yet
of less calibre than the basilar, with which it is nevertheless in
perfect continuity. The exit of the posterior pair of cerebellar
arteries marks the middle of the medulla. These arteries are
slightly asymmetrical, the left being a little in advance of the
right. They arise behind the point of origin of the 6th pair of
cranial nerves. The anterior pair of cerebellar arteries arise just
after the division of the basilar artery to form the carotids on each
side; they are distinctly smaller than the posterior pair.
The two branches of the basilar are approximately equal in size,
as are the carotids which join them very shortly after the bifur-
cation of the basilar. The point of junction is just at the point
of origin of the anterior cerebellar arteries: In this, it will be
observed, is a slight difference from the figure of the cerebral
arterial system of this Lizard given by Rathke*. The next artery
arising from the circle of Willis is in front of the third nerve
(to the inside of which nerve passes the forward continuation of
the carotid, as in other vertebrates) and supplies chiefly the corpus
bigeminum of its side ; but it also gives off a branch each to the
cerebellum and to the cerebral hemisphere. A little way anterior
to this is a much more slender vessel which is absolutely
symmetrical on both sides of the body and which almost at once
divides into two branches; one of these ends upon the in-
fundibulum, the other reaches the optic nerve of its side. Beyond
this again arises the posterior cerebral artery. This artery reaches
the hemisphere just at the furrow which divides it from the
corpus bigeminum and runs parallel to the cerebral branch of the
bigeminal artery.
A little further forward the carotid finally divides into two
arteries. The outer and stronger branch may be termed the
middle cerebral; it runs forwards, curving outwards in the middle
so as to be crescent-shaped, to the long and slender olfactory bulbs,
giving off numerous slender branches to the hemisphere on its way.
The inner branch very soon again divides into two: the innermost
of them is the ophthalmic artery; the outer runs forward along
the median ventral line of the brain in close contact with its fellow
of the opposite side.
* “ Untersuchungen itiber die Aortenwiirzeln &c. der Saurier,” Denkschr. k. Akad.
Wiss. Wien, xiii. 1857, p. 51.
[Since this paper was read Mr. R. H. Burne has kindly directed my attention to a
paper by Dr. Hofmann in Zeitschr. f. Morph. u. Anthr. ii. 1900, in which the arterial
system of the brain is described in a number of Fishes, Amphibia, Birds, and
Mammals, and in the following Reptiles, viz. Iguana, Tropidonotus natrix, Croco-
dile, and Testudo greca. That of the last alone (among Reptiles) is figured. This
paper has been apparently overlooked by the recorders of the Mammalia, Aves, and
Reptilia in the ‘ Zoological Record’ for 1900; but it is catalogued by the recorder of
“General Subjects.”’—July 6th. |
1905. ] ARTERIAL SYSTEM IN SAUROPSIDA. 61
§ Brain of Tropidurus hispidus.
In comparing the arterial system of the brain of this Iguanoid
with those of the other species of Lacertilia with which I have
dealt, I am unable to say anything about the cerebellar arteries,
which were not visible in the specimen examined by me. The
bifurcation of the basilar artery in front at rather an acute angle
consisted of equally-sized vessels, and the carotids which joined
these arteries behind the third pair of nerves were also equal.
The arteries to the corpora bigemina disappear at once in the
groove separating each corpus bigeminum from the hind brain.
The other arteries of the brain seem to be as in other Lacertilia.
$ Brain of Eumeces algeriensis.
The arrangement of the arteries of the brain in this Skink,
which, so far as I am aware, has not been described, shows
certain differences from that of both Varanus and Jguana.
These features are illustrated in the accompanying drawing
(text-fig. 16, p. 62). The fusion of the vertebral arteries with
the basilar marks, as 1s usual, the end of the medulla. From the
basilar artery arise a number of branches of which the posterior
cerebellar arteries are the most important; of these the left artery
arises in advance of the right and it is shortly reinforced by
another branch. The bifurcation of the basilar anteriorly begins
further back than in both Varanws and Jqguana; and another
difference from the conditions observable in these two genera is
to be noted. In these Saurians the carotids join the circle of
Willis behind the origin of the third pair of nerves; in Hwmeces
these arteries join the circle of Willis well in front of the third
nerves, and therefore also in front of the slender anterior
cerebellar arteries, and of the artery supplying the corpus
bigeminum on each side. This artery not only supplies the
corpus bigeminum but also the cerebellum, and it sends a branch
forward which runs parallel to the posterior cerebral artery, and
like it is lost in the groove separating the fore brain from the
mid brain. Between this artery and the middle cerebral or
Sylvian is a slender twig hke that of Zguana which runs to the
base of the optic nerves. The anterior cerebral, which gives off
the ophthalmic artery, is considerably thicker than the middle
cerebral artery.
§ Brain of Gerrhosaurus.
As is the case with Hwmeces, the basilar artery in Gerrhosaurus
(see text-fig. 17, p. 62) divides rather further back than it does in
either Jguana or Varanus. There is, moreover, a very distinct in-
equality of calibre in the two arteries ; the right is in fact consider-
ably larger than the left. This inequality does not, however, extend
to the two carotids, which are equal in size. These join the circle
of Willis only just in front of the point of origin of the anterior
62 MR. F. E. BEDDARD ON THE ENCEPHALIC [May 16,
cerebellar arteries, which latter, as in other Lizards, are smaller
than the posterior pair. The place at which the carotids join
the circle of Willis is only just behind the third pair of cerebral
Text-fig. 16. Text-fig, 17.
Text-fig. 16.—EHumeces algeriensis. Ventral aspect of brain, showing chief arteries.
ca. Carotids ; op. Optic nerves; opth. Ophthalmic arteries; 3, third nerves.
Text-fig. 17.—Gerrhosaurus flavigularis. Ventral aspect of brain, showing chief
arteries. Lettermg as in text-fig. 16.
nerves. The order in which the remaining arteries of the brain
arise 1s quite similar to that of the other Lizards described here, .
and there are no particular comments to be made upon them.
§ Brain of Tupimambis nigropunctatus.
The most important branches arising on either side from the
1905. ] ARTERIAL SYSTEM IN SAUROPSIDA. 63
basilar artery are the posterior cerebellar, and these arise a little
behind the middle of the medulla. The two arteries are perfectly
syminetrical with each other as to their point of origin. They
are, however, different in their branching. The right artery
gives off, shortly after its origin from the basilar, a strong artery
running backwards along the side of the spinal cord. This
branch exists and pursues the same course on the left side; but
on that side of the brain it arises separately from the basilar
artery. Between the origin of the posterior cerebellar arteries and
the bifurcation of the basilar anteriorly are three pais of small
arteries supplying adjacent regions of the medulla. A slightly
larger artery, which is the anterior cerebellar, arises from the
fork of the basilar. This fork is U-shaped in the Teguexin (text-
fig. 18, p. 65), and not V-shaped as in the other Lizards described
here. The U-shape is due to the fact that the two carotids run
parallel to and almost in contact with each other for some distance
before they join the circle of Willis. The carotids, moreover, lie
within the area bounded by the third nerves very close to and about
ona level with those nerves. Theartery formed by the junction of
the basilar and carotid on each side, often spoken of merely as the
carotid, passes outwards and slightly backwards at first, when it is
practically at right angles with the basilar. In this region the
artery shows different relations on the two sides of the body. On
the left side it runs in front of the third nerve; on the right side
it lies behind that nerve. The first branch arising after the
carotid is at the bend of the artery, where it turns forward ; this
very stout artery supplies the cerebellum and optic lobe; im-
mediately in front of this is the artery of the optic lobe. This
state of affairs occurred on the left side of the body; on the right side
the two arteries arose by a common trunk. On both sides the
artery of the corpus bigeminum gives off an artery to the cerebral
hemisphere which buries itself in the furrow between the hemi-
sphere and the optic lobe. From the inner side of the circle of
Willis, just opposite to the bigeminal artery on the left side and to
the conjoined arteries just mentioned on the right side, arises an
artery which runs to the optic chiasma. This artery is precisely
like that of other Lacertilia. The next artery to be given off is
the posterior cerebral, which plunges at once into the furrow lying
between the optic lobe and the cerebral hemisphere. The middle
cerebral artery, which is the largest of the cerebral arteries, runs
in the usual way along the Sylvian depression, and just in front
of the point of origin of this the circle of Willis practically ends
in the strong ophthalmic arteries which follow the optic nerves.
There are therefore no differences of importance between the
arterial system of the brain of Zupinambis and of the other
genera of Lizards reported upon in the present communication.
§ Cerebral Arteries in the Lacertilia.
We may deduce from the facts just described the chief
64 MR. F. E. BEDDARD ON THE ENCEPHALIC [May 16,
characters of the encephalic arterial system in the Lacertilia for
purposes of comparison with those of other Vertebrates *.
{1) The entrance of the vertebral arteries into the anterior
spinal marks the end of the medulla oblongata.
(2) The posterior cerebellar arteries are the only conspicuous
arteries arising from the basilar; they arise at about the middle
of the medulla oblongata and behind the 6th pair of cranial
nerves; they are occasionally asymmetrical with each other.
(3) The anterior bifurcation of the basilar is at a more or less
acute angle according to its position; the slender anterior
cerebellar arteries are invariably given off from the bifurcated
basilar behind the point of origin of the third nerves; the two
branches of the basilar produced by the bifurcation may be
imequisized.
(4) The point of entrance of the carotids is not invariably the
same; it is sometimes in front of and sometimes behind the third
pair of nerves.
(5) The artery on each side to the corpus bigeminum sends
branches to the cerebellum and to the cerebral hemispheres. It
arises in front of the entrance of the carotids.
(6) In front of this artery is one which runs towards the optic
chiasma.
(7) There are three cerebral or hemispheral arteries: the
posterior reaches each hemisphere just at its junction with the
corpus bigeminum ; the middle one is Sylvian in position; the
anterior cerebral gives off the ophthalmic; there is no distinct
completion of the circle of Willis anteriorly.
(8) There is no strongly marked asymmetry in the cerebral
arterial system of the Lacertilia.
S$ Brain of Python molurus 7.
I have been able to study two injected brains of this serpent, of
which one is more completely injected than the other. The most
obvious and plain difference from the brains of other Sauropsida is
the marked asymmetry in the arterial system (text-fig. 19, p. 65),
which agrees of course with the vascular asymmetry shown else-
where among the Ophidia. This asymmetry, however, only concerns
the carotids. The other arteries of the brain, so far as I have been
able to study them, do not show anything of the kind, but indeed
a perfect regularity quite comparable to that shown in other
Sauropsida. Of the two carotids the left is very much the larger.
The basilar artery is single where it runs along the ventral surface
of the cord and brain, until of course it bifurcates anteriorly at
the commencement of the circle of Willis. The entrance of the
vertebral arteries marks the end of the medulla. These arteries,
which lie exactly opposite to each other, are very much stouter
than the basilar, which they combine with the anterior spinal to
* See below, pp. 66, 67, and 69, for comparison with Ophidia and Testudinata.
+ Rathke describes but does not figure brain-arteries of Ophidia in Denkschr.
Akad. Wiss. Wien, xi. 1855.
1905. ] ARTERIAL SYSTEM IN SAUROPSIDA, 65
form. In one of the two specimens at my disposal, I could not
see very well the actual mode of junction of the vertebral arteries
with the basilar. In the other it was plain and very complicated.
The basilar artery itself divides and immediately reunites, thus
forming a circle; the two vertebrals join below this circle, and
from the lower surface of this transversely running trunk two
Text-fig. 18. Text-fig. 19.
Text-fig. 18—Tupinambis nigropunctatus. Ventral aspect of brain, showing chief
arteries. Lettering as in text-fig. 16.
‘ext-fig. 19.—Python molurus. Ventral aspect of brain, showing chief arteries.
v. Vertebral arteries. Other letters as in text-fig. 16.
To the right of the figure is an enlarged representation of the junction
of the vertebral arteries with the basilar.
branches are given off, each of which joins one side of the circle
already referred to. I should not like to lay undue stress upon
the fact as absolutely characteristic of Pyfhon, since the arrange-
ment was not obvious in one specimen through deficiency of
injection.
Proc. Zoot. Soc.—1905, Vou. II. No. V. 5
66 MR. F. E. BEDDARD ON THE ENCEPHALIC [May 16,
A noteworthy difference exists between the two specimens in
relation to the course of the large left carotid. In the one
brain this artery lies outside of the dura mater for a large part
of its course, and gives off at least one branch to the brain which
perforated that membrane ; thus giving additional proof of the
fact that the carotid itself lies outside of the dura mater. In the
other brain I did not observe this state of affairs. It follows
that the left carotid exhibits an aloofness from the brain which
is remarkable, and that the branches therefrom do not run on
the same plane with it.
The arteries to the optic lobes arise from the basilar artery after
its bifurcation, between this point and the entrance of the carotids,
and further back still there is a smaller cerebellar artery. The
posterior cerebral artery is small and arises just in front of entrance
of the carotids. The next important artery is a cerebral, which
arises in front of the inflow of the carotids. This artery is the
middle cerebral or Sylvian of other animals, since it runs along the
rudimentary Sylvian fissure. The posterior cerebral is also partly
represented by several small branches of the artery to the optic
lobe. In front of the middle cerebral artery is a smaller anterior
cerebral artery.
Anteriorly to this the circle of Willis is completed in the
following way: the large left carotid bifurcates to form the two
nearly equally stout’ ophthalmic arteries which of course accom-
pany the optic nerves. Just before this bifurcation the slender
right carotid effects a junction with the common trunk.
Immediately in front of this a single trunk arises from the point
of bifurcation of the left carotid, which at once divides into two.
These vessels run closely side by side in the furrow which separates
the two hemispheres and rejoin at the extreme anterior end of the
brain, their course in fact recalling that of the callosal arteries
in mammals. The arteries are by no means inconspicuous, as 1s
shown in the annexed figure (text-fig. 19, p. 65).
T now draw, of course quite in a preliminary and tentative way,
a series of comparisons between the Ophidian and Lacertilian
brain arteries, enumerating the characters of the former in the
same order as already given (on p. 64) for the latter.
§ Cerebral Arteries in the Ophadia.
(1) The entrance of the vertebral arteries into the anterior
spinal marks the end of the medulla oblongata. These arteries
seem to be stouter than in the Lacertilia.
(2) There is no markedly large pair of cerebellar arteries arising
from the basilar artery, but a number of more or less equisized
arteries supplying the cerebellum and adjacent region.
(3) The two branches produced by the bifurcation of the basilar
are equisized. The anterior cerebellar arteries arise from the
bifurcated region.
(4) The point of entrance of the carotids appears to be rather
1905. | ARTERIAL SYSTEM IN SAUROPSIDA. 67
fay forward as compared with the Lacertilia; but this appearance
is at least partly due to the great length of the bifurcate region
of the basilar artery in Python as compared with that of any
Lacertilian.
(5) The artery to the corpus bigeminum on each side arises
behind the entrance of the carotid instead of in front as in
Lacertilia. It gives off branches to the cerebrum and also to the
cerebellum.
(6) In front of this artery and also in front of the carotid is an
artery which runs towards the optic chiasma.
(7) There is a very marked completion of the circle of Willis
anteriorly.
(8) There is a strongly marked asymmetry in the arterial
system of the brain due to the greater size of the left carotid.
§ Brain of Testudo vicina.
The most salient characteristic of the arterial system in this
Reptile is the double basilar artery (text-fig. 20, p.68). The artery
is double for the whole of its course beneath the medulla oblongata.
The anterior spinal artery in fact divides into two well behind
the medulla. The right-hand one of the two branches is not
larger than the left; the two arteries do not run close side by
side, but are separated by a considerable distance. They are
joined each of them by the carotid in front of the origin of the
third nerve. Behind the origin of the third nerve a large number
of arteries arise from the basilar on each side; there are certainly
eight or nine of them on each side, and they supply the cerebellum,
the medulla, and the cranial nerves of this region of the brain.
The fifth artery (on the right side at any rate), which arises from
the basilar behind the third nerve, is par excellence the cerebellar
artery ; it fuses with its fellow of the opposite side at the end
of the cerebellum. In front of the third nerve arise two arteries
rather close together, of which the anterior has several branches
and is the larger artery: it partly supplies the cerebral hemi-
spheres and corresponds, as I imagine, to that artery in the
Lacertilia which supplies the corpus bigeminum on each side.
Asinthe Lacertilia, there are two cerebral arteries on each side.
The first and largest of these (text-fig. 21, p. 68) may be termed the
Sylvian, as it runs along the lateral groove upon the hemisphere
which has been compared to the Sylvian fissure of mammals The
branches of this artery are not altogether symmetrical on tne two
sides of the body; it is possible, however, to distinguish the main
trunk which runs towards the top of the brain, where it divides
into a forwardly running anda backwardly running branch, several
branches from the main stem which pass backwards over the
temporal region of the hemisphere, and a strong branch running
forwards to the olfactory lobe. Moreover, there is plain on one
side a branch arising immediately after the origin of the Sylvian
artery, which plunges at once beneath the hemisphere. A second
5
68 MR. F, E, BEDDARD ON THE ENCEPHALIC [May 16,
cerebral artery arises from the circle of Willis a very short way in
front of the Sylvian artery. This vessel runs forwards parallel
Text-fig. 20. Text-fig. 21.
Text-fig. 20.—Testudo vicina. Ventral aspect of brain, showing chief arteries.
w. Junction of two halves of the circle of Willis anteriorly.
Other lettering as in text-fig. 16.
Text-fig. 21.—Testudo vicina. Lateral aspect of brain, showing chief arteries.
S. Sylvian. w. Junction of two halves of the circle of Willis anteriorly.
Other lettering as in text-fig. 16.
with and close to the olfactory branch of the Sylvian, and finally
ends in an anastomosis with the main stem, from which the
1905. ] ARTERIAL SYSTEM IN SAUROPSIDA. 69
olfactory branch arises beneath the olfactory lobe at the junction
of the latter with the cerebral hemisphere ; before this point of
junction a branch is given off to the olfactory lobe.
The circle of Willis is completed anteriorly ; it also ends in two
strong branches which run along the under surface of the brain,
anteriorly, giving off numerous branches at the junction of the
hemispheres with the olfactory lobes. One or more of these bend
downwards (as the brain is viewed from beneath) and pass through
the gap between the hemispheres running to the dorsal side of the
brain in a way which suggests the callosal artery of the mammals.
I could not detect anything more than a very small branch arising
where the ophthalmic arteries arise in the Lacertilia. I cannot
think that this artery is absent, but it is clearly not so conspicuous
as in the Lizards.
It is evident that the encephalic arterial system differs quite as
much from that of either Lizards or Snakes as do the encephalic
arterial systems in the two last mentioned groups.
It is thus plainly possible to distinguish between several types
of distribution of the cerebral arteries among the different divisions
of the Sauropsida, and there is, as is well known, another type
characteristic of mammals. It will be interesting to ascertain
how far these several types confirm views as to the relative
positions of the groups of Sauropsida under consideration. It will
not be held by anyone, I presume, that the class Aves represents
a primitive Sauropsidan type; and in agreement with this
presumption we find clear evidence of modification in the
encephalic arteries*, in the abortion of one or other of the
normal two branches of the basilar. On the other hand, the
arteries in question of birds are, as I think, undoubtedly primitive
in that there is no completion of the circle of Willis anteriorly.
A completed circle of Willis appears to me to be a secondary
modification mainly for the reason that in mammals, where it
occurs universally, it is there brought about in more than one way,
and is moreover associated with strong arteries in the anterior
region of the brain in close communication, or rather in close
apposition, and there is apt to be confluence between closely
apposed spaces and vessels. If this view be correct, we can set
aside the brain of the Python and that of Vestuwdo as showing
primitive characters by virtue of the fact that they have a closed
circle of Willis. And in addition to this, it may be pointed out
that the asymmetry of the arterial system in the Snake indicated
by the carotids, and the changes in the disposition of the vessels
due to the prevalence of the left carotid, can be fairly regarded as
being secondary. This conclusion is obviously in accord with the
current views of the relations of the Ophidia to other reptiles.
There only remains the Lacertilia.
It is, in my opinion, probable that in this group (and in
Hatteria) the whole question lies of the antiquity of existing
* P.Z.S. 1905, vol. i. p. 102.
70 SIR HARRY H. JOHNSTON ON THE [May 16,
reptiles. And it must be admitted at onee that the facts dealt
with in the present communication do not conform with any
certainty to one view or to the other. On the whole, however,
they seem to point to the Lacertilian; since from that type
the remaining schemes of encephalic arterial arrangement can
be derived, while the extraordinary modification of the basilar
artery in Z'estudo, found nowhere else, would seem for that very
reason to be a divergence from the original condition.
2. On the Nomenclature of the Anthropoid Apes as proposed
by the Hon. Walter Rothschild. By Sir H. H.
JouNnsToN, G.C.M.G., K.C.B., F.Z.S.
[Received May 5, 1905. |
I should like to make a few remarks on the admirable paper
written on this subject by Mr. Walter Rothschild, which has just
appeared in the ‘ Proceedings’ (1904, vol. ii. p. 413). Unfortu-
nately, I did not know that this paper was going to be read
in December 1904, or I should have endeavoured to be present.
T am disposed in a general way to agree with Mr. Rothschild’s
classification of the great Apes of Africa. I have only one
criticism to offer with respect to the nomenclature of the
Jhimpanzees. Since Mr. Rothschild has done so much to revise,
revive, and establish the nomenclature of these Apes, I should lke
to see him introduce a more rational spelling into the third of his
species of Chimpanzees—the Bald Chimpanzee, which he gives,
following Du Chaillu, as Simia koolookamba. Du Chaillu was
very inaccurate in his transcription of African words, and he used
the cumbrous system of English transliteration which prevailed
until the rational spelling was introduced thirty or forty years
ago by various scientific societies and departments of the Govern-
ment. Koolookamba is really two words, which are pronounced
nkulu-nkamba. J think that this spelling might stand in
preference to Koolookamba [Simia nkulunkamba).
A much more serious point, however, is the generic name which
Mr. Rothschild gives to the Orangs—Pongo. Mr. Rothschild is
undoubtedly right in reviving Simia as the most appropriate and
the earliest name for the Chimpanzee genus, to which it was
applied in the first instance by Linneus. Linneus evidently
thought that the differences between the Chimpanzee and the
Orang, which animal was later brought to his notice, were not more
than specific, so that he included the Orang in the Chimpanzee
genus. Much later, in 1799, Lacépéde applied the generic name
Pongo to the Orangs; and although in the same year the Orang
genus was named Satyrus, Mr. Rothschild prefers Pongo to this
very appropriate designation, and wishes to establish Pongo as the
generic name for the Orangs. I would certainly protest against
this. There is much to connect the Satyr of the Classical world
and Medizval mummeries with traditions of a red-haired man-of-
1905. | NOMENCLATURE OF THE ANTHROPOID APES, 71
the-woods—the Orang—which had filtered to Europe through
India and the Levant, and the Arab sea-berne trade from Sumatra ;
but Pongo is an African word originally applied to the Chimpanzee,
and in all probability derived from the Bantu dialects of Angola,
south of the Congo. The proper spelling of this word is Miponee,
and it is a root which, in varying forms, is found in a number ot
Bantu dialects and languages in Western and Equatorial Africa,
and used to indicate either a chimpanzee or a big baboon*. I have
not got access to various old books at the time of writing, but I
think I am correct in saying that English and Dutch travellers on
the West Coast of Africa in the 16th, 17th, and 18th centuries
referred to the Chimpanzee as ‘‘ Pongo.” I also fancy that the
same allusion and the same name are made use of by Buffon. As
in zoological nomenclature the preference is for the adoption of a
Latin or Greek name, it is a pity to introduce into our lists a
barbarous word in preference to one derived from either of the
classical languages. But when in addition an African word is
taken as the name of an Hast Asiatic genus, then the choice is
singularly inappropriate.
= Tt may be of interest to add the names for “Chimpanzee” in a number of
African languages, mostly collected by myself :—
LANGUAGE. DISTRICT. WorpD FoR CHIMPANZEE.
ILE sdgoneiscoocn vesdodenbooa | SHS IVAOS socconcoocaspsnconseasonccs uRaanien (KG ns Gig
prefix).
Vai. sonosoode sadanbecooupl) NAVGRtEGIN WURLRE) ” —Sossusadedadcoesoogs | a!Dutloe
Busi oo cccccccscsessese. North-western Liberia .. : Guru.
JHGRMWDGO 00 ona necaconcn North of Sierra Leone, "Liberia, Iburu.
and Ivory Coast.
GO WeSta ree eee an COntral Palberialerrt se Ibulu.
(GROIRD cooesosocebosysesescouen) tela Jems liner, VW est Central Onyi.
Le Liberia. e
Basauand eens Coast ol Centraluluibertares sees Ibe. |
Kru and Grebo............ Southern Liberia ..................... Tuawe
JZOP DIN: sonocosonboccoo scones LUMTSBOP QE IVES oho cen: ww ane Obo.
Tjo languages............... Brass, Bonny, “Niger Weltay eo: Tele.
LED OMe en eons sen eash (LOWE NIGER derek a ne ee Ozodimbas
ED Ulcer ere ae ere eae Old Calabar .o.cccccceccseeeis Idiok.
aaa ies fete vi } Lower Crosspiveriee cee rcs Enop or Enowi.
INKG ow ........10...s....... Extreme Upper Cross River ...... Boki.
Mbudikum ............... Sources of Cross River, N.E. of Apu or Epfu.
Cameroons.
Barondo and Isubu...... North Cameroons Coast ............ Ewaka.
WG XORGAHD caonadvaanedanccay “ERIKOOIN nosnnogaoacscaconsveonsadocasages ANIA TERD GING! ING NEEKO)s
also Nkulu.
TON GO conn sse tee ees Lower Congo and Congo Coast .... Mpongi.
Kimbundu .................. Angola (south of Lower Congo) ... _Mpongo.
[x*, The origin of
the name “ Pongo,’
of Buffon and others. |
Kiwemba [or me Bemba ... South-west of Tanganyika ......... Koroe.
Ki-guhea .. ee Westbancanyikaeanenressasasos elolires
Kabwari ............... North-west an canyalkay ere secees Soko.
Manyema .................. West of Tanganyika and extreme Soko.
Upper Congo.
Ruande ..................... North of Tanganyika ..............,_ Enjangwe.
Kifipa veces Hast Coast, Tanganyika ........... Isike.
DLu-ganda@ .................. West and North Coast of Victoria Edzike or Izike.
Nyanza.
72 SIR HARRY H. JOHNSTON ON THE [May 16,
T do not suppose much deference will be shown to my own
suggestions ; but it seems to me that the best generic name for
the Orangs would be Satyrus; or, if that is strongly objected to
because it may be confused with the specific name of one or two
Chimpanzees, then possibly Pithecus.
IT cannot help thinking that in this case, as in many other
instances, when we are settling for good and for all our biological
nomenclature, we carry too far the passion for asserting the prior
rights of the first invented name, which is occasionally a singularly
inappropriate one.
I will conclude my paper with a few remarks on the definite
knowledge of the different species of Anthropoid Apes from the
dawn of zoological science in Greece to the end of the 18th
Century of the present era, by which time European zoologists had
begun to discriminate pretty clearly between the Gibbons, the
Orang, and the Chimpanzee. Knowledge of the Gorilla of course
was not clearly defined till about 1848 or even later. It is
possible, however, that a living specimen of the Gorilla was
brought over to Holland in the latter part of the 17th Century.
A figure of this creature (which was a female) is given in
Dr. Tyson’s work on the Chimpanzee, published in London in 1699.
_ Aristotle, writing in about 330 B.c., divided the mammals that
were nearest to man into three closely allied groups: the Pithekoi
or Apes, the Keboi or Monkeys, and the Kunokephaloi or dog-
faced Baboons. In the Latin translations of Aristotle these
designations are rendered Simia, Cebi, and Canicipes. Aristotle’s
LANGUAGE. District. Worp For CHIMPANZEE.
Nyoroand Hima dialects. Unyoro, Toro, Ankole, and south- Isike, Yisiki,
west of Victoria Nyanza. Kchikuya,
Empundu, Kitera.
TROPPO cnpsenscagoarcenoonna Wiki, TREN KEMATN p00 5. sovanegeaa LWESKREED,
TARUEW occ ec ese esses... Forest, north-w est of Semliki Neule.
River (Mboga Country).
Bibira .....0.c.......... Congo Forest between Semliki R. Kika.
and Upper Congo (Aruwimi
basin).
Mangala and allied Upper Congo, between Aruwimi (Mu) Kumbuso
languages. and confluence of Mubangi Welle, (Mu- is only the
and between course of Congo and singular prefix).
vicinity of Welle River.
Lend y...... es: West of Albert Nyanza ............ Nerrr (2’s trilled).
Bambute pyginies ee Semliki-Aruwimi Forest . Un.
Momfu ....... + North-east Borderlands (Ce ongo- Tato.
Nile water parting) of Congo
Forest, west of Lendu.
SAL atropine dara tern eatin ese North of Albert Nyanza een Bin.
Madi ..........00.05..4..... (Western dialects of) West of Arugu.
Mountain Nile, north-east of
Congo Forest.
Makarka (Nyamnyam). Southern and Western parts of Baham or Bamu;
Bahr-el-Ghazal province of also Irangba and
Egyptian Sudan. Nderuma.
Mund... cccccecseees, North-east of Makarka.. ... Angé.
JECT ~ coreoae0oor North-west of Makarka redline. oe Deddar
foe sine tray selles and Philologists -¢ can fill up the gaps in this series of
names
1905. | NOMENCLATURE OF THE ANTHROPOID APES. 73
general description of the Pithekoi delineates very distinctly an
‘Anthropoid Ape, and reads as though it was derived from a
generalised knowledge of the Chimpanzee, a knowledge obtained
no doubt from specimens which had been brought down the Nile
from the Egyptian Sudan (in the southern parts of which the
animal still exists) to Lower Egypt. A good summary of
Aristotle’s description of the Pithekoi is given in Dr. Tyson’s
celebrated book ‘“‘On the Anatomy of a “Pyemie, sive Homo
sylvestris,’ which, as before stated, was published in 1699, and of
which there are copies in two or three of the principal libraries
of London.
T think I am correct in saying that in an Egyptian fresco or
papyrus which is exhibited in the Egyptian collection of the
Museum at Naples, a Chimpanzee is depicted amongst other strange
animals brought to Egypt from the Sudan. I believe also there
is a representation of the Chimpanzee on one of the Roman
mosaics recently brought to light at or near Carthage, and now
preserved in one of the Museums, either at Carthage or Tunis.
The Byzantine Greeks, who, after Alexandex’s conquests, ex-
tended their trade to India, and the Arabs of west, south, and
east Arabia, who maintained commercial relations with Sumatra,
the Malay Peninsula, North-west Borneo, and the ports of the
Persian Gulf and the Red Sea, may haye introduced some
knowledge of the Orang utan to Constantinople, to Egypt, and
to the Mediterranean world between 100 B.c. and the fall of the
Byzantine Empire.
Sir Walter Scott in his novel ‘Count Robert of Paris’ introduced
somewhat fantastically a captive Orang utan into the story. Iam
not aware what foundation he had for this incident ; and I think
it somewhat improbable that an Orang utan could at that period
have survived the overland journey from the Persian Gulf to the
Mediterranean, or the transit through Egypt.
Marco Polo, the Venetian, in 1296 or thereabouts, travelled
overland from Asia Minor to China and the Malay Peninsula, and
reached Sumatra and possibly Borneo, bringing back with him
stories of man-like apes, some of which cer tainly referred to the
Gibbons, while one or two may be attributed to the Orang utan.
Odorie, a friar of the Order of St. Francis, travelled overland
from Constantinople to India during the first half of the
14th Century, and from India reached Sumatra by sea. He
brought back distinct accounts of both Gibbons and Orangs.
Ibn Batuta, a Morocco Arab, also journeyed to those parts about
the same time, and described the Orang utan in his records.
Friar Giovanni dei Marignolli, a Franciscan like Odorie, also
travelled overland from France to China and thence to the Maiay
Archipelago during the first half of the 14th Century, and br ought
back from Sumatra, or more likely North Borneo, very distinct
accounts of the Orang utan.
At the commencement of the 16th Century the Portuguese
conquistadores reached Malacca and Sumatra in their ships, and
74 ON THE NOMENCLATURE OF THE ANTHROPOID APES. | May 16,
by 1521 had placed more or less roughly on the map all the big
islands of the Malay Archipelago. They were followed a few years
later by Spanish, Dutch, and French adventurers. During the
17th Century many British ships visited Sumatra and Borneo, and
the Malay name Orang utan was in current use in scientific Europe
during the second half of the 17th Century, having been originally
definitely applied to the man-like apes of Sumatra and Borneo*.
But towards the close of the 15th Century the Portuguese had
already become acquainted with the West Coast of Africa and
the Chimpanzee. They first noticed this creature in the southern
part of what is now the colony of Sierra Leone. They called it
in their earlier writings “ Selvage” (savage), and later ‘“ Barri.”
Later still they came to know more of the Chimpanzee in dealing
with the Lower Congo and Northern Angolay. It there went
under the name of Pongo, which as already explained is the
Angola name Mpongo. Andrew Battel, of the 16th Century, was
an Hssex fisherman. Through being shipwrecked off Brazil he got
conveyed into Portuguese captivity in Angola, Escaping, he
travelled into the northern part of Angola towards the Congo.
He returned to England and brought back with him stories of the
‘““Pongos,” which obviously referred to the Chimpanzee. The
name “Chimpanzee” does not seem to have come into vogue till
the latter part of the 18th Century, or to have been much used
until the 19th Century. I have no certain clue as to its origin;
but I have been told that it is a Loango word of which the root
would be -mpanzi or -mpangi (possibly, therefore, cognate with the
Congo name for Chimpanzee, mpongi), with the well-known Bantu
prefix chi (kz) added. This prefix is sometimes an augmentative,
so that chimpangi or chimpanzi might merely mean a big ape.
At the close of the 18th Century, Buffon, Linnzus, Lacépede,
and other zoologists had finally discriminated between the Gibbons,
the Orang utan, and the African Chimpanzee; and to this list was
added in the period between 1847 and 1860 the definitely
established genus (afterwards species, then again genus) of the
Gorilla. ‘The discovery of the Gorilla was really due to the
American Evangelical missionaries, who established themselves in
the early part of the 19th Century in the Gaboon; but complete
specimens of this Ape and a far more extended knowledge of it
were brought to the civilised world by Du Chaillu. Stanley
asserted the existence of the true Gorilla as far east as the forest
between the Upper Congo and the Nile watershed; and this
statement has seemingly been confirmed by the specimens received
from that region by Dr. Matschie, and described and figured by
Myr. Rothschild.
* Though often misapplied to the African Chimpanzee in the 17th and 18th
Centuries by English and Dutch sea-captains, who, having first made acquaintance
with the Orang in the Malay Archipelago, saw Chimpanzees at the West African
ports on their return voyage.
+ When I visited Angola in 1882 Chimpanzees were still found in forested regions
inland south of the Congo and north of the Quanza River, especially in the old
kingdom of Congo.
ee
Pin.
. Eng el Term ; del.
I 4, CASO Solel lel. VU.
Bale & Damelsson, L&.
SIAUILIGS Ol IRISUON OIL OI TEU.
IP 4. SAGO Savel, WLP. OV,
Taal
ips
tary © —
A. J.Engel Tera, del Bale & Danielsson, L%@.
SAUILLS Of IRUSUUNOILOPIEIL
1905. ] ON BATS OF THE GENUS RHINOLOPHUS. (i)
3. On some Bats of the Genus Rhinolophus, with Remarks
on their Mutual Affinities, and Descriptions of Twenty-
six new Forms. By Knup ANDERSEN *.
[Received May 12, 1905. ]
(Plates ITI. & IV.+ and Text-figure 22.)
The present paper is, chiefly, an attempt to disentangle some of
the more complicated groups of Eastern Rhinolophi, to make out
the probable interrelations of the species, and to describe the
many new, imperfectly known, or hitherto confused forms. I
have appended some general remarks on the affinities of the
Ethiopian and Western Palearctic species.
The material placed at my disposal has been more extensive than
that of previous writers on these Bats, namely, Prof. Peters (1871)
and Dr. Dobson (1878); and I have approached the subject from a
different point of view, basing the diagnoses of the primary groups,
and, where possible, of the species and subspecies too, not on
external and dental characters alone, but also on important
differences in the skulls. This may account, partly at least, for
the essentially different conclusions on many points at which I
have arrived. On the other hand, the following pages afford
ample proof that my material has not been complete enough to
enable ine to venture an answer on all the difticult questions,
taxonomic or phylogenetic, that occurred to me during my work.
I shall feel satisfied if my paper is considered of some use as a
basis for further investigations.
T owe my sincere thanks to Mr. Oldfield Thomas for entrusting
me with a revision of these Bats, for giving me unlimited access
to the recently acquired, still unregistered specimens in the British
Museum, especially those of the large and important ‘Tomes
Collection,” and also for having favoured me with much valuable
information during the progress of my work.
T also have to acknowledge the kind assistance of Mr. Gerrit
S. Miller, Jv., who sent me for inspection almost all the Indo-
Malayan Lhinolophi preserved in the United States National
Museum, including many new and interesting forms, part of which
will be dealt with below.
For the loan of specimens for comparison, or for information on
examples preserved in Continental Museums, I am indebted to
Geheimrath Prof. Dr. Ehlers, Gottingen ; Prof. Matschie, Berlin ;
Prof. Dr. Kurt Lampert, Stuttgart; M. Ch. Mottaz, Geneva ;
M. A. Ménégaux, Paris; and Prof. A. Cabrera Latorre, Madrid.
I. THe RAINOLOPHUS SIMPLEX GROUP.
Diagnosis. Basioccipital, between cochlez, not unusually nar-
rowed. Posterior connecting process low and rounded off (text-
fig. 22a, on p. 121).
* Communicated by OrpFreLD Tuomas, F.ZS.
+ For explanation of the Plates, see p. 14.
76 MR. K, ANDERSEN ON BATS [May 16,
Tinclude in this group 40 different forms (22 species), correspond-
ing to Lh. megaphyllus, affinis, capensis, clivosus, and ferrum-
equinwm in Dobson’s ‘ Catalogue of the Chiroptera in the British
Museum. Only the Austro-Malayan, Oriental, and Palearctic
forms will be described below, and only the first species in some
detail, the description of the other forms being, as a rule, confined
to the points in which they differ from the fundamental type.
The Ethiopian species will be briefly mentioned in the ‘“ General
Remarks” on the group (p. 117).
1. RHINOLOPHUS SIMPLEX, sp. n. (Plate III. fig. 1.)
Diagnosis. Cranial character : supraorbital crests meeting at a
point behind the middle of the orbit. External: sella distinctly
constricted at middle. Forearm 44:2 mm.
Details. Nose-leaves large, as compared with those of the other
Austro-Malayan species (2h. truncatus, nanus). A supplementary
leaflet distinctly visible in front of, and on the anterior part of the
sides of, the horseshoe ; a character common to all the members of
the present group, but becoming gradually less pronounced in the
more highly developed species (affinis, ferrwm-equinum, and their
allies) ; it seems to point back to the much more primitive genus
ilipposiderus. Horseshoe so broad as to completely cover the
upper lip; a slight indication of a tooth-like projection on either
side of the median notch. Sella decidedly broader at base than at
summit, and distinctly constricted at middle; summit rounded ;
height of sella, from angle between vertical portion and nasal lobe,
about 4°8 mm., width at base 2°3, at constriction 1:9, at summit
18 mm.; front of sella densely covered with exceedingly short
white hairs (scarcely observable without a lens). Posterior con-
necting process low and broadly rounded off. Lancet long, almost
cuneate ; length, from posterior transverse bridge, about 4°7 mm.
Three mental grooves, as in all forms of this group, except the
highest-differentiated species (ferrwm-equinum and its nearest
relations).
Hars, compared with those of the closely allied Austro-Malayan
species, rather large, almost reaching the tip of the muzzle when
laid forwards. Upper part of outer margin somewhat concave ;
tip blunt ; no constriction below the tip.
Wing-structure very primitive: 4th and 5th metacarpals sub-
equal in length (the 5th, if anything, a little shorter), and both of
them but very slightly longer than 3rd; III.°* less than 14 the
length of ITI.1; IV.° and, especially, V.° very short, being only a
trifle longer than IV.‘ and V.’ This structure of the wing is
characteristic of all the primitive members of this group (simples,
megaphyllus, truncatus, nanus, celebensis, borneensis, malayanus,
rouai, &e.); it is first in so highly-developed forms as affinis and
its various modifications (ferrwm-equinum, &e.) that we find an
important progress: prolongation of III.°; shortening of the 3rd
* Hor brevity’s sake I call the proximal phalanges of the 3rd, 4th, and 5th fingers
IIL}, TV.1, and V.!, the distal phalanges of the same fingers IIT.7, [V.2, and V.2
1905. | OF THE GENUS RHINOLOPHUS. ne
metacarpal, as compared with the 4th and 5th; the 5th meta-
carpal decidedly longer than the 4th; &e.
Tail a little longer than the lower leg. Plagiopatagiuim inserted
on tarsus.
Colour (of a spirit-specimen, unfaded). Fur of upper side a very
dark shade of “drab,” approaching “ Prout’s brown”; base of
hairs rather more distinctly drab; under side somewhat darker
than drab.
Skull. Four anterior nasal swellings and two posterior. The
four anterior arranged in a transverse row, forming the upper and
lateral borders of the nasal opening. Externally these anterior
swellings are separated only by extremely faint linear depressions ;
internally by three bony lamelle, also easily observable through
the thin, transparent outer wall of the swellings. The posterior
nasal swellings, situated immediately behind the anterior ones, at
the front corner of the orbital cavity, are much lower, slightly
concave at summit; three very faint lines divide them, rather
indistinctly, into an upper, middle, and lower swelling.—The
shape and arrangement of the nasal swellings, as here described,
are, roughly speaking, the same in almost all the members of the
simplex-group; there is some variation in the size of the swellings
in the different species; but the more noteworthy deviations from
the general scheme are two only: Rh. malayanus and Rh, stheno.
Postnasal depression triangular in shape, rather long; the
supraorbital crests, which constitute the lateral border of this
depression, meeting (and joining the sagittal crest) at a point more
or less behind the middle of the orbital cavity. ‘“ Supraorbital
length ” of skull (¢. e. distance between the point of junction of
supraorbital crests and median anterior point of nasal swellings)
greater than extreme width of nasal swellings.—The shape of
this part of the skull, as here described, is characteristic of only
the four most primitive members of the group (simplex, mega-
phyllus, truncatus, nanus).
Palatal bridge comparatively long (in antero-posterior direction);
measured in the median line equal to about one-third the length
of the upper tooth-row ; median anterior point opposite the front
of m’, median posterior point opposite the middle of m?.
Dentition. As a general guidance: in all existing species of the
genus the upper p’ * is completely lost ; in all the more primitive
* T write the dental formula (excel. of incisors and canines) of a Rhinolophus with the
(cf. Herluf Winge,
p?_-p* m! m? m3
Po P3 Py M, M, mM,
“ Jordfundne oz nulevende Flagermus fra Lagoa Santa; med Udsigt over Flager-
musenes indbyrdes Slegtskab” ; E Museo Lundii, vol. ii. pt. 1 (1892), p. 56). As
already mentioned by Winge, we have no positive proof whether the upper premolar
lost in all known species is p? or p?. For two reasons I regard the former alternative
to be the more probable :—(1) In all Rhinolophi, also the most primitive forms, the
lower p, 1S on the point of being reduced, in the more highly-developed species
pushed definitely out to the external side of the tooth-row, in the still higher forms
completely lost; it is but reasonable to suppose that the premolar quite lost
in the upper jaw of al7 species corresponds to the premolar which is on the point
of being lost in the lower jaw of all species, in consonance with the general rule
that the teeth of the upper jaw show a more advanced stage of evolution than those
most complete known dentition as follows :
78 MR. K. ANDERSEN ON BATS [May 16,
species of the simplea-group also the lower p, 1s very much reduced
in size and on the point of being driven out of the tooth-row, to
the external side; in all the more primitive species of the group
also the upper p* is reduced in size, but still, trnvariably, in the
tooth-row.
The following remarks apply to RA. simplea and Rh. megaphyllus,
the dentition of these two species, the most primitive within
the present group, being practically exactly alike :—p, very small,
but decidedly less reduced than in the other species of the group.
The position of this tooth, m relation to p, and p,, varies
individually (in the same geographical race, and in examples
from the same locality and of apparently the same age):
completely in the tooth-row (one specimen), or slightly towards
the external side (two), or half external (one), or almost quite
external (one), or completely external (one). This “ vacillation ”
in the position of p, is of some interest as being the first indication
of a tendency towards driving this premolar out of the tooth-row,
a tendency gradually increasing in a long series of more highly
developed species, and culminating in the forms in which the
tooth is quite lost, even in young individuals (4h. acrotis).—p? is
comparatively large, with a well-developed, pointed cusp. From
its base to its tip this cusp is directed obliquely mwards, under an
angle of about 25° to 45° with the vertical line; also in those
species of the present group in which the cusp is so much reduced
as to be scarcely perceptible without a lens, it is invariably point-
ing obliquely inwards, only to a still higher degree. The upper
canine and p' always widely separated. In some individuals there
is a very narrow interspace between p* and p’, on either side of the
jaw, or on one side, no doubt a remnant of the place where p’,
lost in all existing species, was situated (see footnote on p. 77).
Measurements *, On p. 80.
of the lower jaw. (2) When the lower p; is external in position, or even when it is
completely lost, we still, rather often, find p, and p, separated by a narrow inter-
space, reminiscent of the time when p; had its normal position in the tooth-row; if
we can find, sometimes at least, a similar “atavism” in the upper jaw, our sup-
position will be strengthened; and such cases are, in fact, not very rare :—in some
individuals, and just those of the most primitive species of the genus (simplex,
megaphyllus, borneensis, refulgens, philippinensis), I find an arrangement of the
upper teeth which can be graphically expressed as follows: cp pm!m?mn®, 7,e. the
anterior of the upper premolars in contact with the canine, the posterior mm contact
with the first molar, but between the two “p” still a narrow interspace, apparently
a remnant of the place where the lost premolar was situated; if so, however, the
lost p is, of course, p%, those present p? and pt.
* Only the following measurements require some explanation :—Hars, length from
base of inner margin to tip. Forearm, trom posterior point of radius to front curve
of carpus (wing bent), therefore somewhat greater than the length of radius measured
on skeletons. Metacarpais, as far as possible the true length of the bones. 2nd
phalane, always exclusive of the cartilaginous “3rd phalanx” (this restriction beg
of especial importance in measurements of the 3rd finger, the terminal cartilagmous
rod of which is comparatively large). Hind foot, with claws. Skull, total length,
to front of canines (not to front of premaxilla). Width of brain-case, above root of
zygomata. Supraorbital length, distance between point of junction of supraorbital
crests with sagittal crest and median anterior point of nasal swellings. Mandible,
condylus to front of incisors. Upper and lower teeth, exclusive of incisors.
1905. | OF THE GENUS RHINOLOPHUS. 79
Type. 2 ad. (in aleohol). Lombok, 2500 ft., June 1896. Col-
lected by A. Hverett, Esq. Brit. Mus. no. 97.4.18.4.
2. RHINOLOPHUS MEGAPHYLLUS Gray. (Plate IIT. fig. 2 a, b,c.)
Diagnosis. Allied to Lh. sinuplex, but considerably larger. Fore-
arm 46-50 mm.
Details. This is a large continental representative of the simplea-
type. The evidences of its close connection with the Lombok
species are clear enough: the general shape of the facial portion
of the skull; the wide interspace between the upper canine and
p'; the presence, individually at least, of an extremely narrow
interspace between p* and p*; the distinctly constricted sella; the
strong development of the nose-leaves; the large ears. On the
other hand, it has in several respects taken its own course of
development: the sella is, also proportionately, broader than in
simplex, the constriction at the middle is more abrupt; the nasal
swellings are, also proportionately, considerably broader ; the size
of the animal is markedly increased: as regards this latter,
Lh. megaphyllus bears quite the same relation to Rh. simplea as
Rh. rouxi does to Rh. borneensis.
Distribution*. EKastern Australia. Louisiade Archipelago.
Geographical races. There are two apparently well-marked forms
of Rh. megaphyllus, differing in size and in geographical habitat.
2a. RHINOLOPHUS MEGAPHYLLUS Gray, TYPICUS.
Rhinolophus megaphylius J. Ki. Gray, P.Z.S. 1834, p. 52.
Rhinolophus megaphyllus (partim) Peters, MB. Akad. Berlin,
1871, p. 306 7; Dobson, Cat. Chir. Brit. Mus. (1878) p. 110.
Diagnosis. Larger: forearm 46°5-50 mm.
Sella. In one, out of eleven specimens, the summit of the sella
is completely square-cut ; in all the others (some of them from
the same locality) it is broadly rounded off. Conf. with this
Rh. borneensis.
Colour. (1) Dark phase (two skins, one adult and one full-
grown, but young): Like 2h. simplex.
(2) Russet phase (one skin, full-grown individual, but
young): Uniform “ russet” above and below; base of hairs of
upper side “ clay.”
Measurements. On p. 80.
Distribution. Hastern Australia: Queensland, New South
Wales.
Technical name. The type of Rh. megaphyllus is in the British
Museum.
*« The information on the “distribution” of the species and subspecies reviewed in
this paper is based eawclusively on the material examined by myself.
7+ I amunacquainted with Peters’s hypothetical Rh. keyensis, based on an example
in the Leiden Museum, and characterised as “eine vielleicht nur etwas kleinere
Varietit [of megaphyllus]| oder Art” (1. s.c. p. 307). No further information has
been published, and nine years later Peters records “ Rh. megaphyllus” from the
Key Islands without any reference to Rh. keyensis (Anu. Mus. Civ. Genova, xvi.
(1880) p. 32). It is not very likely that the typical Rh. megaphyllus should occur
in the Key Islands.
80 MR. K. ANDERSEN ON BATS [May 16,
26. RHINOLOPHUS MEGAPHYLLUS MONACHUS, subsp. n.
Diagnosis. On an average smaller than the typical form: fore-
arm 46 mm.
Details. Sella a trifle broader at base than in the typical form ;
summit completely square-cut ; front face a little more distinctly
haired. Length of forearm almost as in the smallest individuals
of the typical form, but metacarpals distinctly shorter. Tail also
comparatively somewhat shor ter. Brain-case decidedly more
slender. Tooth-rows somewhat shorter. In colour scarcely
different from the dark phase of the typical form.
Measurements. Below.
_Lype. 2 ad. (in alcohol). St. Aignan’s Island (Misima),
Louisiade Archipelago. Collected by Albert 8. Meek, Esq. Brit.
Mus. no. 98.4.1.1.
Measurements of Rh. simplex and megaphyllus.
Rh. simplex. Rh. megaphyllus.
|
|
| f
. typica. monachus.
fi a i 11 specimens, © ad.
Till 5 skulls. Type.
| Min. Max.
mim. | mm. mm. mm.
Ears, length .. ME Ne eI te 18 I TS TIGR 19'8
» greatest yea th yiees tie beige 13°5 || 135 15 16
Nose-leav es, total Jength ............... 14°5 Halon lO, 14'8
y breadth of horseshoe ...... 85 | 88 98 88
SHOKeAT TR ME rr aL eon RR 44-2 || 465 60 46
GixGl WNGUACAAOAN co an ccoeoo oon nas ovaoee ego00e 318 || 33°38 36 32°7
11) GES ae sree Mens at Coen onemminS Heaeen ie 13 | 13 146 13:2
Il? . Son cies ae teanene TR Tene ee 178 175 20 17°8
4th metacarpal Seana Gah Se aaa ae ey 32 | 343 368 33°5
UTNE) hisktcweon a heeteants icon Wiley, | Sane aby eatin 9:2 98 11:2 97
Ine eh On Acree chee ye eee || 115 13:3 10
Sth metacarpal deat aliens take ati 318 || 3843 3865 32°7
VRIES NEN os enh FAM el Se br 10 || 104 12°7 10°2
Ve). SUE Seth ty Se Sees Areal cemneptie neers efaeti 11:2 elle amen 11°7
Gialamas. oe A aly tn ae 245 | 29:2 268 20°5
Mo wersleas ener ctee cn e c eet ess eee 19°7 | 185 22 19
Foot ..... Senaneaaenuccea aes? 88 | 9 102 87
Skull, total length aba usaacstisnasneneeas 187 || 19°9 20 19°3
s)) mastordiwidth! (0 so .ceeee.--.-- ee 3 98 98 95
» width of brain-case ............... 78 85 86 8
>» Zygomatic width ...............-. 9°4. | .. 10 96
» supraorbital length ............... 6 | 6 68 59
width of nasal swellings ...... 52 | 58 6 al
Mandible, length icra 12°8 SESS ai 13:2
Uipperatecth a ese eee eee 72 ad eit 73
IWORFEE WOEWD 05 000 cvs v0¢ c60. 008 960 codon soo 00s 78 82 87 8
3. RHINOLOPHUS TRUNCATUS Peters.
Rhinolophus truncatus Peters, MB. Akad. Berlin, 1871, p. 307.
Rhinolophus megaphyllus (non Gray), var. a, Dobson, Cat. Chir.
Brit. Mus. (1878) p. 111.
Diagnosis. Allied to Rh. simplex. Sella more slightly constricted
1905. } OF THE GENUS RHINOLOPHUS. 81
at middle. Summit of sella square-cut, or even concave. Base
of fur almost blackish. Forearm 44°7-46°8 mm.
Details. In this species the sella* is not of the shape charac-
teristic of Kh. simplex and megaphyllus. It is narrower, not
considerably broader at the base than at the summit, and the
constriction at the middle is less distinct. This points decidedly
away from simplex, and towards nanus, celebensis, and borneensis.
The square-cut (or concave) summit of the sella seems to be a
rather common feature in those forms of the present section of
the group which are inhabitants of small islands (cf. Rh. megaphyllus
monachus, Rh. nanus, kh. borneensis spadix). Lancet long and
cuneate. Wing-structure and proportionate length of tail as in
simplex, Plagiopatagium inserted on tarsus.
Colour (six skins; adult individuals, but teeth quite, or almost,
unworn). Very peculiar. Generalimpression: avery dark brown.
Details: hairs of upper side “ broccoli-brown” at tip; below the
tip, for a broad space, almost “‘ clove-brown” (more exactly: an
exceedingly dark shade of “ hair-brown,” very much approaching
clove-brown); the extreme base of the hairs, immediately at the
skin, again somewhat lighter. Individual hairs of the under side
much of the same colour, but the tips more brightly broccoli-
brown, giving the under side a somewhat lighter appearance.
All the specimens are exactly alike in colour.
Skull. Essential characters as in Rh. simplex. Nasal swellings
narrow.
Dentition. p, is, f anything, a little more reduced than in
simplex. In two skulls I find it placed in the tooth-row, but
shghtly towards the external side; in a third, on the one side
half external, on the other external; in a fourth, external on both
sides, and the interspace between p, and p, therefore very narrow.
p is always in the tooth-row; its cusp rather well developed,
though somewhat smaller than in simplex. No interspace
between p” and p’.
Measurements. On p. 84.
Distribution. Batchian.
Technical name. One of the two typical specimens (in the Berlip.
Museum) was collected on Batchian by A. R. Wallace and for-
warded to Prof. Peters by Tomes. The whole series in the British
Museum is from the same island and the same collector, and four
of the examples belong to the recently acquired Tomes Collection ;
they are therefore practically (though not technically) co-types.
kemarks. The dentition of Rh. truncatus proves it to be ona
slightly higher level than simplea; the interspace between the
upper canine and p’ is a little narrower, p’ a little more reduced.
The vacillation in the position of p, gives evidence of the same ten-
dency as in simplex: towards the more advanced members of the
group. In the shape of the nose-leaves it has taken a course point-
ing towards borneensis. In its coloration it seems to stand alcne.
* A good series of skins, but no spirit-specimens, are at my disposal. This.
description is from the sesoftened nose-leaves of three examples.
Proc. Zoou. Soo.—1905, Vou. If. No. VI, 6
82 MR. K. ANDERSEN ON BATS [ May 16,
4, RHINOLOPHUS NANOS, sp.n. (Plate IIT. fig. 3.)
Rhinolophus megaphyllus (non Gray), var. (2 (partim), Dobson,
Cat. Chir. Brit. Mus. (1878) p. 111 (Goram).
Diagnosis. Essential cranial characters as in Rh. truncatus, but
brain-case remarkably slender. Sella so slightly constricted as to
be practically parallel-margined. Small: forearm 43-3 mm.
Detwils. This species marks a further step towards the celebensis-
borneensis type. Externally Rh. nanws is exceedingly like these
two species, but the skull is of the stmplex type.
The sella (compared with that of the foregoing three species) is
considerably reduced in breadth; its width at the base is but very
little greater than at the summit; the constriction at the middle
is much reduced (it requires some attention not to be overlooked);
and the whole of the sella therefore might very well be called
almost parallel-margined; summit completely square-cut (there
will probably, in a large series, be some individual variation
in this respect). The horseshoe, too, is a little narrower. Lancet
almost cuneate, the lateral margins being but very slightly
coneave. The sizeof the ears, both length and breadth, is reduced ;
the tip slightly more attenuated (less blunt than in 2h. simples).
In the structure of the wings it stands exactly on the same level
as the foregoing species.
Colour (one skin; adult; teeth almost quite unworn).—Fur
of the upper side uniform dull “ mars-brown”; base of hairs
slightly lighter ; under side very much of the same colour as the
upper side, but with a slight tinge of “ drab.”
Skull. Postnasal depression and supraorbital crests as in
Rh. simplex. Nasal swellings very narrow (4°9 mm.). Chief
character (compared with the three foregoing species): the very
narrow brain-case (7 mm.).
Dentition. p, quite external, and cingula of p,and p, in contact
(a sufficiently large series will presumably show some vacillation
in the position of p,). p®? in the tooth-row ; its cusp very small.
Measurements. On p. 84.
Type. Ad. (skin). Goram Island. Collected by Dr. A. R.
Wallace. Brit. Mus. no. 61.12.11.10.
Remarks. This species is readily distinguished from Lh. celebensis
and Lh. borneensis by the different shape of the facial portion of
the skull.
Dobson regarded the specimen here described, together with
two others from N. Celebes (Menado), as a variety (“@”) of
Rh. megaphyllus, characterised chiefly by having “‘the summit of
the vertical process of the sella broadly rounded off, much
broader than the base.” But, firstly, it should be remembered
that a sella, much broader at summit than at base, would be
exactly the reverse of what is found in megaphyllus; it would
even be unique in the whole genus. Secondly, on resoftening
the nose-leaves I found the sella, in all the three specimens, quite
of the same general shape as in Ah. borneensis, i.e. practically
1905. | OF THE GENUS RHINOLOPHUS. 83
parallel-margined. It would evidently have been much more to
the point if Dobson had called these Bats Rh. borneensis, not
Rh, megaphyllus. But Rh. borneensis, again, was confused with
Rh. minor, which, however, not only IS a distinct Species, but
belongs to a different group of the genus.
5, RHINOLOPHUS CELEBENSIS, sp. n. (Plate IIT. fig. 4 a, 0.)
Rhinolophus megaphyllus (non Gray), var. 3 (partim), Dobson,
fat. Chir, Brit. Mus. (1878) p. 111 (Menado),
Diagnosis. Supraorbital crests meeting at a point more or less
in front of the middle of the orbit. Nasal swellings narrow.
Nose-leaves as in Rh. nanus and Rh. borneensis. Small: forearm
43-44‘7 mm.
Details. In the foregoing species (2th. simplex, megaphyllus,
truncatus, nanus), all of! which are Australian or Austro- Malayan,
the supraorbital crests join the sagittal crest at a point more or
less behind the middle of the orbit. In 2h. celebensis, as in all
the other species of the present group, which are all Oriental,
‘Paleearctic, or Ethiopian, the supraorbital crests meet at a point
more or less in front of the middle of the orbit. This makes
2 comparatively shorter postnasal depression, the supraorbital
crests being the lateral borders of this depression. In this point
therefore Hh. celebensis agrees with the MWesterm forms of the
group, differing from the Eastern.
The mechanical reason for this modification is evidently the
following: a slight increase in the size of the temporal muscle
has pushed the sagittal crest more forwards; this involves a
shortening of the supraorbital crests; this again a reduction in
the length of the postnasal depression.
The nasal swellings are narrow (4:8 mm.), as in the closely
related Eastern forms (anus, truncatus), In the more Western
Rh. borneensis they are, at least sownewlba, and as a rule con-
siderably, broader. Compare figs. 4 and 5 on PI. IIT.
Tt is worth noticing that the cranial characters of this species
are, so to say, “fin accordance with” its geographical habitat :
Celebes is, geographically, intermediate between the Austro-
Malayan and Indo-Malayan subregions, and in its more im-
portant cranial characters 2h. celebensis points partly westwards
(shortening of supraorbital crests), partly eastwards (narrow nasal
swellings).
The nose-leaves, ears, wings, and the general size are as in
Lh, nanus and Kh. borneensis,
Colour. (1) Makassar specimen (2 ad.; in alcohol; unfaded ;
teeth unworn).—General impression of upper side : brown : the
true colour is a deep brown shade of “drab”; base of hairs a
little lighter than drab ; under side drab with a tinge of “ broccoli-
brown.”
(2) Menado specimens (two skins; ad.; teeth almost un-
worn).—Above uniform dull “ mars-brown,” base of hairs but
6*
84 MR. K, ANDERSEN ON BATS [May 16,
slightly lighter ; colour of the fur of the under side very much as
on the upper side.
The Makassar specimen seems to represent the true “dark
phase” ; the mars-brown tinge of the Menado skins may indicate
a tendency towards a “russet phase.” Similar differences in
colour are very common in this section of the group.
Dentition. As in Rh. nanus.
Measurements. Below.
Type. 2 ad. (in alcohol). Makassar, 8, Celebes, November
1895. Collected by A. Everett, Esq. Brit. Mus. no. 97.1.3.19.
Distribution. Celebes : Makassar Menado.
Measurements of Rh, truncatus, nanus, and celebensis.
} |
Rh. truncatus.| Rh. nanus. Rh. celebensis.
- | 6 specimens, | Ad. | 3 specimens,
| 4 skulls. Type. 3 skulls.
| Min. Max. | Min. Max.
mm. mm. mm. | mm. mm.
Mars leno bhiyae <sqadentssidcveeneranetisatees an te Nee eeliG
» greatest breadth.. Lesa eisai a SBE si 12°5
Nose-leaves, total length — FR SERRE oc Mi: aN ee | 123
5S breadth of horseshoe _... us a ie 8
INQUCATINIGERT coeeeaaena een crs ene nes ie 447 46°38 43°3 43 44-7
3rd metacarpal.................cc0ce | 312 32°38 30 | 3805 314
TOTES i Old a me a eee aaa ce SEU Nerae ther ed aime, 2 11:2 | lao) als
Il? . as Pad onguee saat auedsol|: cgltenrye GUSFIL ie ee Ars Yan br ito)
4th metacarpal... Dee ela cth ent. ale eo" moO) 311 31:3 32
Iv Cece es Nore eat el ne LOS LOR BS yu iow neon
Wee Sols Tobe numero cavedacae tear |e mellllet ns gl ARS) cn 10°8 11
5th metacarpal. Use bis wignicealecaninse coor ERE 38l7 33:2 3l1 8l 325
Welt DOD d en eek ae by eh gaara erd, 9 95 10
SV eee Section crc ene eased IGS ALCO 9°8 11
Pater th Ohi Wis Se. EOE INIIOS Se nae 20 Fit
ene! leo eee meee) yee 20 ore 178 183
Shall, ‘total length . Sone OS ae ead go een . 3 fe 181
» mastoid width tfiiscl twos 9:2) Fe ea 9
>, width of brain-case ............... he a 7 8
» zygomatic width .................. “es Zen 9 Br
>» supraorbital length Paste DIDEEON 58 48 48
width of nasal swellings Bee Sil Beal 4:9 48 48
Mandible, IGMEFAN —soovooosoocsenoeavooacce| AS USE 13 122 12:7
(Wippersteethy 26 cscs sececsetecene se ccennn set Al 98} 72 7 72
Wowerjteeth 3oicc.. shee esaensqeaSeeioese TD OY 78 TA 78
6. RHINOLOPHUS BORNEENSIS Peters. (Plate III. fig. 5 a, b,c.)
Diagnosis. Similar to Rh. celebensis, but with broader nasal
swellings. Small: forearm 41°2-46°3 mm.
Details. Sella so slightly constricted as to be almost parallel-
margined from base to summit; in some individuals the con-
striction is completely obsolete; height of sella about 3 mm. ;
1905. | OF THE GENUS RHINOLOPHUS. 85
width at base, at middle, and at summit: 2, 1°8, and 1:7 mm.
Lancet almost cuneate, or the lateral margins but slightly concave,
never abruptly narrowed at the middle (as i in Fh. rout) ; length
of lancet about 4°2mm,. Ears and wings quiteas in Rh. celebensis.
Plagiopatagium inserted on tarsus, or as much as 1°5 mm. above
the tarsal joint.
Colowr. There is an extreme dark phase and an extreme red
phase, connected by several intermediate stages.
(1) Dark phase.— ?, Banguey Isl. (Brit. Mus.); two ¢, Pulo
Sarutu (Un. St. Nat.-Mus.); all of them full-grown, but with
unworn teeth; distal epiphyses of metacarpals in two of them
ossified, in one not completely so; in alcohol, unfaded. General
impression of upper side: brown. The true colour isa deep brown
shade of “drab”; base of hairs next to ‘ broccoli-brown.”
Under side between ‘‘ wood-brown ” and “ broccoli-brown.” The
individuals are not precisely, but almost, alike in tinge.
(2) Intermediate stage, nearer to “ dark phase.”— gad., Qad.,
Labuan (B.M.); ¢ ad., N.W. Borneo (B.M.); teeth either quite
unworn, or almost wnworn,; distal epiphyses of metacarpals ossitfied ;
in alcohol, unfaded. Upper side “russet,” base of hairs but
slightly lighter. Under side ‘‘ wood-brown.”
(3) ian emediate stage, nearer to “red phase.” — @ ad., Sirhassen
(URNES Ms) co Grade 2 afl. Karimata(U. N.S, M.); teeth either
quite unworn, or very slightly worn; distal epiphyses of meta-
carpals ossified ; in alcohol, unfaded. Much like the foregoing,
but also the under side of the body “ russet.”
(4) Extreme red phase.— g ad., Sirhassen (B.M.); teeth wn-
worn; epiphyses ossified; in alcohol, unfaded. Much like the
extreme red phase of 2A. rowxi: not far from “ cadmium orange”
above; ‘“‘ orange” beneath.
As proved by the above, these differences in colour are inde-
pendent of the geographical habitat and of the sex of the
individuals, seemingly also of the age. So far as the present
material goes, the only “ phase” in which a quite young, though
full-grown, individual occurs (epiphyses not quite ossified) is the
dark phase; but it may be accidental: the individual which
represents the extreme red phase is, at all events, only a few
months older (teeth unworn).
Skull. As in Rh. ¢elebensis, but with broader nasal swellings
(5:4 mm., on an averzge),
Dentition. ps almost always completely external, but in one
skull (out of eleven) half in row. Cingula of p, and p, in contact
(six), or very slightly separated (four), or distinctly separated
(one), p always in the tooth-row; cusp very small. In four
individuals there is an extremely narrow interspace between p*
and p* (the former place of p’).
Distribution. N. Borneo; 8. Natunas; Karimata Group.
Technical name. The type of Rh. borneensis, in the Berlin
Museum, is from Labuan, There are two specimens from the
86 MR. K. ANDERSEN ON BATS [May 16,
same island in the British Museum*, As, however, i. borneensis
has for many years been completely confused not only with several
more or less closely related species, but also with the widely
different Rh. minor, the following remarks may not be out of place
here :—
The salient point in the original description of Rh. borneensis,
as given by Prof. Peters (loc. infra cit.), is this: “Sattel....an
dem vordern obern Hade abgerundet, die hintere, zusammenge-
driickte Spitze [7. ¢. the posterior connecting process] kaum héher,
abgerundet.” have emphasised the last three words, because they
clearly prove that 2h. borneensis belongs to what here is called the.
simplex group (connecting process low and rounded off), and has.
nothing to do with Ah. minor or its allies (connecting process pro-
jecting and pointed). But ten years later (MB. Akad. Berlin,
1871, p. 306), Peters himself believed Rh. borneensis to be identical
with Rh. minor, described by Horsfield so long ago as 1824.
The reason was, beyond all doubt, this: to identify Horsfield’s
Bats without an examination of the types is, in most cases,
impossible ; and Peters had not seen the type of Rh. minor (then
in the Indian Museum, London, now in the British Museum),
but only the bad figure in the ‘ Researches in Java’; as, further-
more, the two species in many respects (size, wings, sella, ears,
&e.) are, externally, puzzling alike, the mistake is easily explained.
Thus, according to Peters, there were two small Indo-Malayan.
Rhinolophi: the one, with a low and rounded connecting process,,
he called Rh. minor, Horsf. (synonym: Rh. borneensis, Peters) ;
the other, with a projecting and pointed connecting process, he
identified with Temminck’s 2h. pusillus, stated to be from Java..
Under these circumstances, a quite reasonable conclusion: we
had a name for either “species,” and perfectly clear diagnoses.
Dobson, who examined the type of Ah. minor, states, quite
correctly, that the connecting process is projecting and pointed ;
when, nevertheless, he put Rh. borneensis down in the list of
“synonyms” to Lh. minor, he must have overlooked the most
important point in Peters’s description of borneensis, the shape of
the connecting process. Dobson, therefore, called the small Indo-
Malayan Rhinolophus with pointed process Rh. minor (synonym :
Rh, borneensis): thus, the names were the same as employed by
Peters, but the diagnosis exactly the reverse ; Temminck’s “ih.
pusillus he identified with Fh. hipposiderus (sic); and as to the
small Indo-Malayan Rhinolophus with rounded process (the true
borneensis) he put it down under Lh. affinis, Horsf. (!), with
which species he alsc united the very different Rh. rowwi, Temm.,
at the same time keeping a genuine Rh. rowaxi separate as
Rh, petersi. This accumulation of errors and wrong identifications
* On one point there is a discrepancy between Peters’s description of Rh. borneensis
and the series before me: according to Peters the length of the forearm is 37 mm.;
in the smallest (adult) specimen I have seen, it measures 41°2 mm. I am informed
by Prof. Matschie, who kindly re-examined the type for me, that Peters’s statement
must be a mispr int ora slip of the pen; the forearm of the type specimen (a rather
young, but apparently full-grown individual) measures 41 mm.
1905.] | OF THE GENUS RHINOLOPHUS. 87
is the true reason of the exceedingly confused state in which this
group of Bats has remained, making a safe determination of
Specimens procured almost impossible.
Geographical races. There seems to be two forms of Rh, bor-
neensis, differing, slightly, in the size of the ears, and in geogra-
phical habitat.
6 a. RHINOLOPHUS BORNEENSIS Peters, TYPICUS.
Rhinolophus Borneensis Peters, MB, Akad, Berlin, June 25th,
1861, p. 709.
Rhinolophus minor (partim, nec Horsf.), Peters, MB. Akad.
Berlin, 1871, p. 306; Dobson, Cat. Chir. Brit. Mus. (1878) p. 114.
Rhinolophus afinis (partim, nec Horsf.), Dobson. op. cit. (1878) )
pele
Diagnosis. Kars slightly shorter: 16-17 mm., and narrower :
12°2-12°8 mm. Forearm 41°:2-43°7 mm.
Details. In one specimen (from Banguey Isl.) the summit oi
the sella is completely square-cut; in the others (Labuan, N.W.
Borneo) it is broadly rounded off. This is, no doubt, an individual
variation, but, it would seem, of more frequent occurrence in indi-
viduals inhabiting smaller islands (cf. Rh. megaphyllus monachus,
Rh. nanus, Rh. truncatus, Rh. borneensis spadia).
Measurements. On p. 88.
Distribution. N.W. Borneo; Labuan; Banguey.
6 6. RHINOLOPHUS BORNEENSIS SPADIX Miller,
Rhinolophus affinis rouxi (non Temm.) Thomas, Nov. Zool. i.
(1894) p. 656.
Rhinolophus spadi« Gerrit 8. Miller, Jr., Proc. Wash, Ac.
Sci. ii. (March 26th, 1901) p. 136.
Diagnosis, Kars slightly longer: 17-19°5 mm., and broader :
12°5-14:2 mm, Forearm 42°5- “46-3 mm,
Details. In one specimen (Sirhassen Isl.) the summit of the
sella is completely square-cut ; in all the others (one of them from
the same island) it is broadly rounded off.
Measurements. On p. 88.
Distribution. 8. Natunas (Sirhassen); Karimata Group (Kari-
mata and Pulo Sarutu).
Technical name. The type of “ Rh. spadix,” in the Washington
Museum, is from Sirhassen. There is a specimen from the same
island in the British Museum. I am indebted to Mr. Miller for
the loan of a paratype, also from Sirhassen, and of the series from
the Karimata Group, collected by Dr. Abbott.
Remarks. 1 should not have separated these two forms (if they
be so) of borneensis, if the latter of them had not, accidentally *,
got aname. There is no tangible difference in the skulls, not even
* When describing Rh. spadix as a new species, Mr. Miller compared it with.
Rh. affinis. He could not, very well, compare it with Rh. borneensis, which was
regarded as identical with Rh. minor.
88 MR. K, ANDERSEN ON BATS [May 16,
(as might perhaps be expected) in the measurements of them. It
may well be that the few examples from N.W. Borneo, Labuan,
and Banguey (four only) happen to be rather short-eared (and
short-armed), and therefore do not show the true limits of indi-
vidual variation in these respects. I prefer to keep them separate,
provisionally at least, to call attention to the possible existence of
two very slightly differing forms of the species.
7. RHINOLOPHUS VIRGO, sp. n.
Diagnosis. Similar to borneensis, but much smaller. Forearm
37°5-38°8 mm.
Details. This is decidedly the smallest species of the present
group. The horseshoe is markedly narrower than in any other
form of the borneensis type; the sella considerably smaller than
in borneensis, but of the same shape; the ears much shorter and
narrower.
Colour. Probably not far from being the same as in the dark
phase of borneensis (the two specimens examined are evidently
somewhat faded in alcohol).
Measurements of Rh. borneensis aid virgo.
| Rh. borneensis. || Rh. virgo.
f. typica. spadix. |
4 specimens, | 6 specimens, || 2 specimens,
4 skulls. 7 skulls. | 2 skulls.
Min. Max. Min. Max. || Min. Max.
mm. mm. | mm. mm. |) mm. mm.
Ears, length puscnsovooconecscoanasenceal| AK 2 SIL, SN lee Na
2 Sreatest breadth ..................| 122 128 | 125 142 ||. 10:7 108
Nose-leaves, total length ...............) 125 137 | 127 142 ‘|| lov 112
5 breadth of horseshoe ...| 8 83 8 9 C2 GD
Forearm NBeaoovopEeooudososscosnosceel| AMIGA dehy 425 463 || 375 388
3rd metacarpal 2.0... .....| 28°7 B12 ASS) Be ||| Wee aise
gt ee aeoe 121 1355 117 142 || 102 10-7
WES? socledondpedsoneoineeeeomnoueinete erate GE Theorem Iho aiarae Mera) It Peale 15°2
4th metacarpal... | 297 822 | 307 345 || 98 286
IV.) SUL GON GaE IMB Re bu Mice Ne a SHEA Nera en Un 8:8 OFT 82 98 73 82
LOE Tap Hae Ba) ohh eee CMD acme 10 118 98 12 9 9
oth metacarpal ..........................| 29'S 322 30°7 33°8 27 = (282
AG gh Ser Suet coeuSsc quell amr oeh. sere Sa 95 103 9 10°3 81 88
NE coupe SRGee MEN ee ma i a ag 10°2- 11°8 98 12:2 82 83
Tail pan psnddaduupsoacsdeasbucnddoseagonenad|| lls) 19°2 183 21°5 179 202
owerdesy Rec thc. beet aeeee vale mye@e 1972 17-2 19 14:2 152
Foot nobridedad Gsniine Haakon SebeH a we aA eae ook 88 9 85 91 . '3}
Skull, totallength | 195 | 182 20 162 169
» Mastoid width ...0...0..0..00...5| 9:2 88 95 & 82
» Width of brain-case...............) ... 8 78 82 Weal manda:
>» Zygomatic width .................. say 98 | 9 9:9 81 82
» Ssupraorbital length ............... Sl Hy 5 5:2 47 5
» _ width of nasal swellings 53 57 52 55 43 43
Mandible, length .................... 192) 11 Pil 122 13°7 10°8 11°5
Wipperstecthic se nn Gran nit 7 72, @ 76 61 62
LSwersheethr ee eee ete (Odes T4 8 65 68
1905. ] OF THE GENUS RHINOLOPHUS. 89
Skull. As in borneensis, but considerably smaller; the nasal
swellings are, also proportionately, narrower than in the Bornean
species (perhaps as a consequence of the much smaller nose-
leaves).
Dentition (two skulls). ps half in row (one skull), or external
(the other). p, and p, in the former skull, of course, separated 5
in the latter almost in contact. p° in the tooth-row. Upper
canine and p* widely separated.
Type. Qad. (in alcohol), §. Camarinas, Luzon, Philippine
Islands. Collected by L. M. McCormick, Esq. Un. St. Nat. Mus.
no. 101966.
Remarks. This species is readily distinguished from any other
form of the simplex group by its small size, narrow horseshoe,
and short ears. The shape of the connecting process ought to
prevent a confusion with the equally small species of the minor
group, to which it, in other respects, bears a very striking
external resemblance.
8. RutyoLopHus MALAYANUS Bonhote. (Plate ITI. fig. 6.)
Rhinolophus malayanus Bovhote, Fasc. Malayenses, Zool., 1.
(Oct. 1903) p. 15.
Diagnosis. Closely allied to Rh, borneensis, but median anterior
nasal swellings somewhat more differentiated. Small: forearm
4]:2-42°8 mm.
Details. Externally this Bat is exceedingly like kh. borneensis,
but the shape of the anterior nasal swellings is somewhat different.
The colour, too, seems to be constantly different.
The sella is, in vertical direction, a trifle shorter, but the
difference is scarcely appreciable without actual comparison with
borneensis. The lateral margins of the sella are, practically,
parallel from base to summit; an extremely faint constriction
can be traced, at least under a lens; summit of sella rounded.
Plagiopatagium inserted on tarsus, or very nearly so.
Colour. (1) Biserat specimens; two 2 ad.; August and Sep-
tember ; teeth slightly worn; in alcohol; unfaded.— Upper side a
rather dark brown shade of “drab”; this colour is confined to
the tips of the hairs; the much broader base of the hairs so light
‘“‘eeru-drab” as to approach whitish; under side whitish “ ecru-
drab,” somewhat darker on the sides of the body.
(2) Laos specimen; ad.; teeth slightly worn; skin.—Very
much lighter. Upper side bright ‘“ cinnamon,” base of fur
‘“‘eream buff”; horseshoe patch * on back dark brown; under side
buff.
* A dark-coloured patch on the upper side of the body, horseshoe-shaped, or like
a V, the branches starting on each shoulder, convexity (or angle-point) directed
backwards. It is curiously characteristic of many species of the families Rhino-
lophide and Phyllostomatide, but often (quite individually) more or less, or even
completely, obliterated, especially, of course, when the fur also is dark-coloured.
Being, as a rule, more common and more distinct im young or immature individuals,
it is, probably, an inheritance from some remote ancestors of the two families.
Rhinolophide and Phyllostomatide have, probably, had a common origin.
90 MR. K. ANDERSEN ON BATS | May 16,
It looks like a dark and a light “ phase.” The dark phase
differs from that of Ah. borneensis, chiefly, in having the under
side of the body much lighter, in strong contrast to the colour of
the upper side, and in having also the base of the hairs of the
upper side much lighter. The light phase is, as will be seen from
this description, totally different from the ‘“ cadmium orange ”
phase of borneensis (and more approaching the light phase of.
Lh. affinis himalayanus).
Skull, Wssential characters as in Rh. borneensis, but the median
anterior nasal swellings somewhat more distinctly marked off
from the lateral anterior swellings.
Dentition. p, external; p, and p, almost in contact; p* im row,
cusp extremely small.
Measurements. On p. 92.
Distribution. Biserat (Jalor, Malay Peninsula). Laos Mts.
(Siam).
Technical name. The type is in the British Museum.
Remarks. From the Laos Mountains, Siam, I have seen one
dried skin only (Tomes Collection); it looks like a light-coloured
phase of Rh. malayanus; the nasal swellings of the (fragmentary)
skull have the shape characteristic of this species. But fresh
material from that region is desirable.
9, RHINOLOPHUS NEREIS, sp. n. (Plate IIT. fig. 7 a, b, ¢.)
“ Rhinolophus rouxii?” (non Temm.) Gerrit 5. Miller, Jr.,
Proc. Wash. Ac. Sci. ii. (Aug. 20th, 1900) p. 234.
Diagnosis. Allied to Rh. borneensis, and of about the same size,
but with much larger skull and teeth. Lower leg considerably
longer: 21 mm. Tail comparatively very short: 17 mm. Fore-.
arm about 45 mm.
Details. In addition to the above :——The second phalanx of the
third finger is more than 14 the length of IIT.’; this is the first
time we have to note a decisive lengthening of III. in Lh, bor-
neensis, as in all the foregoing species, III.” (always, i in this paper,
measured without the terminal cartilaginous rod) is invariably
less than 14 the length of III.’; compare with this Rh. stheno,
thomas, affinis, ferrum- equinum. IV.! is comparatively shorter
than in Rh. borneensis, only about 7 the length of the meta-
carpal of the same finger ; compare with this 2h. stheno.
Colour. 2 ad. (type); September; teeth almost quite unworn ;
first preserved in formalin, now in alcohol; probably unfaded.—
‘“¢ Mars-brown ” above; base of hairs “ ecru-drab”; of a peculiar
yellowish ‘‘ drab” beneath (?the yellow due to the influence of
formalin).
Skull. Of the same general shape as in Lh. borneensis, but
much larger, with considerably larger teeth, and therefore longer
tooth-row ; orbital constriction very narrow. The following
measurements, in millimetres, will give a more precise idea of the
differences (the ciphers in brackets are the measurements of
eleven skulls of 2h. borneensis) :—total length, inion to front
1905. | OF THE GENUS RHINOLOPHUS. 91
of canine 21-2 [18-2-20]; length of brain-case, inion to anterior
point of proencephalon 13-7 [11-3-12°5]; width of brain-case above
zygomata 9°5 [7-9-8:2]; zygomatic width 10°8 [9-9-91; maxillar
width, across antero-exterior corners of m* 8°5 {6°8-7-2]; inter-
orbital constriction 2:2 [2°4-2°8]; palatal bridge, median length
2°6 [1°8-2°3]; maxillar tooth-row 8°7 [7-7-6]; extreme width of
m! 2-2 [1°5-1°9].
Dentition. I have not seen the mandible of this Bat. p° in
row; cusp almost imperceptible.
Measurements*. On p. 92.
Type. 2 ad. (in alcohol). Pulo Siantan, Anambas Group ;
September, 1899. Collected by Dr. W. L. Abbott. Un. St. Nat.
Mus. no. 101714.
Remarks. As already pointed out above, the Bats of the
borneensis type inhabiting the 8. Natuna and Karimata groups,
rather close to the north-western and western coasts of Borneo,
are so extremely like the typical borneensis as to be, perhaps,
searcely separable. But farther westwards, on the much more
isolated Anambas Islands, the borneensis type has developed into
the present, peculiarly modified species. In the lengthening of
I11.7, the shortening of IV.!, and the shortening of the tail (com-
pared with the tibia), Rh. nereis has taken the same course as the
still more western Lh. stheno (described below). But the shape
of its skull sufficiently proves it to be an offshoot, not of that
species, but of 2h. borneensis. Compare with this the “remarks ”
under 2h. stheno.
10. RHINOLOPHUS STHENO, sp.n. (Plate IIT. fig. 8, a, 6.)
Diagnosis. Allied to Rh. borneensis, but anterior nasal swellings
much more projecting. Lower leg long: 19°8-20°8 mm. Tail
extremely short: 15°5-17°8mm. Slightly larger than borneensis :
forearm 45-2-48 mm.
Details. This is a third modification of the borneensis type, in
several respects recalling Rh. nereis, in others quite peculiar.
The shape of the facial portion of the skull is unique within the
present group. As in Rh. nereis, III" is lengthened, IV.’
shortened; the tail is extremely short. The general size of the
animal is slightly increased.
Plagiopatagium inserted 1-3 mm. above the ankle-joint.
Colour. 3 ad., Penang; teeth unworn; skin.—General 1n-
pression: reddish brown above; under side much lighter, con-
trasting with the upper side. ‘“ Mars-brown” above; base of
hairs light “drab”; under side almost “ broccoli-brown.”—
Three spirit-specimens (Selangor; teeth unworn) apparently
agree In colour with the skin.
Skull (three individuals). Owing to the much more projecting
anterior nasals wellings, the skull of Rh. stheno, in side view, is
strikingly different from that of Rh. borneensis. This peculiarity
* The tip of the ears and the posterior nose-leaf are damaged ; forearms broken.
92 MR. K, ANDERSEN ON BATS [May 16,
in its outline is produced, not by a heightening of the anterior
swellings, but by a reduction of the posterior pair; these latter,
which in all the allied species form a sort of transition between
the anterior swellings and the adjacent part of the supra-
orbital crests and interorbital constriction, are in stheno so much
reduced as to leave the anterior swellings more isolated, @. e., more
abruptly projecting.
Dentition. p, external; p, and p, im contact; p* in row, cusp
extremely small.
Measurements. Below.
Type. 3 ad. (in alcohol). Selangor, Malay Peninsula. Pre-
sented by H. N. Ridley, Esq. Brit. Mus. no. 98.3.13.1.
Distribution. Selangor ; Penang.
Remarks. Rh. stheno differs from Rh. borneensis in the series of
characters pointed out above. From &h. nereis, in the shape
of the facial portion of the skull, the much slenderer brain-case,
and the shorter tooth-rows. From 2h. rowwi, in the shape of the
facial portion of the skull; the much shorter metacarpals (al-
though the forearm 1s of the same length as in smaller individuals
of pour) the long III.’ (compared ‘with ILI. ); the short IV.’
Measurements of Rhinolophus malayanus, nereis, and stheno.
\Rh. malayanus.|Rh. nereis.| Rh. stheno.
3 specimens, @ ad. 4, specimens,
| 2 skulls. Type. 3 skulls.
Min. Max. Min. Max.
mm. mm. | mm. mm. mm.
Kars, length .. A sae tne PETA aOR, ALOIS ae Wy es
> greatest breadth eel e tl toss 8 1 13-7 18. ery |
Nose- leaves, TOWAN NEM — soo cveoccesocasl| SFA) SERA a | 138 14:2
55 breadth of horseshoe... 73 8 | 9 1 8 $3
Forearm.. Saasdod tide Godan care encws socntee| meee Ate) 245 |} 45:2 48
3rd metacarpal — Bor Ate eee Li dente ape ee nea(), MESS TL | PSeea 9) Biles Sys
JOU eee Bee Se oe Ree ear eter emt ft ic Bane beg 13°2 12°6 18
NEE ee he AE Geach cis Bas callie LOTS GIB: al Ql 201 217 |
4th metacarpal — LUNE oagheenecumoostecaoal ly Ora nail an a nner? 330 38a'8
er OME AL nee ate) BAP NOT Sy sm MEN MOLT FSS, |
JE NWP. D La iso Spao ee bakaaiaiacriac crs sericea thee te) Go) 105 | 12°8 11 125 |
5th metacar pal SAbsruope al adomeo Ud eor ote 30. 315 =| 34 335 3842 |
Veena ce oe mPen she acetal usae a machetes Oy OS | 10°8 9 104 |
ane 97 10 | 10°2 105 115 |
Tail PER so ZRRMEL OM EMionn Mia eee Lp gOS eM wah lg 155 17:8 |
Tio werwle ge: nsenrt 6 ade terccacieccteioneiaee 168 178 | 21 19°8 203 |
Foot ....... Se BHOU ROE CHORD OES eS eaten | 9°3 85 92) |
Skull, total leneth tee ate eee op b anne ahi tone! 21-2 197 202 |
57 DASTONG! WAH 555m 060 280002 00008 Scar 10:2 9:3 10
> Width of brain-case ...............| 8 3: 9°5 Siommoud
5 AVEOTIENNG WACWIN so6o0c0n5c0a0cee00) 9: aa 108 Pee LOwt
;, supraorbital length .. eG Sulee O2aee| 56 5 sik |
width of nasal sw ellings ‘ee | 52 56 5'8 ee 55 |
Mandible, length .. Geanaeouncaal e Lieel ee ea! es [Por ls ba be tel
Upper teeth Mite aM LaRue a hl aca Veal 8:7 Cs 1D |
howerrbeetht tee cncce racer seneerercmniie t3 dio a Sl ee
|
1905. | OF THE GENUS RHINOLOPHUS. 93
(compared with the fourth metacarpal); the excessively short
tail; and the smaller hind foot.
Phylogenetically, Rh. stheno is evidently more closely connected
with Ah. nereis than with any other hitherto known Bat, To call
the resemblance between these two species (in III.*, [V.’, the tail)
“ convergence,’ would be a phrase only, not an explanation, There
can scarcely be any doubt that the type of Rhinolophus to which
the now existing Rh. borneensis belongs, sent off a branch west-
wards; a part of this branch, isolated on the Anambas Islands,
developed into Fh, nereis; another part, in the Malay Peninsula,
into Fh, stheno (cf. the diagram on p. 120).
11. Rurotopnus rouxt Temm. (Plate IIT. fig. 9 a, b, ¢, d.)
Diagnosis. Allied to Rh. borneensis, but larger, and with con-
siderably longer metacarpals. Third metacarpal 34-38 mm.
Forearm 46—51°5 mm.
Details. This is a large, continental representative of the
borneensis type, characterised chiefly by the much longer meta-
earpals and the shape of the lancet. In general size, the
continental 2h. rowxi bears the same relation to the insular
Rh. borneensis as the continental Rh. megaphyllus does to the
insular Lh. simplex.
The sella is practically parallel-margined from base to summit ;
not rarely some faint indication of a constriction at the middle
can be traved ; summit broadly rounded off. In simplea and its
closest allies the lancet is long and quite (or almost) cuneate ;
in borneensis there is some tendency towards a slight emargination
of the lateral margins of the lancet ; this tendency has been carried
almost to an extreme in rowai: the lancet is hastate, i. e., abruptly
narrowed in the middle, the tip well developed and slender (not
abnormally shortened, as in thomas); but still, individually
(though, as it seems, rather rarely), in rout, the lancet is less
abruptly narrowed, as an atavism towards a passed stage, The
ears are as in borneensis.
Wing-structure almost on the simplex-borneensis stage, 7. e.,
III? almost always less than 13 the length of III.!. The rare
individual exception, that IIT.* is equal to (or a mere trifle
more than) 13 the length of ITI.', is of some interest as fore-
shadowing the next important step to be taken in the series of
evolution, viz., from rowxi to affinis, in which species III.” is
always considerably more than 14 the length of IIT.’
Plagiopatagium inserted on, or 1-4 mm, above, the tarsus, 7. e.,
there is evidently some tendency to draw the insertion of this
membrane away from the ankle-joint, a little higher up on the
tibia; compare with this 2h. afinis. The proportionate length
of the tail is as in borneensis.
Skull. The skull of Rh. rousxi is larger than that of borneensis,
but I fail to find any appreciable difference in the shape—a
strong evidence of the very close relationship between the two
species. The individual variation in the size of the skull, in
94 MR. K. ANDERSEN ON BATS [ May 16,
vouxi, is rather considerable (as is also the variation in the ex-
ternal dimensions of this Bat); but among 18 skulls of the typical
form of rowxi, from localities so many and so distant inter se
as to represent practically the whole area covered by this form,
I do not find any so small as the largest among 11 skulls of
borneensis (and 6. spadix); in so far there is no difficulty in
diseriminating them. The tooth-rows, too, in rowaxi, are longer.
As to the small 8. Chinese race of row«i (described below), the
skull has the same length as the largest of borneensis, but the
brain-case is decidedly broader, the zygomatic and maxillar width
greater.
Dentition (19 skulls). p,, most often, quite external (12 skulls) ;
not rarely half in row, or ? in row (6 skulls); in one aged
individual (teeth much worn) p, is wanting, on both sides of the
mandible, and the alveoli have disappeared. Cingula of p, and p,,
most often, in contact or separated by a very narrow, sometimes
almost hairfine, interspace (13 skulls); in the remaining (6)
individuals, distinctly separated, but the width of the interspace
is not always quite the same on both sides of the mandible.
The upper canine and p‘ are, with rare exceptions, distinctly
separated, p* completely in the tooth-row (17 skulls, out of 19),
as in all the foregoing species. The size of p* and, therefore, the
width of the interspace between ¢ and p‘ vary, however, to a
certain extent; but in »o instance is the width of the interspace
as broad as (p° as well developed as) in stmplea: this is a thing of
the past. As to the remaining two skulls (Ceylon, Nepal), the
interspace is very narrow, p° half external. This 1s the first time
we have to note instances of p’ not being completely in the
tooth-row.
As a general conclusion :—(1) In “Ah. rowxt p, has arrived
so far on its way towards disappearance as to be, generally,
external; but still, not rarely, the individual variation falls back
to a former stage: p, partly in the tooth-row; and in some aged
individuals the dentition (p, disappeared) points forwards to sub-
sequent stages in the series of evolution: Rh. ferrwm-equinum
(p, rather often lost) and 2h. acrotis (p, always lost). (2) As to
p’ in rouwi, it is generally in the row, rarely half external; this
latter, again, points forwards towards subsequent stages: thomasi,
ferrum-equinum, and acrotis (p° always external, or lost).
Distribution. From 8. China through the Himalayas to the
Indian Peninsula and Ceylon.
Technical name. As Rh. rouxt has for many years been com-
pletely confused with Ah. affinis, some remarks are necessary to
prove that the name rowxt belongs to the species here under
consideration. The type locality of Rh. rowai is “ Calcutta” * ;
the types (in the Leiden Museum) were collected by the French
naturalist, M. Roux. There is in the Tomes Collection (British
Museum) a skin also collected by Roux. The essential points
~ * Temminck, loc. infra cit., p. 30 ¢; Jentink, ‘Catalogue systématique des
Mammiferes,’ Mus.:d’hist. nat. Pays-Bas, xii. (1888) p. 161 (under Rh. affinis).
1905. ] OF THE GENUS RHINOLOPHUS. 95
in the original description as given by Temminck are the
following :—
(1) In “taille, forme du corps, des oreilles et des follicules
accessoires du nez” very much like Java specimens of Zh. affinis
Horsf. It may be said so; the difference in the shape of the
sella is not easily ascertained in dried skins.
(2) “ Des proportions moins grandes,” as compared with affinis.
As measurements Temminck gives :—Of rowxi: forearm “1 pouce
10 lignes” (49°5 mim.), expanse of wings “10 pouces.” Of affinis:
forearm ‘1 pouce 10 lignes,’ expanse “11 & 12 pouces.”
49-5 mm. is one of the commonest measurements of the forearm
in the series before me. It looks a little contradictory that
Temminck, having stated that rouxi is smaller than affinis (which
is quite correct), gives precisely the same measurement of their
forearms, though, at the same time, a considerably larger
“expanse” of the latter species. But just that is the salient
point. Asa matter of fact, the two species can have the forearm
of exactly the same length (very large rowai, and small affinis) ;
but also in that case, the expanse of Rh. aflinis is always markedly
larger than that of Rh. rouxi, for the obvious reason that in the
former species the second phalanx of the third (longest) finger is
always absolutely longer than in the latter.
(3) A ved, a dark, and an intermediate phase of rowaxi were
known to Temminck. I have the same phases before me. That
similar phases occur in Ah. borneensis has no bearing on the
present technical question; borneensis lives far away from
“ Calcutta.” The “phases” of Rh. affinis are different.
(4) “Les molaires de la machoire supérieure sont en méme
nombre que dans lafinis, celles de Vinférieure en compte cing, ou
une de moins, par le manque total de la petite dent dont lafinis
est pourvu, et qui forme la sixiéme molaire.” Since Temminck
emphasises the “‘ manque total” of p,, I suppose that he has not
overlooked this small tooth, but has examined a (probably aged)
individual in which it was wanting (cf. the specimen mentioned
above). The word “ sixiéme” is, of course, a lapsus for “cinquiéme”
(Temminck counted the “molars” from behind forwards).
To sum up:—There can be no doubt that Temminck’s RA. rowni
is the Bat here under consideration, being a species (1) bearing
much resemblance to 2h. affinis ; (2) of almost the same size, but
with a markedly smaller expanse of wings ; (3) with a red, a dark,
and an intermediate phase; and (4) inhabiting the Continent of
India.
“Rh. peterst.” —The original description of Rh. petersi is meagre
and vague ; the figures of the head and nose-leaves published four
years later are badly drawn; the type specimen (in the Calcutta
Museum) has no indication of locality. This may sufficiently
account for the fact that no technical name in the genus has been
the source of more confusion. I therefore think it of some use to
give a brief sketch of its rather complicated history in literature :—
(a) As to the identification of *“ Rh. petersi,” in the original
96 MR. K, ANDERSEN ON BATS [May 16,
sense of the term*, there are only two alternatives: it is either
Rh, rowwi or a species of the Ah. acuminatus section, I have
not the slightest hesitation in referring the name as a synonym
to the former species. As, however, Dobson himself later on
applied the name to two Bats of the aewminatus section, it will
only be necessary to give evidence, from his own description, that
he was mistaken. The only important points in the description
of “ Rh. petersi” as given by Dobson in 1872 and 1876, i.e. at the
time when he had access to the type specimen, are the following
(the italics are mine)—(1) The nose-leaves are “as in Lh,
acuminatus, except the upper border of the posterior connecting
process, which is much less acute.” This statement alone would
be sufficient. In acwminatus the shape of the sella and lancet is
very much as in rouwai, but the connecting process, both in
acuminatus and in all its allies (swmatranus, calypso, wudax), 1s
projecting and pointed; there is, in this respect, no difference
between the species of the aewminatus section, and there is also no
appreciable individual variation. When, therefore, Dobson in this
decisive point (the chief character of the whole group to which
acuminatus belongs) declares his Rh. petersi to be very different
from acuminatus, it may safely be said that it has nothing to do
with that group. Dobson had evidently before him an example
of Rh. rouxi with a slightly raised connecting process (‘‘ much less
acute” than in acwminatus); such individuals are by no means
rare ; there are severalin the British Museum, and the peculiarity
is purely individual. Dobson found, quite naturally, that this
peculiarity recalled that shape of the connecting process which had
been described, one year earlier, by Peters in a species called by
him Rh. acuminatus Tt, and, consequently, he compared it, in his
paper, with this latter species, at the same time emphasising that
there was a considerable difference. (2) The figure (side view) in
Dobson’s ‘ Monograph,’ however bad it is, can scarcely represent
the shape of the connecting process in acwminatus. Dobson has,
no doubt, called the attention of his artist to the connecting
rocess of the specimen to be figured as 2h. petersi, and the artist,
in due obedience, has made his best to ‘‘emphasise” that point :
this may account, I think, for the process being somewhat more
exaggerated than in ordinary individuals of rowxi; but it is still
not the process of an acuminatus. (3) The measurements of
petersi are, without any exception, perfectly like those of several
unquestionable specimens of rowai measured by myself ; there is not
the slightest indication of a difference. (4) The type of petersi is
from “ India, precise locality unknown.” The aewminatus section
is distributed over Sumatra, Engano, Java, and Lombok. When
Dobson wrote his ‘Monograph,’ there was not, in the Calcutta
Museum, any specimen.of any species of Rhinolophus from
those islands; so that, if RA. peterst were a member of the
acuminatus section, the type, without locality, would have been
* Dobson, J. A. S. B, xli. pt. ii. (Dece 22, 1872) p. 337; id., Monogr. Asiat. Chir.
(1876) p. 49, text-figs. a, b.
+ Peters, MB. Akad. Berlin, 1871, p. 302.
1905. | OF THE GENUS RHINOLOPHUS 97
the only Rhinolophus in the museum from any of those islands.
This is, of course, not beyond the limits of possibility ; but it is
certainly much more likely that RA. petersi, as also the vast
majority of the Bats in the Caleutta Museum at Dobson’s time,
came from some part of the Indian Peninsula or the Himalayas,
the habitat of Rh. rowxi, and far from the home of Rh. acuminatus
and its allies.
To describe a new species which subsequently proves to be an
old one is no rare occurrence, and, as a rule, it does no very serious
harm. But the strong emphasising of a purely individual
peculiarity, combined with the circumstance that the type had no
“ locality,” caused in this case a series of confusions: Rh. petersi
emerged, like a ghost, very unexpectedly at such different places
as the Gold Coast, Sumatra, the Himalayas, and 8. India. And,
curiously enough, the author of the “species” inaugurated the
mistakes. When he had returned to London and was working
out his ‘Catalogue,’ Dobson had no longer access to the type of
Rh. peterst; he had his own short description only, and perhaps some
private note. It is quite evident that, in these circumstances and
occupied with the study of many other Bats, he lost the precise
idea of the type specimen ; he only kept in his memory, as its most
important character, its ‘‘ projecting” connecting process. So it
eame that he referred a specimen labelled ‘Gold Coast” to
Rh. petersi*; for it is a genuine acuminatus, beyond all doubt
from Java, and Dobson himself would scarcely have been able
to tell why he called it peterst instead of acuminatus. Two
years later, Dobson had for determination a collection of Bats
belonging to the Gottingen Museum; among these he again
believed he found a Fh. petersit. I have had this example for
inspection £; it is neither ‘“‘ Rh. petersi” nor Rh. acuminatus, but
Rh. sumatranus.
(6) In a paper on some Himalayan Bats, Capt. Hutton § records
Rh. petersi from Masuri. All the Bats mentioned by Hutton
were presented to the ‘‘ Indian Museum,” and are now in the
British Museum. The two specimens labelled “ Rh. petersi” are
Rh. monticola, a species closely allied to Rh. lepidus ||.
* Dobson, Cat. Chir. Brit. Mus. (1878) p. 114.
+ Dobson, “On some new or rare Species of Chiroptera in the Collection of the
Gottingen Museum,” P. Z.S. 1880, p. 462.
¢ I am indebted to Geheimrat, Professor Dr. Ehlers, Gottingen, for the loan of
this specimen.
§ Hutton, “On the Bats of the North-western Himalayas; with Notes and Correc-
tions in Nomenclature by Prof. W. Peters,” P. Z.S. 1872, p. 700.
|| As Hutton’s article is one of the very few papers which give information respecting
the habits of Himalayan Bats, and therefore has been frequently quoted by subsequent
writers, I think it advisable to correct the following errors in the identifications of
the four species of Rhinolophus dealt with in that paper :—“‘ Rh. affinis’’ (p. 696)
is Rh. pearsoni; “ Rh. rouwi” (p. 697) is Rh. affinis ; “ Rh. minor” (p. 698) is Rh.
rouxi; and, as pointed out above, “ Rim petersi” (p. 700) is Rh. monticola. Hutton’s
Bats were (as also stated in his paper) determined, not by himself, but by Prof.
Peters in Berlin. But the mistakes are so strange that they cannot, certainly, be
due to Prof. Peters; an extensive confusion of labels must have occurred (I can
rather easily, from Peters’s point of view, as laid down in his papers, guess the
original arrangement of the labels), but the confusion had at all events taken place
before the specimens were returned to Hutton.
Proc. Zoou. Soc.—1905, Vou. II. No. VII. 7
98 MR. K. ANDERSEN ON BATS [May 16,
(c) In Blanford’s ‘Fauna of British India’ (loc. injra cit.)
Rh. peterst is recorded from Masuri and from Nilghiri. The
former statement is borrowed from Hutton’s paper. The latter is
based on an example collected by W. Davison in Coonoor, Nilghiri*.
This specimen is now in the British Museun. It is a Ah. rouse.
In short:—(1) For reasons given above I regard Dobson’s
Rh. peterst (1872 and 1876) as a synonym of Lh. rouxt; (2)
Dobson’s Rh. petersi (1878) is Rh. acuminatus; (3) Dobson's
Rh. peterst (1880) is Rh. swmatranus; (4) Hutton’s hh. petersi
is Rh. monticola; (5) Blanford’s Rh. petersi is partly Rh. monticola
(Masuri), partly Rh. rowaxi (Nilghiri).
Geographical races. There are, at least, two forms of 2h. rouwi,
differing in size and geographical habitat.
lla. RHINOLOPHUS ROUXI SINICUS, subsp. n.
Diagnosis. Skull smaller, tooth-rows shorter. Forearm 46 mm.
Details. The general size is as in the very smallest examples I
have seen of the typical form. Skull still a little smaller, with
slenderer brain-case and shorter tooth-rows; nasal swellings, in
front view, slightly lower. Colour as in the dark phase of
Himalayan specimens of the typical form (see below).
Measurements. On p. 100.
Type. & ad. (skin). Chin Tah, Anhwei, Lower Yangtse 7.
Presented by W. Styan, Esq. Brit. Mus. no. 99.3.1.6.
116. RuroLopuus Rouxt Temm., TYPICUS.
Rhinolophus Rowxit Temminck, Mon. Mamm. ii. 8° monogr.
(1835) p. 300.
Rhinolophus rubidus, cinerascens, rammanika Kelaart, Prodr.
Faune Zeylanice (1852), pp. 13, 14.
Rhinolophus Rouxii (partim) Peters, MB. Akad. Berlin, 1871,
. 308.
; Rhinolophus petersii Dobson, J. A. 8. B. xli. pt. ii. (1872)
p-. 337 (nec Dobson, 1878, 1880); Blanford, Fauna Brit. India,
Mamm. pt. ii. (1891) p. 275 (partim).
Rhinolophus minor (non Horsf.) Hutton, P. Z.8. 1872, p. 698.
Rhinolophus affinis (partim, nec Horsf.) Dobson, Cat. Chir.
Brit. Mus. (1878) p. 113.
Diagnosis. Skull larger, tooth-rows longer. Forearm 46—01'5mm.
Colour.—(1) Specimens from Nepal and Darjeeling. (a) Dark
phase: onead.; Nepal; teeth unworn ; skin :—Upper side “ mars-
brown”; horse-shoe patch on back distinguishable, though some-
what obliterated ; base of hairs light ‘‘ drab,” almost ‘ ecru-drab ” ;
under side “drab,” with a tinge of ‘“russet” ; sides of body some-
what darker. With this skin agree in colour another adult
specimen from Nepal (teeth somewhat worn; skin) and a 9 ad.
from Darjeeling (in alcohol).
* Blanford, J. A.S. B. lvii. pt. ii. no. 3 (1888) p. 261.
+ For the exact position of this locality, see ‘ Ibis,’ 1899, p. 289.
1905. | OF THE GENUS RHINOLOPHUS. 99
(6) Light phase: one ad.; Darjeeling; teeth slightly worn ;
skin :—Above inclining to “clay”; a strongly marked, deep brown
horse-shoe patch; base of hairs and fur of under side almost
“ cream-buff.”
(2) Specimens from Ceylon and India.—{a) Dark phase:
three adult individuals; Ceylon; teeth rather slightly worn;
skins :—Upper side a shade of brown, darker and duller than
“mars-brown ”; horse-shoe patch more or less effaced; base of
hairs “drab,” with a tinge of ‘ ecru-drab”; under side ‘‘ wood-
brown” or light “ drab.”—This is Kelaart’s 2h. cinerascens.
A skin (ad., January, teeth unworn) from Sirzi, Kanara, comes
extremely near to the last-mentioned specimen, being only a little
darker. A. spirit-specimen from Nilghiri seems to be of very
much the same colour.
(b) Intermediate stage: 3g ad.; January; Sirzi, Kanara; teeth
unworn. Upper side between “russet” and ‘ mars-brown ” ; base
of hairs ‘‘ ecru-drab” ; under side almost “ clay.” —This is Kelaart’s
th. rammanika.
(c) Red phase: one ad.; Ceylon; teeth worn; skin :—Above
light “hazel” with a tinge of ‘orange-rufous”; horse-shoe patch
almost obliterated ; base of hairs and under side of body light
“ orange-rufous.”—This is Kelaart’s Rh. rubidus.
A skin (¢ ad., February, teeth unworn) from Jellapur, Kanara,
represents the extreme of light colour: upper side next to “ tawny-
ochraceous”; base of hairs and fur of under side almost ‘“ orange-
ochraceous.”
Conclusions :—-The dark phase in specimens from the Himalayas
(Nepal, Dar ‘jeeling) 1 is of a richer brown, more tinged with russet,
than in specimens from Ceylon and 8. ‘India (Kanara, Nilghiri).
The light phase, in specimens from the Himalayas, seems to be
more inclining to “clay”; in specimens from Ceylon and§. India
more “hazel” or * tawny-ochraceous.” I do not think the series
examined affords evidence conclusive enough to justify the sepa-
ration of a Himalayan “race” and a soit hern (Ceylonese and
S. Indian) “race.” In all the other characters (external, cranial,
dental; variation in general size) there is no appreciable dif-
ference. If they were *t0 be separated subspecifically, the southern
form would have to stand as “ 2h. rowai rubidus Kelaart,” the
Himalayan as ‘“ 2th. rouxt typicus.”
Measurements. On p. 100.
Distribution. Himalayas (Darjeeling, Nepal, Masuri). 8. India
(Nilghiri, Kanara) and Ceylon.
Remar hs. Of the two forms here recognised, 2h. rowan sitirvicus
and Rh. rowxi typicus, the former, as coming nearest to Lh.
borneensis, is no doubt the more primitive. The rouai-type,
therefore, has spread from an eastern point of the continent
westwards, through the Himalayas, down the Indian Peninsula,
to Ceylon.
Q/
100 MR. K. ANDERSEN ON BATS [May 16,
12. RHINOLOPHUS THOMASI, sp. n. (Plate ITI. fig. 10.)
Rhinolophus affinis rouxi? (non Temm.), Thomas, Ann. Mus.
Civ. Genova (2) x. (1892) p. 15, pl. xi. fig. 3.
Diagnosis. Allied to Rh. rouxi, but p* external to the tooth-row.
Smaller than rowwi, with considerably shorter metacarpals, and
the tip of the lancet excessively shortened. Third metacarpal
30°-4-31 mm. Forearm 44°8-45-7 mm.
Details. While being similar to 2h. rowwi in the shape of the
sella and the ears, and the proportionate length of the tail,
Rh. thomasi differs, externally, from that species in the following
particulars :—
The horse-shoe is considerably narrower ; it is even narrower
than in the smaller borneensis and in the much smaller malayanus.
- The tip of the lancet is exceedingly short, almost rudimentary ; it
is the hastate lancet of rowai carried to an extreme.
The general size is smaller, as seen by the measurements of the
forearm. But the metacarpals are proportionately mach shorter,
as short as inthe much smaller malayanus. ITI.° is comparatively
Measurements of Rhinolophus rouxi and thomasi.
Rh. rouxi. | Rh. thomasi.
sinicus. Eypicus.
6 ad. 30 specimens, || 2 specimens,
Type. 18 skulls. | 1 skull.
Min. Max. Min. Max.
min. mm. mm. || mm. mm.
Devas, Jes RERAN 289 s3a44s ceaeeaeae coaceanee ony bb0 see 166 19 | 168 168
» greatest breadth.....................| se 13 «86415 |} 12 122
Nose-leaves, total length ...............| Hee 135 162 || 117 118
| F breadth of horse-shoe ...| abe eens 927 = a2) ES
Forearm EAR eee Stigs tcc ericnealg AO 46 515 || 448 45°7
Brdumetacatpal...es.eesehsa tesserae | ee 34 = 38 || 3804 31
WORT pre tee conenine cc sean/escmemnemaal pg) hate 137 15'8 13°) 1331
fl U UC 2 BA a a aes ean nantehcosaaRmEBRentas.. aan 20°8 185 25°5 20°2 20:2
Ath metacarpal............c0c0cc | BHT | 3845 389 313 319
PW a aubk fet Aart SEU eats esadacianence tr ikl isla 7 12 10 102
Ia IsWite, sSeeteeny Renee nm natin seater gt sccercenl (mk acer 17 145 = «|| 12:2 12-7
| 5th metacarpal..........-.........:.-.-.-..| 354 354 389 || 3823 327
others sett pada coe ponbosnpoandieegatondacdes 119 106 132 11 11:2
Veo ee ed opments ack valine ures le DZ eS 9 9:7
I ARES uioh onuedude pay aasouebesbooee sadoeacntso4b 21 21 265 || 19 19
Us Gonueese Gea ele ho ndociagsesecandenuescocenel| SA8MS) 19 235 || 18 18
DY GXE a cmences cononet uucases ane sancenene buy adel & 9. 11:2 8 88
Sheol #rotalilene-thissssreeree sire veces ele ae 20°3 23 nish teaiiinn oe =
,, mastoid width .....................] 9°5 ‘O'7 10° 9:2
» width of brain-case............... 87 87 98 8:7
» zygomatic width..................| 108 104 118 10
», supraorbital length ............... 48 48 58 4-4,
» Width of nasal swellings......... 5°8 65 59 53
Mandible, length ............0..0...0..[ 185 13 «164 12°8
Wipper teeth 20sec. eesceee essen TT 82 92 Hilt
TORRE THA, icone cod eau see ane0oo cbosons00080 81 85 103 ai
1905. | OF THE GENUS RHINOLOPHUS. 101
longer than in rouwi, 7.e. more than 13 the length of IIT.’
(cf. neveis and stheno). V. is extremely short.
Colour. To judge from specimens preserved in alcohol, probably
not far from being the same as in the dark phase of Nepal examples
of Rh. roux.
Skull. The essential characters are as in rouat, thus proving
Rh. thomasi to be an offshoot from that type of Bat, not (as might
very well be supposed, in view of the short metacarpals) from
borneensis. The skull of Rh. thomasi agrees with that of rowat im
the broad brain-ease ; it differs from rowxt in the much smaller
size. Compared with borneensis, the skull of 2h. thomast 18 as
small ag in the smallest individuals I have seen of borneensis (even
as small as in malayanus), but the brain-case is markedly broader,
even broader than in the largest bormeensis, and the supraorbital
length is exceedingly short (¢/. measurements, p. 100).
Dentition. p, external; p, and p, in contact; p* external,
Upper canine and p* in contact. Both of the specimens examined
are identical in dentition.
Measurements. On p. 100.
Type. 2 ad, (in alcohol). Karin Hills, Burma, 1888. Collected
by Signor Leonardo Fea. Presented by Marquis G. Doria. Brit.
Mus. no. 90.4.7.10.
I venture to connect with this fine species the name of
Mr. Oldfield Thomas, who already thirteen years ago (J. s. ¢.)
pointed out that it could scarcely be identified with any hitherto
known form, but refrained from describing it as new, owing to
the general confused state of this group of Bats.
13. Ruronopuus arrints Horsf. (Plate HT. figs. 11-13.)
Diagnosis. Sella pandurate. p° in the tooth-row. Forearm
50-56 mm.
Details. This species marks an important progress in develop-
ment as compared with 2h. rowwi. It is the base of the ferrum-
equinum section.
The chief modifications are four: in the shape of the sella; in
the structure of the wings; in the size of the animal; in the
shortening of the palatal bridge.
In the borneensis-rouwi type the sella is practically parallel-
margined; in afinis it is pandurate, %. ¢. the lateral margins
concave, as in ferrum-equinum, though generally to a slightly
less degree. In simplex and its closest relations the lancet
is almost cuneate; in borneensis there is a tendency towards
emargination of the lateral margins; in rows this tendency is
carried to an extreme ; in afinis the lancet falls back to the former
stage : it is almost cuneate. E
Throughout the whole series of forms reviewed above, with the
exception of the somewhat aberrant Rh. nereis, stheno, and thomas,
the wings have remained at the same primitive stage : no length-
ening of the second phalanx of the third finger. In affinis this
phalanx has considerably increased in length, being always more
102 MR, K, ANDERSEN ON BATS: [May 16,
than, and with very rare exceptions considerably more than, 14 the
length of the first phalanx, a peculiarity which is preserved in the
subsequent stage of evolution: ferrwm-equinum. The aberrant
species just alluded to, viz. Rh. nereis, stheno, and thomasi, are,
from this point of view, of especial interest, as being Bats of the
rouxt type which already show the wing-structure characteristic
of the more highly developed affinis.
kh. affinis is larger than rouxi ; but small affinis have the same
length of the forearm as very large rouxi. In such cases,
Ph. afjfinis, provided the specimens examined are fresh or preserved
in spirit, can, of course, easily be discriminated by the shape of
the sella and the length of III’; if preserved as dried skins (in
which the shape of the sella is often difficult to recognise), still
the latter character remains unchanged.
Colour. The many forms in which this species is differentiated
seem to agree, rather closely, in colour :—-
(1) Darker individuals: gad., Darjeeling (2h. a. himalayanus) ;
Oct. 22nd; teeth unworn; skin :—Upper side “ mars-brown”
with a rather strong hue of “drab”; no horse-shoe patch; base
of hairs ‘“ ecru-drab”; under side ‘ broccoli-brown.”
Still darker isa ¢ ad. from Lombok (2h. a. princeps); teeth °
somewhat worn ; in alcohol; unfaded :—‘ Prout’s brown” above,
base of hairs ‘‘wood-brown”; under side almost “ tawny-olive.”
(2) Light-coloured individuals: ¢ ad., Nanking (2h. a. hima-
layanus); July 5th; teeth somewhat worn; skin :—Extremely
light. Above light “clay,” almost “ ochraceous-buff,” hinder
back somewhat darker; a rather distinct, ‘‘ mars-brown ” horse-
shoe patch; base of hairs “ cream-buff”; under side very light,
almost ‘ cream-buff.”—-A spirit specimen ( gf ad.) from the same
locality (June 15th) is quite of the same colour.
Skull. The essential characters as in rouaxi, proving that
Rh. affinis originated from a Bat of that type. The skull is
generally larger, and the gap in front between the maxillary
bones wider. Chief character: the exceedingly short palatal
bridge, as a rule only 7 the length of the maxillary tooth-row, or
even less; in rowxi, with very rare exceptions, decidedly more
than t, sometimes almost 3. The teeth, too, are slightly larger.
Dentition. p, external and extremely small; but, as a rare
exception, this premolar may still, in this comparatively highly-
developed species, show some tendency towards the tooth-row
(one skull, out of 19), or be halfway in row (one). p, and p,
generally quite, or almost, in contact (14 skulls); in the remaining
somewhat more distinctly separated. p> always in the tooth-row,
extremely small, and the interspace between the canine and p*
rather narrow. In no less than five skulls there isan exceedingly
narrow, In most cases almost hair-fine, interspace between p* and
p' (the former place of p’)
Distribution. From the N.W. Himalayas to 8. China; through
Indo-China, the Malay Peninsula, and N. Natunas, to Sumatra,
Java, and Lombok.
1905. | OF THE GENUS RHINOLOPHUS. 103
Technical name. The type of Rh. affinis is in the British
Museum. From the original description it would have been
quite impossible to identify the species.
Remarks. Of all the races of Rh. affinis, the Himalayan form
(Rh. «a. himalayanus) is the most ordinary-looking: in_ the
horse-shoe, the ears, the nasal swellings, the brain-case. There
can hardly be any doubt that the affinis type originated in the
Himalayas, and from there spread eastwards to 8. China, south-
eastwards through Indo-China, as far as Lombok.
Geographical races. There are, at least, seven forms of Rh. affinis,
differing in certain cranial characters, in the size of the ears and
horse-shoe, in the length of the tail and tibia, in general size, and
in geographical habitat. Some of these forms may be called
distinct species by other authors.
13@. RHINOLOPHUS AFFINIS HIMALAYANUS, subsp. n. (Plate IIT.
fe. Ue, b.)
Rhinolophus affinis (pavtim) Dobson, Cat. Chir. Brit. Mus.
(1878) p. 112.
Diagnosis *, External characters :—Size largest ; ears small ;
horse-shoe narrow; tail short ; lower leg short. Cranial: length
of skull, width of brain-case, length of tooth-rows, moderate ;
nasal swellings narrow.
Type. Q ad. (in alcohol). Masuri. Collected and presented
by Capt. Hutton. Brit. Mus. no. 79.11.21.148.
Distribution. Himalayas (Masuri, Nepal, Darjeeling) ; 8. China
(Nanking).
13 6. RHINOLOPHUS AFFINIS TENER, Subsp.n. (Plate ITT. fig. 12.)
Diagnosis. External characters: Size small; ears small,
horse-shoe broader; tail short; lower leg rather long. Cranial :
skull short; nasal swellings and brain-case narrow; tooth-rows
short.
Type. 3 ad. (in aleohol). Pegu. Collected and presented by
W. Theobald, Esq. Brit. Mus. no. 87.5.4.11.
13c. RHTNOLOPHUS AFFINIS MACRURUS, subsp. n.
Rhinolophus afinis Thomas, Ann. Mus. Civ. Genova (4) 3,
(1892) p. 922.
Diagnosis. External characters: Size moderate; ears larger ;
horse-shoe broader; tail long; lowerleg longer. Cranial: length
of skull, width of brain-case, length of tooth-rows, moderate ;
width of nasal swellings moderate.
Type. gad. (inalcohol). Taho, Karennee, Burma; Febr. 1888.
Collected by Signor Leonardo Fea. Presented by Marquis G.
Doria. Brit. Mus. no. 90.4.4.7.
% As the characters of the different forms of Rh. affinis are sufficiently clearly
expressed in the table of measurements, p. 105, they will not be reviewed im detail,
but only rendered in general terms, in the “ diagnoses” of the subspecies.
104 MR, K. ANDERSEN ON BATS [| May 16,
13d. RHINOLOPHUS AFFINIS SUPERANS, subsp. n.
Rhinolophus afinis (pavtim) Peters, MB. Akad. Berlin, 1871,
p- 306 ; Dobson, 1. s. e.
Diagnosis. External characters: As macrurus, but with short
tail. Cranial: skull rather long; nasal swellings still broader
than in macrurus; brain-case broad ; tooth-rows rather long.
Type. 9 ad. (in alcohol). Pahang, Malay Peninsula. Pre-
sented by the Selangor Museum. Brit. Mus. no. 0.7.3.2.
Distribution. Lower Siam (Trong); Malay Peninsula (Pahang) ;
Sumatra.
Remarks. A specimen from Sumatra is in every respect, cranial,
dental, and external, indistinguishable from those from Pahang
and Trong (the latter sent for identification by the United States
National Museum).
13. RHINOLOPHUS AFFINIS NESITES, subsp. n.
Rhinolophus affinis Gerrit 8. Miller, Jr., Proc. Wash. Ac. Sci.
iii. (1901) p. 135.
Diagnosis. External characters: As superans, but smaller, and
with shorter tibia. Cranial characters unknown.
Type. Qad.(inalcohol). Bunguran Isl., N. Natunas, Aug. 24th,
1900. Collected by Dr. W. L. Abbott. Un. St. Nat. Mus.
no. 104753.
Remarks. This is evidently an offshoot of the Malacca form,
Rh. a. superans, isolated on the outlying N. Natunas, and
developed into a well-marked race (or species). It still shows
some of the chief characters of swperans: the large ears, broad
horse-shoe, and short tail; but, to judge from the metacarpals
(the forearms are broken), it is decidedly smaller, it would seem
still a little smaller than RA. a. tener, and the tibia is very short.
The skull is so much damaged that I have only been able to
examine the teeth and the lower jaw.
13. RHINOLOPHUS AFFINIS Horsf., TyPrIcus.
Rhinolophus affinis Horsf., Zool. Res. Java (1824), pl. [7],
figs. A, B.
Rhinolophus affinis (partim) Peters, |. s. c. (1871); Dobson,
1. s. ec. (1878).
T am unable to give a definite diagnosis of this, the “ typical,”
form of Rh. affinis, having seen only one very old skin (the type)
and a fragment of the skull, representing the facial portion and
the tooth-rows. But these are sufficient to show, first of all, of
course, the specific characters (pandurate sella, lengthened IIT.’,
dentition, &c.); secondly, that this form is quite different from
any of its next neighbours, on Sumatra and the Malay Peninsula
(superans), on the N. Natunas (nesiées), or on Lombok (princeps).
The horse-shoe seems, allowing for some shrinkage, to be quite
as narrow as in 2h. a. himalayanus ; the nasal swellings, too, are
as narrow as in himalayanus and tener. But, although the
OF THE GENUS RIHINOLOPHUS. 105
1905.]
L6éL
TL
8.6€
6-P1
¢.01
¢.6€
VG
¢.cT
9.16
6S
LIL
6-81
6.9T
€-16
“UU
“pe P
‘sdaoutud
“TUUL
‘ad AY,
“PY.
snoidhy
6-01
8.66
GG
G-GL
¢.IL
8.96
| 8-71
GOL
9€
| FG
PL
6.26
| 8-6
G-V1
6.06
“UU
ad Ay,
“ped
“saqisau
TOL 4-6 | 6.6
L.6 6 6-6
6-91 8ST L.9L
19 6.9 B.9
G9 L.S 6.¢
L6t IT 9.11
GOL 8-6 3-6
GIL 6.01 II
8-66 8.66 G6
ol TIL ait
8.96 GG V-6
GGG -€.16 €.66
SST G6L 8-F1
611 &I11 €L
c6e LLe Gi
7 FL G.9T
6.0L ol G-GL
8-8E 8-96 L.0F
96 8-86 2.96
GST 9-PT OL
6-8E 9€ 66
eg 66.19 8.€¢
OL 8-6 8.6
11 8-61 ¢.9L
LST 8-P1 8.ST
£06 6.06 1.06
“TU “UU “UU
‘xB ULIAL “XU
“s][NYS ¢
‘stauttoads ¢@
‘supsadns
4 10 19 10 do &
toe
sp gUcyWI~ HE
il
Ne) a
ier)
=
“WU
“ULIN
SIMS &
‘suamuoeds ¢
*SMLMLLODU
> © 19 19 19 G SD
a
DADAM ONAN
=!
)
6-€1
8.11
“ULL
‘ad AY,
“pe é
“wag
‘xe
BOL 4.6
¥.6 6
@.9T 8ST
a) Om
qo ag
8-IL TIT
OL 6
6.0L GOT
es L.2e
eae
Bes 8.66
e818
Lp LT
Sel ScD
Veh 6.68
a = Ol
BIL V-OL
GIP 8.88
ae Oe
oe Ol
OF 4-8
Gch ace
8.8 8
TL 6.1
GFL 8.81
GSI BLT
*ULUL “TUL
“UAL
‘STINYS L
‘suamads 9
‘snuphpppury
~" Yyoay TIMOTT
Uneeth woddy
Tiere) ‘OIqIPUB TN
© SSUITIOMS jeseu Jo [AprM
“yySuey peqqaoradus =
YIP orywuosdz = **
aseo-ulntq JO Yyprm
Ee ployseur
: sue] yeqoy TnyAS
4007
Sa] IOMOTT
TL
ZA |
vA
_[edavonjou qg¢
oe AT
cAI
Te eee “ah?
edawomaut pag
) ULIBO.10
il SOYs-as10r] JO TZ pPRa.tq a
aoe “* YVSUAT [RJO} ‘SOAual- 9SO NT
mu eeand qsayewais =“
YQouey ‘sven
|
‘savaadsqns Pup stuyys snydopouryy fo SPMAIUWAMNS DA T|"
106 MR. K. ANDERSEN ON BATS [May 16,
specimen is slightly smaller than the smallest example of hima-
layanus I have seen, the tibia is fully as long as (if anything, a
trifle longer) than in the very largest of these latter. On the
whole, I have but very little doubt that Ah. a. typicus will prove
to be much more closely related to the Burmese and Himalayan
forms than to any of the others. This would be an additional
evidence of the closer connection between the fauna of Java and
that of Indo-China and the Himalayas—closer than between Java
and the geographically nearer Sumatra, Malacca, and Borneo.
Distribution. Java.
13g. RHINOLOPHUS AFFINIS PRINCEPS, subsp. n. (Plate III.
fig. 13.)
Diagnosis. External characters: General size moderate; tail
short; but largest in the size of the horse-shoe and ears, and
the length of the tibia. Skull, nasal swellings, tooth-rows: the
extreme.
Type. 3 ad. (in alcohol). Lombok, July 1896. Collected by
A. Everett, Esq. Brit. Mus. no. 97.4.18.13.
Remarks. Placed side by side with Rh. a. himalayanus, this form
is strikingly different; the horse-shoe is no less than } broader
than the broadest in himalayanus, and the skull is distinguishable
at a glance by its excessive width and the very broad nasal
swellings. But it must be remembered that sawperans leads, not
up to, but decidedly in the direction of, princeps, and we do not
yet know the extreme limits of individual variation, either in
superans or In princeps.
When considering the geographical races * of 22h. affiiis from a
more general point of view—and excluding “ typicus,” owing to the
peculiar geological history of Java, as well as nesites, owing to its
having, probably, been influenced by somewhat exceptional con-
ditions, far away on the small isolated N. Natunas,—the following
rule will be observed: the more southern or south-eastern the
habitat, the longer the ears, the broader the horse-shoe, the longer
the tibia, the larger the skull, the broader the nasal swellings,
and the longer the tooth-rows.
5
14. RetNoLopHUS FERRUM-EQUINUM Schreb. (Plate IV. figs.
14, 15.)
Diagnosis. Sella pandurate. p* completely external or wanting.
Hars more than 20 mm. Width of horse-shoe less than 10 mm.
Forearm 52°8-65 mm.?f
Details. The ferrwm-equinum type originated from a Bat in all
* T am unacquainted with Dobson’s Rh. andamanensis (J. A.S. B. xli. pt. ii.
(1872) p. 337). The only specimen known is in the Calcutta Museum. It seems to
be a local representative of the affinis type.
+ The first and second characters, combined, are sufficient to distinguish fermein-
equinum from all Oriental species of this group. The others are added to prevent
confusion with those Ethiopian species of the present group which also have the
sella pandurate and p? external or wanting (clivosus, darlingi, acrotis; augur and
deckent).
1905.] OF THE GENUS RHINOLOPHUS. 107
essential points similar to 2A. afinis. It agrees with the now
existing affinis in the pandurate sella and the prolongation of
Iii’. But it is considerably higher-developed, chiefly in the
following respects: (1) the dentition; (2) the wing-structure ;
(3) the length of the tail; (4) the beginning, or complete, reduction
of the lateral mental grooves; (5) the general size.
The peculiar prolongation of the second phalanx of the third
finger, described above under 2h. affinis, is preserved in Rh. ferruim-
equinum: III.’ is more than (or, extremely rarely, at least equal
to) 14 the length of III... Also IV.’ is lengthened, i.e. more than
14 of IV.’; it is an interesting fact that, in this particular point,
Rh, ferrum-equinwm (all races) agrees with Lh. affinis himalayanus,
but not with any of the other races of affinis. Besides these
two characters, which are simply inherited from an affinis-like
ancestor, there is an important modification in another part of
the wing, to which we have no parallel in any of the foregoing
forms*, viz. «@ change in the proportionate length of the third,
fourth, and fifth metacarpals, as shown in the subjoined table :—
3rd meta- 4th meta- 5th meta-
. Forearm. carpal. carpal. carpal.
All the foregoime species
(94 examples) ..................... 1000 715 739 740
Rh. fervrum-equinum
(all races; 121 examples) ...... 1000 644. 724) 743,
This table shows:—(1) In all the foregoing 21 forms of this
eroup the fourth metacarpal is but very little longer than the
third (24 mm., for a supposed length of forearm of 1000 mm.),
and the fifth metacarpal is practically of the same length as the
fourth f. (2) In ferrum-equinum «a considerable shortening of the
third metacarpal has taken place ; at the same time a much smaller
reduction of the fourth metacarpal has occurred, so as to make
the fifth metacarpal, slightly but decidedly, the longest of all.
The tail is proportionately longer than in the foregoing species,
being, on an average, in the eastern races of ferrwm-equinwm
(nippon, tragaltus, regulus) exactly 14, in the typical form 13,
the length of the lower leg, whereas proximas, in this point (as
well as geographically), is intermediate between the eastern and
western races 7.
In all the foregoing forms, without exception, there are three
* But there is an exact parallel in an Ethiopian species, of the affinis type, viz.
Rh. darlingi (see the “General Remarks,” below, p. 118).
+ It would only have made the table more complicated if I had given separate
ciphers for all the foregoing species. The only difference (and an exceedingly small
one) is that in simplex, megaphyllus, truncatus, nanus, celebensis, borneensis, virgo,
and malayanus the fourth metacarpal is, almost always, a mere trifle Jonger than the
fifth; in xereis, stheno, rouxi, thomasi, and affinis a mere trifle shorter than the
fifth. However small this difference is, it is evidently the first faint trace of the
modification definitely carried out in ferrwm-equinum : the fourth metacarpal always
shorter than the fifth.
£ It is hardly necessary to say that a short tail cannot be a primitive character in
the order Chiroptera, taken as a whole. But, for some reason or other, we find in the
most primitive species of the genus Rhinolophus a very short tail; in the higher
forms of the present group we see, again, a lengthening of the tail.
108 MR. K, ANDERSEN ON BATS [May 16,
vertical grooves on the front of the lower lip. In the eastern races
of ferrum-equinum (nippon, tragatus, regulus) sometimes exactly
the same, but very often the lateral grooves are more or less
reduced ; in the western races (proximus, typicus, obscurus) they
have, as arule, almost or quite disappeared *.
As to the general size, the eastern races are, as it seems, always
larger than any form of affinis; proximus and typicus at least on
an average so; while obscurus is nearly of the same size as affinis
himalayanus.
The remaining external characters need only a brief record :-—
The supplementary leaflet is slightly more reduced than in
affinis, and more closely united to the upper lip; this latter it™is
(more than the reduction) which makes it less distinctly visible.
The posterior connecting process is more lengthened in antero-
posterior direction, also a little more projecting, but quite rounded
offat the summit. But, curiously enough, in one specimen (from
Transcaspia) I find the process quite as in @finis (in all other
specimens from W. Asia it is normal). The lancet has a marked
tendency towards assuming a hastate shape, rather than a cuneate,
the extreme tip being, generally, long and slender; but sometimes,
and both in the eastern and western races (though more often in
the former), individuals are found in which the lancet is almost
cuneate, as in affinis.—These two individual variations are worth
noticing, as, both of them, pointing back to affinis.
The ears are somewhat modified: more attenuated below the
tip, and more pointed.
The plagiopatagium is inserted on the tarsus, on the base of the
metatarsus, or about 1 mm. above the ankle-joint. But in one
individual (from Cyprus) it is mserted no less than 6 mm. in
front of the ankle-joint. It, again, recalls 2h. affinis.
Colour. A small series of skins from Tessin, Switzerland, affords
some information as to the difference in colour dependent on the
age of the individuals; all the specimens are of the same sex, from
the same locality, and the same month :—
(1) Two full-grown, but younger individuals (females,
December); distal epiphyses of metacarpals ossified, but teeth
unworn; they are probably about six months old :—Upper side
* According to Blanford (J. A. S. B. lvii. pt. 11. no. 3 (1888) p. 263), Rh. tragatus
Hodgs., regarded by him asa distinct species, and corresponding to what is here
called the eastern races of ferrwm-equinum, has three mental grooves, ferrum-equinum
one only. If this were so, I should have no objection to separating Rh. tragatus
‘specifically from ferrum-equinum. But there is, in this as in other respects, a
complete intergradation. The details are these:—(1) “Rh. tragatus” (10 spirit-
Specimens) : in three individuals (Kashmir, Almora, Darjeeling) the three grooves
are perfectly distinct; in three (Masuri, Nepal) the lateral grooves are less distinct
than the central one; in two (Nepal) they are so far on the way towards obliteration
that it requires close examination to discover them; in the two remaining (Shanghai)
they are still more reduced. (2) Rh. ferrum-equinum (s. stv.): rather often traces
of the lateral grooves are easily observable; a number of individuals before me, from
various places in Europe and W. Asia, have either a slight depression or a short
linear groove on either side of the central one; ina specimen from Ttibingen (one
instance only, among several) they are at least not moze obliterated than in two
“tragatus” trom Nepal and two “ nippon” from Shanghai.
1905. ] OF THE GENUS RHINOLOPHUS. 109
greyish “ drab,” lighter on the head and neck; base of hairs ‘ ecru;
drab”; astrongly marked, dark brown horse-shoe patch ; under side
almost “ ecru-drab” on throat and breast, very Lght “drab” on
belly.
(2) One (female, December); teeth almost unworn ; must be very
nearly of the same age as (1):—Intermediate in colour between
(1) and (3), but nearer to (3).
(3) Three aged individuals (females, December); teeth worn ;
two of them are at least 14 years old, the third (teeth very camel
worn) still older :—Upper side, a shade of brown which might be
described as “ mars-brown” with a pronounced tinge of ‘ ‘drab’;
base of hairs light “ecru-drab”; scarcely any indication of a
horse-shoe patch ; under side light ‘ wood-brown” with a tinge of
* ecru-drab.”
In a series from the Hautes-Pyrénées (January) I find the
same differences in colour, but have not been able to verify the
comparative age of the individuals by means of the skulls.
Three skins from Minorca (spring) are like the aged Swiss
individuals or, if anything, a trifle lighter. The teeth are worn,
showing the animals to be, probably, at least about two years old.
Skins of aged individuals from England are indistinguishable
from Swiss specimens of a like age. A very young (not full-
grown) example from Somerset is quite like the younger (greyish-
drab) individuals from Switzerland.
As a general conclusion: young individuals are, broadly
speaking, ‘dark grey, old individuals brown; the Colon of the
young animal is retained, at least in some individuals, till
December, beyond the time when the epiphyses of the metacarpals
have become ossified. For those who have an opportunity to
watch these Bats in the caves during the winter, it would be an
object of some interest to ascertain how the colour-change is
effected, by a moult or by a recolouring of the hairs.
Shull. The essential characters as in th. affinis, the general
shape hardly different, but as a rule, of course, the skull is larger.
The four anterior swellings are slightly more differentiated ; ‘the
median ones almost circular in outline, the lateral ones oblong.
Chief character: the much longer palatal bridge: very nearly 3
the length of the maxillar tooth-row, a little more or less, but
never so short as $ the tooth-row (as in affinis).
Dentition. p, external and exceedingly small, or, very often, lost,
also in younger individuals. p, and p,in contact. p* completely
external, extremely small, not rarely y lost, also in younger
individuals. Upper canine and p’ not only in contact, but their
cingula, as a rule, considerably overlapping each other (the cingula
of p* being external to that of the canine).
Measurements. On p. 115.
Distribution. From 8. Chinaand Japan, through the Himalayas,
the Mediterranean Subregion (exclusive of Egypt), and Central
Europe to 8. England.
Geographical races. There are, at least, six forms of Rh. ferrum-
110 MR. K. ANDERSEN ON BATS [May 16,
equinum, three eastern (iippon, tragatus, regulus), and three
western (proximus, the typical form, and obscurus). They are
sufficiently differentiated to need technical names, but in no
respect—in the external characters, in the skull, in the dentition—
is there a sharp “hard-and-fast” line between them :—
Tn the extreme east (S. China and Japan) we find a Bat (mippor)
of moderate size and with rather small teeth; the dentition, too,
has remained on a rather primitive stage of development; but the
horse-shoe and nasal swellings are very broad. Some of these
peculiarities, viz. the broad horse-shoe and nasal swellings, are
preserved in the Central Himalayan tragatws, but the general size
of the animal is increased, the skull and teeth very large, the
dentition more highly developed. This latte character reaches a
climax in the next form, regulus, from the N.W. Himalayas, but
at the same time the horse-shoe and nasal swellings are markedly
narrower; in this respect regulus evidently shows tendencies
towards the western races, as also might be expected from its
habitat.—These three Bats constitute what I call the ‘“ eastern”
races of ferrwm-equinum. The geographical line separating them
from the western races must be drawn somewhere between Masuri
and Gilgit, at the border between the Oriental and Palearctic
Regions. East of that line the individuals are generally larger,
with broader horse-shoe; the lateral mental grooves not rarely
fully developed; the tail on an average only 13 the length of the
lower leg.
Passing from Masuri (still regulus) to Gilgit, on the extreme
north-western, ‘ Palearctic” side of the Himalayas, we find a
form (proximus) with small and slender skull, narrower horse-
shoe and nasal-swellings ; which give it a decidedly ‘“ western ”
aspect, and contrast it with its eastern neighbour, vegulus ;
but it has retained the somewhat shorter tail characteristic
of the eastern races. The typical form has got rid also of this
reminiscence, but, as a matter of fact, also in this race now
and then, though rarely, individuals occur which ‘fall back” to
the shorter-tailed eastern stage. The typical form leads to the
generally smaller, extreme south-western race (obscwrus : Spain,
Algeria).
A closer study of these races, as compared with the Ethiopian
Rh. augur and Rh. deckeni, will throw some ‘light on the past
history of the ferrwm-equinum type (see the “ General Remarks”
on the simplex group, below, p. 118).
14a. RHINOLOPHUS FERRUM-EQUINUM NIPPON Temi.
Rhinolophus nippon Temminck, Mon. Mamm. 1. 8° monogr.
(1835) p. 30a; Temminck & Schlegel, Fauna Japonica (1842),
p. 14, pl. iii. figs. 1, 2; Peters, MB. Akad. Berlin, 1871, p. 312.
Rhinolophus ferrwm-equinum (partim) Dobson, Cat. Chir.
Brit. Mus. (1878) p. 119.
Diagnosis. Size moderate, horse-shoe very broad. Skull smail,
but with rather broad nasal swellings; tooth-rows very short.
1905. ] OF THE GENUS RHINOLOPHUS. 111
Details—(1) Compared with tragatus: On an average (as a
rule also absolutely) markedly smaller: forearm 57:2-59-3 mm.
(tragatus: 59-63); but the horse-shoe is, nevertheless, of
the same excessive breadth: 9-9°5 mm. (éragatus: 8°8-9°7),
Skull considerably smaller and narrower, but {(in conformance
with the broad horse-shoe) with rather broad nasal swellings:
comparatively as broad as in tragatus, but, owing to the smaller
size of the skull, not absolutely so. Teeth markedly smaller, the
tooth-rows shorter.
(2) Compared with regulus: Of approximately the same size
(or nippon rather smaller), but horse-shoe considerably broader :
9-95 mm. (regulus: 8:2-8°8). Skull generally smaller and
narrower, but nasal swellings, nevertheless, quite as broad as
in regulus (comparatively, therefore, decidedly broader). Tooth-
rows markedly shorter.
(3) Compared with the western races: The broad horse-shoe
prevents it from being confused with any of the western forms.
Colour. AS im adult individuals of Serrum-equinum from
Europe*. No quite young specimens examined.
Dentition (5 skulls). In two skulls p, is present on both sides;
in two (teeth unworn) on one side only; in one (teeth very
slightly worn) lost, but the alveoli not quite obliterated. p? is
present in all skulls examined. The cingula of the upper canine
and p* not only less completely overlap than is generally the
case in the other races, but in one skull the two teeth are very
slightly, in one quite distinctly, separated. his dentition is
decidedly more primitive than in the western neighbours of this
race, tragatus and regulus.
Distribution. S. China (Shanghai). Pt. Hamilton. Japan.
Remarks. 1 find the examples from Shanghai and Pt. Hamilton
(S. of Korea) indistinguishable from those from Japan.
146. RArNOLOPHUS FERRUM-EQUINUM TRAGATUS Hodgs. (Plate
IVe fie. 14a, 0, c,d.)
Rhinolophus tragatus Hodgson, J. A. 8. B. iv. no. 48 (Dec. 1835)
p. 699; Peters, MB. Akad. Berlin (1871), p. 312.
Rhinolophus ferrum-equinum (partim) Dobson, 1. s. ec.
Diagnosis. Size largest, horse-shoe very broad. Skull and
tooth-rows: the extreme.
Details —({1) Compared with nippon : see this form, supra.
2) Compared with regulus: Onan average larger, with markedly
broader horse-shoe (but no sharp line of separation, the maxima
* According to Temminck the fur of nippon is “plus long, plus abondamment
feutré, plus soyeux et moins lustré” than in ferrwm-equinwm from Europe, and the
colours “ différent également.” In the length and abundance of the fur I am unable
to find any tangible difference between nippon, tragatus, and ferrum-equinum. As
to the colours (two well-preserved skins: Fuji and Nikko), it is quite the same
as in darker individuals of ¢ragatus, and this again as im-fully adult individuals of
the typical ferrum-equinum ; laid side by side these Bats are indistinguishable in
colour,
ple MR. K. ANDERSEN ON BATS » [May 16,
of regulus-being equal to minima of tragatus). Skull generally
larger, and with broader nasal swellings.
(3) Compared with the western races: The large size, broad
horse-shoe, shorter tail, large skull, broader nasal swellings, and
longer tooth-rows prevent it, in most cases, from being confused
with any of the western forms.
Dentition. In one only, out of six pairs of mandibles, p, is
present on both sides; in two (teeth unworn, or very slightly
worn) on one side (alveolus disappeared on the other side); in
no less than three completely wanting, although the teeth are
either quite or almost unworn. A similar high development of
the upper teeth (eight skulls): p* present in five; completely
wanting, and alveoli disappeared, in three (teeth unworn or
slightly worn). Cingula of the upper canine and p* always over-
lapping. ‘This is unquestionably a higher stage than in nippon.
Distribution. Darjeeling. Nepal.
Technical name. Hodgson’s cotypes of Rh. tragatus (three
examples; Nepal) are in the British Museum.
14¢. RHINOLOPHUS FERRUM-EQUINUM REGULUS, subsp. n.
Rhinolophus ferrum-equinum Hutton, P. Z.8. 1872, p. 698.
Diagnosis. Size rather large, but width of horse-shoe moderate
only. Skull large and broad, with long tooth-rows, but narrow
nasal swellings.
Details. Compared with the western races: The large size,
combined with the short tail, will, in most cases, make it readily
distinguishable. The skull is, almost invariably, larger, the tooth-
rows longer.
Dentition (4 skulls). In none of the skulls examined could If find
any trace of the lower p,, although they all have the teeth unworn.
Tn two skulls p* is present, in two completely wanting. Cingula
of the upper canine and p* always overlapping. This is the
highest stage of dentition in any race of ferrum-equinum (in the
present group it is surpassed only by 4. acrotis, but this species
is an Ethiopian modification not of the ferrwm-equinwm type, but
of the affinis type).
Type. 3 ad. (in alcohol). Masuri. Collected and presented by
Capt. Hutton. Brit. Mus. no. 79.11.21.153.
Distribution. Almora. Masuri.
14d. RHINOLOPHUS FERRUM-EQUINUM PROXIMUS, Subsp. n. (Plate
IV. fig. 15.)
Diagnosis. Size moderate, horse-shoe very narrow, tail short,
Skull small and slender, with very narrow nasal swellings and
short tooth-rows.
Details.—(1) Compared with the typical form: Although being
of the same size as the larger and medium-sized individuals of the
typical form, proximus has a very short tail; in so far, it might,
very properly, be characterised as a “typical” ferrum-equinum
1905. ] OF THE GENUS RHINOLOPHUS. 113
which has preserved the tail of the eastern races (¢f. also its
geographical habitat); the horse-shoe is remarkably narrow.
The skull very small and slender; the nasal swellings narrow.
(2) Compared with obscurus: Larger, but proportionately with
narrower horse-shoe. The skull is even smaller and more slender
than in any individual of obscwrus I have seen.
(3) Compared with the eastern races: The small size, combined
with the very small horse-shoe, distinguishes it sufficiently. The
skull is smaller and, especially, more slender, the nasal swellings
narrower, than in any of the eastern forms.
Dentition (one skull). p, and p” present. Cingula of the upper
canine and p‘ overlapping. ‘This dentition is more in accordance
with that of the typical ferruwm-equinwm than that of regulus,
showing the “western” character of proximus (notwithstanding
the short tail), a conclusion borne out by the general external
aspect of this Bat, and the size of the skull and the tooth-rows.
Type. 9 ad. (in alcohol). Gilgit. Presented by Dr. J. Scully.
Brit. Mus. no. 81.3.1.10.
14 ¢. RHINOLOPHUS FERRUM-EQUINUM Schreb., TYPICUS.
Le fer-a-cheval Daubenton, Mém. Acad. Rov: Sci. Belg. 1759,
pp. 377, 382, pl. 15. fig. 4.
Vespertilio Ferrum equinwm (partim) Schreber, Siiugthiere, 1.
(1775) pp. 174, 188, pl. 62 (the two upper figures).
Vespertilio equinus (partim) P. L. 8S. Miiller, Natursyst., Suppl.
(1776) p. 20.
oe Ungula (partim) Boddaert, Elenchus animalium, i.
GU7S5) ape Gl
Vespertilio Ferrum equinum, a. major Gmelin, Linn. Syst. Nat.
. (1788) p. 50.
Vespertilio Hippocrepis (paxtim) Schrank, Fauna Boica, i. (1798)
. 64.
Lthinolophus uni-hastatus Geoffroy Saint-Hilaire, Descr. de
VEgypte, ii. (1812) p. 132; id., Ann. Mus. d’Hist. Nat. xx, (1813)
. 257, pl. 5.
Rhinolophus JSerrum-equinum var. germanicus et var. téalicus
Koch, Jahrb. Ver. Naturk. Nassau, 1862-63, pp. 522, 523 *
Phinolopha s ferrum-equinum (partim) Peter s, MB. Akad. Berlin,
1871, p. 810; Dobson, Cat. Chir. Brit. Mus. (1878) p. 119.
Rhinolophus libanoticus, conchifer, et rufescens ‘ Khrbg, et
Lichtst. Mspt.” Peters, loc. cit. (1871) (nomina nuda).
Diagnosis. Size moderate, horse-shoe rather narrow, tail long.
Skull rather small and slender, with narrow nasal swellings and
short tooth-rows.
** Koch’s two “varieties” of ferrum-equinum must have been based on too small
a material, or there must be some mistake in his statements. That individuals
from S. Europe, é. e., Europe 8. of the Alps (his “ var. italicus”’), should, generally
speaking, be larger than those from Europe N. of the Alps (his “var. germanicus”’),
is at all events not correct. The statement that var. germanicus is “iiber den
tticken mehr braungrau oder aschgrau gefarbt,” whereas var. italicus “stets in das
Rothliche neigt,”’ raises the suspicion whether Koch has not compared immature
individuals from Germany with fully adults from Italy.
Proc. Zoou. Soc.—1905, Vou. IT. No. VIII. 8
114 MR. K, ANDERSEN ON BATS [May 16,
Details.—(1) Compared with obsewrus : the subjoined particulars
will make the difference evident :—
59 specimens of the typical form have been examined from the
following localities :—Transcaspia (1); Euphrates Valley (3) ;
Syria (2); Galilee (2); Cyprus (2); N. Bulgaria (1); Trans-
sylvania (31); Hungary (1); Moravia (2); Dalmatia (2); Turin
(1); Genoa (1); Sicily (2); Switzerland (Tessin and Geneva * 7) ;
Tiibingen (1).
Forearm, in these specimens, on an average 57-5 mm. In no
less than 44, 7. e. 75 per cent., the forearm measures 5/7 mum. or
more (up to 60°3 mm.) ; in the remaining (and quite independent
of the locality) Jess than 57 mm. (down to 53-5 mm.).
Of obscurus 31 specimens have been examined from :—Troubate,
Hautes- Pyrénées (8); Cintra, Portugal (1); Madrid (3); Valencia
(12); Minorca (5); Algeria (2).
Forearm, in these specimens, on an average 55:5 mm. In no
less than 25, 7. e. 81 per cent., the forearm measures less than
57 mm. (down to 52°8 mm.); in the remaining between 57 and
58mm. Although the series is smaller than that of the typical
form, the facts here pointed out cannot be due to mere chance ;
the contrast is too well marked.
As a conclusion: in the typical form the forearm measures
generally 57 mm. or more; in obscwrus almost always less than
57 mm.; maximum of obscurus is but a trifle larger than the
average size of the typical form.
(2) Compared with the eastern races: the proportionately
longer tail prevents, in almost all cases, its confusion with any of
these races. The skull is rather easily discriminated from that
of tragatus and regulus (cf. measurements, p. 115), but I fail to find
any point by which to distinguish it from the Japanese nippon.
British specimens. 13 specimens have been examined. Yorearm
on an average 55°4 mm., i.e., British specimens of ferrum-equinum
are on an average of the same size as the extreme south-western
(Spanish) race, Rh. f. obscurust. Of the 13 specimens, 2 only
have the forearm 57 mm. long or more (up to 58 mm., quite as in
obscurus); all the others between 53°8 and 56:2 mm. These indi-
cations require, of course, verification by a much larger series §.
Dentition (11 skulls). In seven skulls p, is present on both sides
(teeth in very different stages of wear); in one, on one side only
(teeth worn); in three (teeth almost unworn, or much worn)
completely wanting (no alveoli). p* is present in all the skulls
examined, two of which are of very aged individuals. Cingula of
the upper canine and p' generally more or less overlapping, but
in two skulls separated by an extremely small interspace, This
dentition is almost exactly as in xippon.
* For the loan of some Bats from the neighbourhood of Geneva I am indebted to
M. Ch. Mottaz.
+ A very elaborate table of measurements of fourteen Spanish specimens was
kindly sent to me by Prof. A. Cabrera Latorre, Madrid. These are the only examples,
dealt with in this paper, not examined by myself.
+ Compare with this Rh. hipposiderus minutus, below, p. 142.
§ To keep the typical form uninfluenced by the smaller British individuals, I
exclude these latter from the table of measurements on p. 115.
OF THE GENUS RHINOLOPHUS. 115
1905.]
9-6 6-6
18 9.8
6ST &-ST
¢.9 6-9
gg g
GGL &.-IT
6-6 6
9-01 OL
GEG -& 86
&-16 &@
LE LG
AT &8T
GPL GET
Gh SBE
06 9T
L11 OL
S-1V LE
GE GL
61 ST
8& TE
8G 8.69
£.8 LL
GST 4-81
ST &1
GG 81
“UU “TUT
XV ULTL
SIMS P
‘susuttoods Te
*SNANISGO
OL 66
6 ¢.8
LL 9ST.
1.9 6-9
9 8-P
L600 1-61
6.6 ¢.6
It &.OT
8-86 4.66
G&L Il
G16 8-6
Iv VE
AT &-&T
CT $61
LUV ¥-68
606 LT
$<6L €.0L
L-8V 8E
GCE GLE
6:06 81
60F 8-7E
€.09 ¢.€¢
8:8 8.
8:91 FT
8-91 ST
8.66 1G
“UU “UU
‘XR | ULTT
“S]DYS TT
‘suoutloeds @g
‘snardhg
2.6
8:8
9
6.
G11
8-8
G6
GIL 01
6-6 6.96
ve g.1&
ZT 8.ST
LEt L&T
Ty 8.07
$-6T 9.81
L10 4.01
$07 8-66
$66 $.86
0G I-61
LE G96
8g 8.99
8 LL
S-7L ia
GST ST
6-16 8-06
“UU = “HU
“XBI ULIAL
TMS T
‘suoutoeds Z
“snmixord
L01 6.0L
1.6 6-6
GAT 4.91
49 19
9 1g
&I L-6L
GOL 4.6
GIT 4.01
L¥G L.&%
GPL 8-61
8-96 9.66
ge. 18
AT 8.91
401 GET
Fi i LCL
6.06 4-81
GEL 6.11
SEP 8.11
GE G0
16 &.6T
G8E ELE
09 «4.89
8:8 6.8
Z-S1 ST
TL4L 6ST
8.86 GG
“WUL = “WU
Xe “ULIN
LCE
‘suouloeds ip
“sinha
Z0L 6.01
6-6 6-6
8I 8.47
GL 1.9
LG 6G
G&L 8-61
IL 6.01
g.1T IL
L6 6.VG
€-71 €1
9-46 9-96
LE 8-VE
61 81
8-ST ial
6Lbp 8.87
GB G06
8-6 9-IT
LSP GV
SVE G&
6 9.06
600 GLE
€9 6g
4.6 8:8
8-41 G.9T
8-81 8-91
$76 8.16
“UUL = UU
Xe UTI
“ST[NAS 8
‘suauttoeds g
‘snp hpi,
8-6 6-6
6 €-8
8-91 8.ST
8-9 €.9
9 6.G
GGL 4.11
OL 9.6
6.0L GOT
L:86 6-66
GPL L.61
€96 G.PG
8.9€ Té
GLI 4.ST
SVL 4-81
€Sp 1-87
S.6L G8T
GL IL
TY §8-1P
GE 1G
16 §-6T
8.88 GLE
6.69 G.Lg
¢.6 6
8ST 61
ZL GST
8-66 P.66
“UU = “TU
“XBYL ULTAL
“SOAS G
‘sueuttoods y
‘uoddvu
"4904 TeMorT
DOD Ob OC COMOGUOO UOC ORCLOOO GOD.CO GCCOOo = Gye jedd
page sie BaUIT Te Ma [eseu jo WPL
eee ees “Yysue] peyiqiovidns =“
rr TIPIA OL{BUIOSAZ ce
Myce S OSvo-UIBIG JO YypIm
we aes proyseur
yg suey Te904 TRNAS
— q00KF
Foes Caen een cdnbA taddeecenodanioenacnoss TL
“oA
tA
“qedworjace qe
Soere oe ee .. SAI
_ledivoejout WP
s III
vIil
_ [edavovjour pre
TWIG WT
“s0Us-9s10y 2@ YI pvaiq &
: Y}SUET [2404 Boneeye O80 NT
doo sotsodo0bnDe opp O0O _Wapread qsoqvois 66
p\etabafatalstelatw(ulelsyeratsyalelsy>tsier " YP. UOT ‘SLB
‘sawoadsqns pun wmutnbe-un«zr1e; snydojouryyy fo spvawaimsnary
116 MR. K, ANDERSEN ON BATS [May 16,
Distribution. From Transcaspia and the Euphrates Valley
through Southern and Central Europe, exclusive of the Spanish
Peninsula.
14/. RHINOLOPHUS FERRUM-EQUINUM OBSCURUS Cabrera.
Rhinolophus ferrum-equinum obscurus Cabrera Latorre, Mem.
Soe. Espafi. Hist. Nat. ii. (1904) p. 257.
Diagnosis. Smaller than the typical form.
Detwils.—(1) Compared with the typical form: see above, p. 114.
(2) Compared with the Eastern races : the small size, combined
with the narrow horse-shoe, make it readily distinguishable. The
skull is apparently slightly smaller than in nppon.
Dentition (4 skulls). As in the typical form.
Distribution. Spanish Peninsula, with the Balearic Islands.
Algeria *.
General Remarks on the Rhinolophus simplex Group.
The place of origin.—Of all the existing forms, the Australian
Rh. megaphyllus is one of the most primitive in dentition. But
it is very unlikely that the Australian Continent has been the
place of origin of the group. Rh. megaphyllus is the only
Australian species of the whole genus; this might suggest
the assumption that it is an immigrant into the country,
vather than an ancient inhabitant: secondly, Australia is the
extreme eastern border for the group (as well as for the genus),
no species being known from the islands to the east of the
Continent; it would probably not be so, if Australia had been
a centre of dispersal for the group: thirdly, megaphyllus has at
least two characters which certainly are not primitive—the large
nose-leaves, and (probably as a consequence of that) the rather
broad nasal swellings: fourthly, megaphyllus looks extremely like
an enlarged, continental representative of the Lombok species,
Rh. simplex (just as Rh. rouwi is the larger, continental repre-
sentative of Ah. borneensis). These arguments seem to support
the conjecture that, not the Australian Continent, but the “ Indo-
Australian Transitional Tract,” now broken up into numerous
larger and smaller islands, and still inhabited by such. very primi-
tive forms as simplex, truncatus, nanus, celebensis, and borneensis,
has been the centre from which the group spread eastwards and
westwards.
Differentiation t.—The ancestral species seems to have divided
into two branches, an eastern and a western. In the eastern,
more primitive branch the sagittal crest does not reach quite so
far forwards as a point corresponding to the middle of the orbit ;
in the western the temporal fossa is comparatively a little wider,
and the sagittal crest produced forwards more or less beyond that
* The type of Rh. f. cbscwrus, in the Madrid Museum, is from Valencia, Spain.
As will be seen, I take the name:in a wider sense. Valencia specimens were
separated by Prof. Cabrera, as a distinct subspecies, mainly on account of a difference
in the ratio between the length and breadth of the horse-shoe. In a large series of
ferrum-equinum from Europe and W. Asia there is, however, no small, and quite
ndividual, variation in this respect. + Compare the diagram on p. 120.
1905.] OF THE GENUS RHINOLOPHUS. ITE
point. The geographical line separating the two branches coin-
cides with the line separating the ‘‘ Austro-Malayan” from the
“Tndo-Malayan” subregion (Celebes being a part of the latter).
The eastern branch is, as yet, represented by four known species
Rh. simplex, megaphyllus, truncatus, and nanus. The western by
all the others.
The further evolution, from borneensis to ferrum-equinum, has
been discussed above, and is summed up, in the briefest possible
form, in the subjoined diagram (p. 120). But the sketch of this
group would be deprived of some of its most instructive features
if the Ethiopian species were left quite out of consideration. They
belong to three closely related types :—
(1) Ethiopian species of the borneensis-stheno-rouxi type.—
Far south in Africa, in Bechuanaland and Mashonaland, we find
two small species, Rh. denti and simulator, described quite
recently *. They are the Ethiopian representatives of the borneen-
sis type: the same general shape of the skull; essentially the same
dentition; the same parallel-margined sella, with a faint or
almost imperceptible constriction at the middle; the same style
of connecting process; the same proportionate length of the
fourth and fifth metacarpals ; even the same length of the tail, &c.
But there are, in these species, three characters of especial in-
terest, because they enable us to determine still more precisely
their phylogenetic place: the nasal swellings (side view) are more
projecting than in borneensis, but less than in stheno; III. is
lengthened, and IV.’ somewhat shortened, as in this species,—
proving that they have originated from a Bat which had already
traversed a part of the distance separating borneensis and
stheno. The dentition is on a slightly higher level than in
borneensis and stheno, the only difference being that p”, although
still in the tooth-row (as in the Oriental species), shows a distinct.
tendency fowards the external side.:
In the extreme south of Africa (Cape Colony) we find a species,
Rh. capensis, which, quite superficially, looks like an enlarged
Rh. simulator. It is an African representative of Rh. rowxi: the
skull is to such a degree that of roux? that it would be hard to find
any tangible difference, even the measurements being practically
the same (on an average smaller than in rowwi); the nose-leaves
(sella, process, lancet) are the same; proportionate length of
fourth and fifth metacarpals, of tail and tibia, the same. But
the dentition is somewhat more advanced: p is generally ex-
ternal, but still, very often, a quite distinct interspace between
the canine and p‘ indicates its former place; IIT.° is somewhat
lengthened. In short: Rh. capensis isa “Rh. rowxt ” which in
the wing-structure has taken a course towards, in the dentition
very slightly beyond, the affinis-stage.
(2) Ethiopian species of the aftinis-type.—On the coasts of the
Red Sea we find a species, Rh. clivosus, first made known by
Cretzschmar from Mohila in Arabia; I have seen examples from
* Thomas, Ann. & Mag. Nat. Hist. (7) xiii. (1904) p. 386; Andersen, op. cit. (7)
xiv. (1904) p. 384.
118 MR. K, ANDERSEN ON BATS [May 16,
the African coast of the Gulf of Aden. Jé is the closest existing
relative of the Himalayan Rh. affinis: the same shape of the
skull; the same shape of the sella, of the connecting process, of
the ears; the same structure of the wings (also the same lengthening
of III.*); the same proportionate length of the tail. But it is
more advanced in dentition : p, is not only external (as in affinis),
but very often lost; p*, which in affinis is still in the tooth-row,
is in clivosws external and very small. In short: Rh. clivosus is
a“ Rh. affinis” with ferrwm-equinum dentition.
The clivosus type has found its way very far into the Ethio-
pian Region. kh. darlingi*, from Mazoe to Angola, is a
modification of this type (as proved by the skull), differing from
clivosus in the more pronouncedly pandurate sella, the much
broader horse-shoe, the much smaller ears, and, by far the most
interesting, i the shortening of the third metacarpal. This
last peculiarity is the same as that pointed out above, under
th. ferrum equinum: in the wing-structure Rh. darlingi differs
from “h. clivosus quite in the same way as Lh. ferrwm-equinum
from Kh. afinis. It is a suggestive fact to find this peculiarity so
exactly copied by the South-African species.
Kh. acrotist, from Egypt and Erythrea, is, externally, very
similar to Ph. clivosus; also the wing-structure is the same. But
the tendency, in elivosus, towards an obliteration of p, and p* has
been further developed by acrotis: it has completely lost both of
these teeth, thus being, in this particular respect, the highest
member of the whole group. h. acrotis is a “ Rh. affinis” with
a dentition still more advanced than in ferrwin-equinwm regulus.
(3) Hthiopian species of the ferrum-equinum type.—Rh. augur £
is widely distributed, in several geographical races, over the
southern part of the Ethiopian Region: the Orange River tract,
Natal, the Lower Zambesi. Jt is the closest existing relative of
Eh. ferrum-equinum ; the skull, the nose-leaves, the wing-structure
are the same; but the dentition is a trifle less advanced, and the
ears are smaller.
We find the ferrwm-equinum type also further northwards in
Tropical Africa (Mombasa): Rh. deckent; the skull and dentition,
and all external characters of any importance, are as in augur;
but the horse-shoe is broader.
The area occupied by these two Ethiopian representatives of
the ferrum-equinum type extends, broadly speaking, from the
Orange River to Mombasa. It is completely cut off from any
other region inhabited by that type of Bat; it forms a large
enclave bordered to the north and west by vast tracts where no
representative of ferrwm-equinum occurs; we must go so far
away from South and Equatorial Africa as the Euphrates Valley,
Syria, and Algeria before meeting with the closest relatives of
those Ethiopian species. Thus the question suggests itself, by
which way the ferrwm-equinum type reached Tropical Africa,
and why its range there is now so peculiarly insulate. When
* Andersen, Ann. & Mag. Nat. Hist. (7) xv. (1905) p. 70. ~
+ Andersen, op. cit. (7) xiv. (1904) p. 454; (7) xv. (1905) p. 73.
{£ Andersen, op. cit. (7) xiv. (1904) p. 380.
_ 1905. ] OF THE GENUS RHINOLOPHUS. 119
trying to answer this question, the following facts must be borne
in mind :—Firstly, that all paleontological evidence is wanting,
which detracts from what we know about the affinities and
distribution of the now existing representatives of these Bats.
Secondly, that the ferrwm-equinwm type is unknown in Egypt,
as well as in the whole region of the continent north of British
East Africa, and that we have no reason, of any kind, to believe
that it ever existed there. Thirdly, that we have to account not
only for the distribution of Rh. augur and deckeni as compared
with the other members of the same section of the genus, but
also for the presence in Tropical Africa of representatives of the
borneensis and rouxi types, and, be it noticed, representatives
which, without exception, are more highly differentiated than
their Oriental allies. These facts, so far as they go, seem to
allow of no other satisfactory explanation than this: the im-
migration of these Bats, as of so many other Oriental types in the
Kthiopian fauna, has taken place by way of the broad tract of
land which, as commonly supposed, in a geologically late period
connected Southern Asia with the African continent. In the
case of the ferrum-equinum type this explanation would make
it evident, why it, though vastly distributed in South and
Equatorial Africa, is absent from the whole north of the con-
tinent with the exception of the extreme north-western (Medi-
terranean) coast-region, which it, no doubt, has reached from
South-western Europe, since the Algerian race is subspecitically
indistinguishable from the Spanish form (A. f. obscurus).
In the case of the borneensis and roux types it would account
for the fact that they are common to the Oriental and Ethiopian
Regions, but absent from the whole of the Palearctic Region.
And it would also account for the presence of the genus Rhino-
lophus in the Ethiopian Region, for, as I shall have to show later
on in this paper, all the Ethiopian representatives of the genus
are undoubtedly of Oriental origin.
Such being the case, | am able to draw up the following
rough sketch of the history of Rh. augur, deckeni, and their
Oriental and Palearctic relatives :—
The ferrum-equinwm type has originated somewhere in South
Asia; we find there the long series of more primitive forms
which lead up to that type, whereas in the whole of the Ethiopian
Region there is not any species with which it can be brought in
genetic connection. The ancestral ‘“ferruwm-equinwm” broke up
into three branches: a south-western, a western, and an eastern.
The south-western branch, which had spread directly from South
Asia into the Ethiopian Region, was cut off from the main stem
by the submergence of the connecting tract of land, and is now
differentiated into two species—the southern Rh. augur and the
northern Rh. deckent. Both of them have retained at least two
“ancient” characters: a slightly more primitive dentition (the
upper canine and p* often more or less separated; p* sometimes
half in row*) and a short tail. To the external difference
* 35 skulls of Rh. augur (all races) have been examined :—In 17 the upper canine
and pt are more or less separated, in 7 in contact, in 11 more or less overlapping
120 MR. K, ANDERSEN ON BATS [May 16,
between these two Ethiopian species, viz. a broad horse-shoe in
deckent and a narrow one in augur, we have a parallel in ferru-
eguinum: a broad horse-shoe in nippon and tragatus, a narvew one
in the other races. The western branch spread over South and
Central Europe: the dentition slightly more advanced, the tail
lengthened. The third branch is now represented by what I
have called the Eastern races of ferrwm-equinum; all of them
have retained the short tail; mippon (which, so far as the
dentition is concerned, has remained on a relatively less advanced
stage) leads through fragatus to regulus, in which the dentition
has reached the highest stage of development found in any race
of ferrum-equinum.
According to this the mutual affinities of the species of the
simplex group might be expressed as follows? (the Ethiopian
species are marked with an asterisk) :—
*deckeni.
SUUgur.
SS
\ eee nen. *acrotis.
*darlingt.
/
/
xv. = /
*clivosus.
thomasi.
“capensis.
wy
stheno
SS al | , *denti.
LOUKT ve / |
nereis.
*simulator.
malayanus. |
|
|
virgo. ~borneensis.
celebensis.
NENUS. |
|
|
truncatus. |
|
megaphyllus.
Y
SS
eae ol
|
|
O
(Jepidus-group_)< —
each other at base; in 4 pis half in row. To this latter I find no parallel in any
specimen of ferrwm-equinum (all races) I have seen, and in 4 skulls only, out of 33,
there is a more or less distinct remnant of the interspace between the canine and p‘.
Of Rh. deckeni I have seen one skull only; the dentition is as in many specimens
of Rh. augur: c and p! separated, p2 external.
t I give the diagram the form of a genealogical tree, only because it is convenient to
1905. ] OF THE GENUS RHINOLOPHUS. 121
Il. Tat RA#NOLOPAUS LEPIDUS GROUP.
Diagnosis. Basioccipital, between cochleex, not unusually
narrowed, Posterior connecting process projecting and pointed.
I include in this group :—(1) All the forms with projecting
connecting process comprised by Dobson under the technical name
“Kh. minor” ; their close relationship is unquestionable; their
differences will be pointed out below ; (2) Rh. acuminatus and its
allies, which are scarcely more than giant forms of the lepidus-
type; (3) the Rh. blasti and (4) Rh. ewryale sections, peculiarly
modified Ethiopian and W. Palearctic representatives of the
subbadius-type. ‘The two former sections only will be reviewed
below ; the two latter will be briefly mentioned in the “ General
Remarks” on the group (p. 135).
Text-fig. 22.
c d
Side views of nose-leaves, showing the principal forms of the connecting process
in the Rh. simplex group (a) and the Rh. lepidus group (8, ¢, d).
a. Rh. borneensis typicus; b. Rh. cornutus pumilus ;
c. Rh. monoceros ; d. Rh. empusa.
As this is a first attempt to disentangle the many different
forms hitherto confounded with MHorsfield’s Rh. minor, the
following preliminary remarks are necessary, as a general
guidance :—
The first of the above-named sections (the “‘ lepidus-section ”),
viz., all the small Oriental and EK. Palearctic Rhinolophi which
have the connecting process projecting and pointed, fall into three
show, at a glance, the probable interrelations of the species. As sufficiently emphasised
in the foregoing pages, I am far from being of opinion that ferrwm-equinum is derived
from the now-existing affinis (or capensis from rouxi, or stheno from borneensis, &c.).
But ferrum-equinum has originated from a Bat which had the more essentiui
characters of affinis (besides several others, unknown to us). The technical names
in the diagram are, in other words, to be taken, not in their strict specific sense, but
as names of the sections (“ types,” “ branches”) of which the species, as we now see
them, are the surviving representatives.
122 MR. K. ANDERSEN ON BATS [May 16,
natural groups (sub-sections): the lepidus-type, the minor-type,
and the subbadius-type. ,
I propose to characterise these types at once. It will enable
me to confine the diagnoses of the various species to the points in
which they differ from the subjoined general characteristic.
(i) The lepidus-type—Chief characters : skull larger, width of
braim-case about 7-7-7-8 mm.; connecting process (in side view)
projecting as a small, erect triangle (not curved forwards as a
sharply pointed “ horn ”).
Description, based on Rh. lepidus (Wynaad, Mysore, Indian
Peninsula).—Supplementary leaflet as in simplex and its allies.
Horse-shoe not completely covering the upper lip; a small tooth-
like projection on either side of the median notch; front border
sometimes, not always, slightly crenulate (individual variation).
Sella decidedly broader at base than at summit, slightly, but quite
distinctly, constricted at middle, narrow at summit: there is a
tendency towards producing an almost subacute summit to the
sella (compare with this the borneensis-type : sella broadly rounded
off, or even truncated, at summit); height of sella 3-2 mm.;
width at base, at constriction, and at summit: 2, 1:8, and 1:2 mm.
Connecting process projecting as an acute, sometimes only sub-
acute, triangle beyond the summit of the sella. Lancet strongly
hastate, about 3 mm. long. Three mental grooves. ;
Ears much as in the celebensis-borneensis type, but somewhat
more blunt-tipped. .
Wing-structure quite primitive, 7. e. no lengthening of III.’,
this phalanx being always less, and very often much less, than 14
the length of III.'; no shortening of the third metacarpal ; fourth
metacarpal slightly the longest (individually it may fall short of
the fifth by a fraction of a millimetre). This wing-structure is
perfectly like that of Rh. simplex and its allies.
Tail slightly longer than (individually equal to, or a trifle
shorter than) the lower leg. Plagiopatagium inserted on the
ankle, slightly above or below.
Skull. General shape: the simplea-borneensis type, but consider-
ably smaller, with smaller teeth, and shorter tooth-rows. The
orbital cavities (the confluent orbital and temporal fosse) are
shorter and narrower than in borneensis, the zygomatic arches,
therefore, less projecting laterally, making the zygomatic width of
the skull, as a rule, only equal to, or even a trifle smaller than,
the mastoid width. These peculiarities combined make, as a rule,
the skulls of the species of the lepidws-type rather easily distin-
guishable from those of the borneensis-type-—Arrangement of the
nasal swellings, essentially, as in borneensis. Palatal bridge,
on an average, somewhat less than 4, but more than + the length
of the maxillar tooth-row.
Denxtition. Position of p, (in, or external to, the tooth-row)
“ vacillating.” _p? invariably in the tooth-row. ‘This dentition is
precisely as in simplex-borneensis.
Species. Rh. lepidus, monticola, refulgens.
1905. ] OF THE GENUS RHINOLOPHUS. 123
(2) The minor-type—Chief characters: skull, also propor-
tionately, very small; width of brain-case about 6°8-7°2 mm. ;
connecting process of the lepidus-type (text-fig. 22, b, p. 121).
Deser iption, based on 2h, cornutus pumilus (Loo- choo Islands).—
Nose-leaves as in the lepidus-type, but: sella narrower; height
about 2°8mm.; width at base, at constriction, and at Semen -
1:7,1°5, and 11mm. Connecting process slightly higher, slightly
more acute, but of the same general shape.
The other external characters as in the lepidus-type.
Skull. Considerably smaller; nasal swellings narrower. Teeth
smaller,
Dentition. As in lepidus.
Species. Rh. minor, cornutus, “ minutus” (Miller, nec Montagu),
gracilis.
(3) The subbadius-type.—Chief character: connecting process
long, slender, very sharply pointed, curved forwards, projecting
like a small, curved “ horn” (text-fig. 22, ¢, p. 121).
Nose-leaves, and other external characters, much as in nwn07,
but connecting process as described above; lancet more or less
approaching the shape of an equilateral triangle; length of sella
about 2°4 mm.; width at base, at constriction, and at summit:
1:7, 1:3, and 0:9 mm.
Skull. To judge from fragments, and the skull of a quite young
individual, much of the minor-type.
Dentition. As in lepidus and minor.
Species. Rh. subbadius, monoceros.
15. RHINOLOPHUS LEPIDUS Blyth.
Rhinolophus lepidus Blyth, J. A. S. B. xiii. pt. i. (June 1844)
p. 486.
Rhinolophus minor (partim, nec Horsf.) Dobson, Cat. Chir.
Brit. Mus. (1878) p. 114.
Diagnosis. Skulland external characters: lepidus- type. Larger:
forearm 41°8-42 mm.
Details. This species difters from Rh. monticola in its broader
nasal swellings, larger size, and considerably longer metacarpals.
Colour. Ad., skin: Ganges Valley ; teeth almost unworn; two
¢ ad., in alcohol: Wynaad ; teeth unworn. General colour above
between “ wood-brown” and “ cinnamon,” lighter on the anterior
part of the back; base of hairs very light “ ecru-drab”; under side
“‘ wood-brown ” or tending to “ ecru- drab. a
Dentition (three skulls). p, external. p, and p, separated, or
almost or quite in contact. p* in the tooth-row, with a well-
developed cusp, pointing inwards.
Measurements. On p. 125.
Distribution. Indian Peninsula: Wynaad (Mysore); Ganges
Valley.
Technical name. I identify this Bat with Blyth’s Rh. lepidus
(to which I find no reference in Dobson’s ‘ Catalogue’), for the
following reasons :—(1) lepidus belongs to this group of the genus,
124 MR. K. ANDERSEN ON BATS | May 16,
as proved by Blyth’s description of the connecting process, “ still
more developed [than in his Rh. subbadius| and obtusely angulated
behind m3 the words “still more developed” mean, evidently,
‘““bigeer,” not extremely slender as in suwbbadius. (2) The types
were “ probably obtained in the vicinity of Calcutta”; one of the
specimens in the British Museum is from the Ganges Valley,
therefore in all probability from the very same locality as the types.
(3) The colour, as described by Blyth, agrees very well with that
of the specimens before me. (4) The forearm was stated to be
“13 inches” (41°5 mm.); the longest finger “21 inches”
(57°2 mm.); the tibia “above 3 inch” (above 16 mm.) ;
these measurements are as in the British Museum examples:
forearm 41:8-42 mm.; third finger 58°3-59'1 mm.; lower leg
16-17 mm. These facts leave no room for doubt as to the
identification of 2h. lepidus.
16. RHINOLOPHUS MONTICOLA, sp. n.
Rhinolophus petersi (errore*) Hutton, P. Z.8. 1872, p. 700.
LRhinolophus minor (partim, nec Horsf.) Dobson, wt supra.
Lhinolophus subbadius (non Hodgs., nec Blyth) Scully, J. A.S. B.
lvi. pt. i. (1887) p. 244.
Diagnosis. Skull and external characters: lepidus-type. Smaller:
forearm about 37°5 mm.
Details. This species differs from /h. lepidus in its narrower
nasal swellings, somewhat smaller size, and considerably shorter
metacarpals. The horse-shoe seems to be narrower.
Colour. Unknown (faded in alcohol).
Skull. As in Rh. lepidus, but somewhat smaller, and with
narrower nasal swellings.
Dentition (two skulls, one belonging to a quite young individual).
p, im row (skull of an adult), or external (young). p, and p, well
separated, or almost in contact. p* in row; a distinct cusp,
pointing inwards.
Measurements. On p. 125.
Type. & ad. (inalcohol). Masuri. Collected and presented by
Capt. Hutton. Brit. Mus. no. 79.11.21.151.
17. RHINOLOPHUS REFULGENS, sp. n. (Plate IV. fig. 16a, 5, c.)
Diagnosis. Skull and external characters, essentially of the
lepidus-type. But brain-case somewhat higher in front, making
the anterior slope of the sagittal crest, towards the postnasal
depression, somewhat more abrupt. Forearm 40°6-41:5 mm.
Details. Very nearly of the same size as 7h. lepidus, but meta-
carpals, also proportionately, somewhat shorter; tibia shorter.
The horse-shoe is, if anything, shghtly broader.
* There is no doubt that this is anaccidental error. Prof. Peters (who determined
Hutton’s Bats) cannot, possibly, have identified the specimen here under considera-
tion (forearm 37°5 mm.) with “Rh. petersi” (forearm of type 51 mm.). As already
pointed out above (p. 97, footnote), the labels must have been confused; the name
“ Rh. petersi” was, probably, intended for Hutton’s examples of Rh. noua’.
1905. ] OF THE GENUS RHINOLOPHUS. 125
Colour. Q ad., skin; Perak; March; teeth almost unworn.
Very different from Rh. lepidws. General effect of the colour of
the upper side: a dark shade of “‘ Prout’s brown” with a tinge of
‘“‘hair-brown.” On closer examination the fur of the upper side
proves to be composed of two kinds of hair : longer, thinner, straight
hairs, quite black; and somewhat shorter, crinkled hairs of a
‘“‘hair-brown” colour; the mixture of the colours of these two
kinds of hair produces the general effect. Base of hairs of wpper
side not lighter coloured. ‘The fur of the upper side has a silvery
reflection (iridescence). Under side between ‘“ broccoli-brown ”
and ‘“hair-brown.” <A. spirit-specimen from Selangor (¢ ad.,
apparently the same age) is of the same colour.
Skull. In addition to the characteristic in the diagnosis: the
“maxillary width,” across the antero-external corner of m°* (a
character subject to exceedingly small individual variation in the
species of the lepidws-section) is somewhat larger, giving this part
of the skull a somewhat broader aspect: 6°5-6°7 mm. ; in lepidus
62mm. Gap in front between the maxillary bones somewhat
larger.
Dentition (two skulls). p, external. p, and p, almost or quite
Measurements of Rh. lepidus, monticola, and refulgens.
| |
Rh. lepidus, Rh. monticola.| Rh. refulgens.
|
| |
3 specimens, 6 ad. | 2 specimens,
3 skulls. Type. 2 skulls.
| Min. Max. : | Mm, Max.
mm. mm. mm. | mm. mm.
Ears, length .. somnoo smal! — cl) TG iii | 15:7
iden greatest breadth... séageo|), ald, pe) ue Herel |
| Nose- leaves, total length... a 115 12 ae Paes |
6 breadth of horse-shoe| 7 72 P62 Raaebee Asia. pas
lMoresean FARR SHE nee aloe ee Sn Ae | 375 40°6 41°5
| 8rd metacarpal.......0..s0..| 808 3b2 | 28:7 | 28'3 2072
PUL erent: ecw. ay MO Be TS 10°9 | aORSS iis
SEZ enn. ere kee eh TO Seog 14:2 142 15:3
4th metacarpal.....ccccccees| BL B12 | 28'8 | 29:2 30:2
AES cuss cde cna seu ans or aaem ent crt ends 9 92 83 85 85
ATR iest a eee De Aenean essere {oO 10°2 9°8 | 95 10
5th metacarpal... PUR calm Oo OTE TOL ONt S| 28 28°8 29:7
Vets Ge eis eke. Hada ad OSU LOn Ms | 92 ie RS
AOA cain do nian nina cee rene rer Pee oaiceel| wr ees eet oats a 9°8 | 1@ Lore,
| Tail “dbase usage nadpadeae sadeetin oeccee al Lees 18°3 Ae | AIG 1)
EOE SEFC wbosorconsesegpasemaensanenal| LGRS “aly? | 15°3 LISS) NG
| Foot . ERR RE 83 87 ate 8:3
| Skull, total length La dens aesneee Wye : 16°8 We} aR
» mastoid width .. ‘ 26 81 Ses Sige
»» Width of brain-case ......... ou a se dS
ry ASERONTEND TFGIN S55. 500 ono nee Silents 8-2 | 3
» supraorbital length......... 45 5 | 44 | BS &
width of nasal swellings. 5 5 4:5 | 2 ede ass
“naitle See rata cet GMO cota rg es a Cee LI 11 | 114 11°8
(nUnnpersbeetiteen, menace err cncen et, GiOMe Gr 63 le GS GS
ee tac Heel MOL 7 id 68 bo GQ gal
{
126 MR. K. ANDERSEN ON BATS | May 16,
in contact. p* in row; a small cusp, pointing inwards. In one
specimen there is an extremely narrow space between p? and p*
(the former place of p’).
Measurements. On p. 125.
Type. 9 ad. (skin). Gunong Igar, Perak, 2000 ft.; March
1898. Presented by A. L. Butler, Esq. Brit. Mus. no. 98.11.29.2.
Distribution. Malay Peninsula: Perak; Selangor.
18. RuatNnoLorHus minor Horsf.
Rhinolophus mimor Horsfield, Zool. Res. Java (1824), pl. [7],
figs. C, D.
Rhinolophus pusillus Temminck, Mon. Mamm. ii. 8° monogr.
(1835) p. 36, pl. 29. fig. 8, pl. 32. figs. 22, 23; Peters, MB. Akad.
Berlin, 1871, p. 309.
Rhinolophus brevitarsus Blyth, Cat. Mamm. Mus. Asiat. Soe.
(1863) p. 24 (nomen nudum) (“ vicinity of Darjeeling ”).
Rhinolophus minor (partim) Dobson, wé supra.
Diagnosis. Skull and external characters: minor-type. Ears,
tail, and tibia shorter. Forearm 37-38 mm.
Details. This species differs from Rh. cornutus by the shorter
ears, tail, and tibia (ef. measurements). The forearm is, at least
on an average, shorter.
Colour. 3 ad., skin; Darjeeling; November; teeth unworn.
General effect of the colour of the upper side very much as in
Rh. refulgens, though perhaps not quite as dark; base of hairs
light, ‘‘ecru-drab”; under side “ ecru-drab,” darker on the hinder
belly and flanks.
Dentition (three skulls). p, in row, almost in row, or external.
p, and p, well separated, or almost in contact. =p? in row; a
small cusp, pointing inwards.
Measurements. On p. 128.
Distribution. Darjeeling. Siam. Java (ef. remarks below).
Technical name. Horsfield’s type of Rh. minor is in the British
Museum.
Rh. pusillus* —The figure of the head of Rh. pusillus, as given
by Temminck, proves that he had before him one of the small
species of what is here called the lepidus group (shape of connect-
ing process, of sella, &c.). The only question is, therefore, to
which species the name pusillus belongs. It would seem to be
settled, beyond doubt, by Temminck’s statement that the types
were brought from Java. But Dobson, who examined these types
in the Leiden Museum, gave the rather astounding information
that they are ‘ undoubtedly specimens of 2h. hipposiderus” ! +
There is only one answer: if so, an interchange of labels has
* Temminck, ut supra; Dobson, Cat. Chir. Brit. Mus. (1878) p. 117; id. Rep.
Brit. Assoc. 1880, p. 175; Peters, MB. Akad. Berlin, 1880, p. 28.
+ This is the source of the statement that Rh. hipposiderus should occur in Java;
there is no other foundation. The range of Rh. hipposiderus has its extreme eastern
limit in Gilgit (N.W. Himalayas); there is not a single reliable record of that Bat
from the whole of the Oriental Region; and the species therefore cannot possibly
turn up again in Java.
1905.] OF THE GENUS RHINOLOPHUS. 127
taken place in that Museum; for the Bat figured and described
by Temminck as pusillus was certainly no hipposiderus ; among
all the small Rhinolophi existing it would be difficult to find a
stronger contrast to Rh. pusillus, in the shape of the connecting
process, than Rh. hipposiderus.
Remarks. From Java I have seen one old skin only (the type)
and a fragment of the skull, representing the nasal swellings and
the teeth. It is, of course, not sufficient to prove that the Java
Bat is in all particulars identical with that from Darjeeling; but
the nasal swellings, the teeth, the connecting process, the horse-
shoe, as well as the measurements of the wings and tibia, are the
same, If not identical, they are, at all events, extremely closely
related.
19. RHINOLOPHUS coRNUTUS Temm.
Diagnosis. Skull and external characters essentially as in
Rh. minor. ars, tail, and tibia longer. Forearm 38:8-41 mm.
Details. Cf. Rh. minor.
Distribution. Loo-choo Islands, and Japan proper.
Geographical races. There are two races of Rh. cornutus, slightly
differing in the general size, in the length of the tail and tibia,
and in geographical habitat.
19@. RHINOLOPHUS CORNUTUS PUMILUS, subsp.n. (Plate IV.
fig. 17 a, 6, c.)
Rhinolophus minor (non Horsf.) Bonhote, Nov. Zool. ix. (1902)
p. 626.
Diagnosis. On an average smaller: forearm 38°3-39°7 mm.
Details. See table of measurements, p. 128.
Colour. $ ad., 9 ad., skins; March; teeth unworn. Fur
strongly bicoloured, 7. ¢. base of hairs strongly contrasting with
the tip. General effect very much asin the adult Rh. hipposiderus.
Upper side, anteriorly almost ‘“ broccoli-brown,” posteriorly next
to ‘‘ Prout’s brown”; base of hairs extremely light, almost white
with a tinge of “ ecru-drab.” Under side “ ecru-drab,” darker on
the flanks.
Skull. Quite of the minor-type. The teeth seem to be a mere
trifle smaller.
Dentition (three individuals). p, external; p, and p, completely
in contact. p* in row, but the space between the upper canine
and p‘ narrower than in the lepidus-type and Rh. minor; cusp
of p* so extremely minute as to be scarcely observable (teeth
unworn), and the tooth itself a little reduced in size.
Type. Q ad. (in alcohol), Okinawa, Loo-choo Islands, March
16th, 1902. Presented by the Hon. N. C. Rothschild. Brit.
Mus. no. 2.10.7.18.
Distribution. A skin (skull very incomplete) from Foo-chow
(Swinhoe leg.; Tomes Collection) seems to be referable to this
form.
128 MR. K. ANDERSEN ON BATS [May 16,
196. RurNoLornus cornutus Temm., TyPricus.
Rhinolophus cornutus Temminck, Monogr. Mamm. ii. 8° monogr.
(1835) p. 37; Temminck & Schlegel, Fauna Japonica, p. 14
(1842) pl. 3. figs. 38,4; Peters, MB. Akad. Berlin, 1871, p. 309.
Rhinolophus minor (partim, nec Horsf.) Dobson, ut supra.
Diagnosis. On an average larger: forearm 39:2-41 mm.
Details. See table of measurements, below. To judge from
three spirit-specimens, the plagiopatagium is inserted alittle
higher up on the tibia (1-3 mm. above the ankle) than in the
foregoing forms of this group.
Colour. (1) Tsu-sima: ¢ ad., in alcohol, unfaded ; September;
teeth unworn. As Rh. c. pumilus. A young individual, from
Tsu-sima, is still considerably darker.
(2) Japan proper: one skin, three spirit-specimens ; teeth un-
worn. Very different; extremely like Rh. lepidus, if anything
still a trifle lighter.
Skull. Quite of the minor type; measurements shghtly larger.
Dentition (five skulls). p, almost in row (two), or external
(three). p, and p, well separated (two), or almost in contact
Measurements of Rh. minor and cornutus.
|
|
Rh. minor. Rh. cormutus.
|
|
|
|
|
|
|
| pumilus. f. typica.
3 specimens, | 3 Specimens, | 6 specimens,
3 skulls, || 2 skulls. 5 skulls.
Min. Max. } Min. Max. | Min. Max.
| mm. mm. || mm. mm. / mm. mm.
Warsslen sthie ae nccs. ate eee mee || belles re a lG sae IG 175
oy SAREEHSSH LREACHN — oosccyoeeoncooanel| aac boa) if) lees} Bi 12 13
Nose-leaves, total leneth ............... ay eee, ll wd ade Tigi} aR
5 breadth of horse-shoe ...|_ 27 an aenG so ant 6°4 67
Forearm Sty SoRDHME RABE Raacia eRe So NM Anal ARES 38 | 38:8 39°7 39:2 Ad
Srdimetacanpal We.) 268) 275) || 97-70 og-F 28:2 29:8
IOUT ceaogn epbenaneP oases soanepke treet meer tte C0) LOS) 9) LOA sl Seige
eee Meteo an tee eel TS 14°5 | NERY 1Be2) 14 14:8
| 4HEIN TOEAGEMYTRM oo nocoonconsveoneseovaereenas| PEF 8 jl Gia” Bers 288 307
f LY ee ean 78 85 8 87 85 9
NV hee eet ret cae ee cee oe Bit 5 de 9 98 87 9-2 99 10:3
Sth metacarpal.......... 268 28 PHT PASS) 29 30°9
BV ee Rec saneneee cs 88 9 9 95 91 SF
VEC SIAS AT CNN) en teh iy Tak soils 88 9°8 85 9:2 10:2 11:3
| satel aero gsctises yar tapas le tera teesedere pl apelin ee) Ke 18 nae 21 22
Mowerblea ae aay nee ly een Das NGA eA} 178 184
ILO O Lenny eaten eet ects eee ey cic, ca eee 8 sas Sion ne
[STUD HOA MEME coocedenncssonnsarawece.| SCH WEES aaa ef clk 16 17
| gy TROSOWGL TPOKAN son ococcsannarcencccl 78 LT ed 78 8 8:2
Pa WBLOh Vode lop P ITER Gy sauneonanene ll 7 aaa 72 a 7-2
5 AVEROMTENING GRAHAM 35 caccoscno sao ene 8 cate | dw eate 79 78 8
» Supraorbital length............... 4 4c1 38 4, AS 47
> _ width of nasal swellings......... 4 42, Ba Ay. 4. AD
Mandiblewcntcs ice ener, Ot ame Ose mee OMe 105 112
Wippentechlin 24s eit ee ke See ee 5:9 6 57 57 6 63
Wowersieebliges GAGs ae Ae rere 6:2 63 6 61 6:2 6°8
1905.] OF THE GENUS RHINOLOPHUS. 129
(three); in none, completely in contact. p® in row; a well-
developed cusp, pointing inwards. Upper canine and p' widely
separated ; in one skull there is a small interspace between p° and
p’ (the former place of p’).
Distribution. Japan proper.
Remarks. In general size, as well as in the skull and dentition,
the T'su-sima Bat agrees with the typical form; but the colour is
that of Rh. c. pumilus*.
20. RHINOLOPHUS GRACILIS, sp.n. (Plate IV. fig. 18 a, }, c.)
Rhinolophus minor (partim, nec Horsf.) Dobson, ué supra.
Diagnosis. Skull: the minor-type. Sella parallel-margined ;
tail extremely short. Very small: forearm 36°2 mm.
Details. This is an aberrant species of the minor-type. The
connecting process is quite of the same shape as in the foregoing
species (very different from that of subbadius). But the sella is
parallel-margined, as broad at the summit as at the base; by
means of a lens (probably not without) an exceedingly faint trace
of a constriction can be observed; the summit of the sella is
broadly rounded off, as in borneensis, not witha tendency towards
a subacute shape, as in the foregoing forms of this group; length
of sella 2°8 mm.; width at base 1:8 mm., at summit 1-7 mm.
The lancet is, considering the small size of the Bat, remarkably
fo)
long (4mm.), with the lateral margins almost straightly converging
towards the tip; it recalls the lancet of Rh. midas and hippo-
siderus (with which species &h. gracilis has no very close
affinity).
The tail is extremely short (13°5 mm.), shorter than the lower
leg. Plagiopatagium inserted a trifle above the ankle.
The colour (a little faded in alcohol) has probably been rather
like that of 2h. lepidus.
Skull. Quite of the minor-type.
Dentition (one skull). p, external. p,and p, distinctly separated.
p in row; cusp extremely minute (unworn).
Measurements. On p. 132.
Type. 9 ad. (in alcohol). Malabar Coast. Purchased. Brit.
Mus. no. 73.4.16.2.
21. RHINOLOPHUS SUBBADIUS Blyth.
Rhinolophus subbadius Blyth, J. A. 8. B. xi. pt. i. no. 150
(June 1844) p. 486.
Rhinolophus garoénsis Dobson, J. A. 8. B. xli. pt. i. no, 4
(Dec. 22, 1872) p. 337; id., Mon. Asiat. Chir. (1876) p. 48, text-
figs. a-c; id., Cat. Chir. Brit. Mus. (1878) p. 115.
* T have examined a paratype of Gerrit S. Miller’s Rh. minutus (Proc. Wash.
Acad. Sci. 1900, p. 235), the type of which is from the Anambas Islands. It is an
offshoot of the minor-type, but undoubtedly a distinct species, differme from
Rh. minor (trom Darjeeling) in having the brain-case decidedly higher in front,
giving the skull, in side view, a very characteristic outline. The name “minutus”
is, however, preoccupied by Montagu’s “ Vespertilio minutus,’ which is the British
form of Rh. hipposiderus. Mr. Miller will rename the Anambas species.
Proc, Zoou, Soc,—1905, Vou, I. No, LX, 9
130 MR. K. ANDERSEN ON BATS | May 16,
Diagnosis. Subbadius-type (cf. p. 123). The smallest species in
the genus: forearm 34°2 mm.
Details. The very characteristic shape of the connecting process,
formed as a long, sharply pointed, slightly curved ‘“ horn,” pre-
vents the confusion of this (and the next-following) species with
any of the foregoing forms. Also the shape of the lancet is
peculiar : : short, ine bank almost as an equilateral triangle ; but I
doubt that this character, in a large series, will prove to be quite
as safea guide for the discrimination of the species as the shape of
the connecting process ; there is, in all species of Rhinolophus, a
little more individual variation in the lancet than in other parts
of the nose-leaves. The sella is, essentially, of the minor-type
(not as in gracilis), much broader at base than at summit; below
the constriction the margins are almost parallel, above the con-
striction slightly converging ; the summit somewhat more subacute *
than in any of the foregoing species; tip of sella bent forwards.
Plagiopatagium inserted a trifle above the ankle.
The colour (a little faded) is probably not very different from
that of Rh. lepidus.
Skull. Unknown. I have seena small fragment only; it seems
to be of the minor-type.
Dentition (one example). p, external. p, and p, in contact. p*
in row; cusp small, but distinct.
Measurements. On p. 132.
Distribution. Nepal (type locality). Garo Hillst. (The only
example of this species in the British Museum is without exact
indication of locality.)
Technical name. Hodgson’s “ Vespertilio subbadia” (J. A. 8. B.
x. pt. 11. (Nov. 1841) p. 908), from the ‘Central Region of the
Himalayas,” is a nomen nudum (no word of description). The
head of this Bat is figured in his unpublished drawings (pl. 8.
fig. 3); it is not a Rhinolophus, but a Hipposiderus, probably
H. bicolor or an allied form.
* T emphasise this peculiarity (and, on the whole, enter intoa detailed description
of the sella), because it is this “pattern” of sella which has been carried to an
extreme insome of the Ethiopian and W. Palearctic representatives of the swbbadius-
type (Rh. empusa and blasii; cf. the “General Remarks,” pp. 136-37).
+ In Dobson’s ‘ Monograph’ and ‘ Catalogue’ (1. s. c.) Rh. garoénsis (= subbadius)
is recorded from Masuri. The species is very likely to occur there, only it must
be said that till now there is no proof. Its alleged occurrence in Masuri can be
traced back to two examples in the British Museum (Capt. Hutton) identified by
Dobson with Rh. garoénsis. They are, however, Rh. monticola, differing in all im-
portant points (process, lancet, size) from his own original description of garoénsis.
Quite as in the case of Rh. petersi: as Dobson had no longer access to the type, he
lost the precise idea of it. Still later (Rep. Brit. Assoc. 1880, pp. 175-76) he gave up
the separation of Rh. garcénsis as a distinct species, and then we arrive at the stage
when all small Indian and H. Palearctic Rhinolophi with a projecting process were
called Rh. minor, irrespective of differences in the skull, the process, the sella, lancet,
general size, and geographical habitat. What led Dobson to this conclusion was
the fact that the position of the lower pz varies in individuals from the same locality
(which, however, also is the case in all the more primitive species of the simplex group,
as high up in the series as Rh. affinis), and he was quite right in arguing that, from an
exclusively taxonomic point of view, this character had no value; but he overlooked
the other and more important characters by which the members of his composite
species differ from each other,
1905. ] OF THE GENUS RHINOLOPHUS. 131
Blyth’s kh. swbbadius (1844) from Nepal, erroneously believed
by himself to be the same as Hodgson’s V. subbadia, is a genuine
Rhinolophus. The following analysis of the original description
will make it evident that it is the species here under consideration :
(1) The connecting process is stated to be “ conspicuously deve-
loped, and pointed”; one of the chief characters of subbadius.
(2) The lancet is but “slightly emarginated towards the point” ;
also one of its principal characters; for the salient point in the
sentence is the word “ slightly,” as proved by a comparison with the
immediately subsequent description of lepidus, in which the lancet is
called ‘‘ considerably emarginated towards the tip.” (3) Forearm
“12 inches” (34°8 mm.); third finger “ 14 inches” (47°6 mm.);
these measurements, as being smaller than in any other species,
and like those of the individual before me (forearm 34:2, third
finger 46-4 mm.), settle the identification beyond all doubt.
Rh. garoénsis.—Dobson’s Rh. garoénsis (1872) is evidently the
same species as Blyth’s Ah. subbadius* (to which there is no
reference in Dobson’s ‘Monograph’ or ‘Catalogue’). The two
authors emphasise the same points :—(1) The connecting process
is described by Dobson as “ forming an acutely pointed elevation.”
(2) The lancet is a “ broad, triangular, pointed process,” or, as he
says in his ‘ Monograph,’ “almost an equilateral triangle” ; both of
these features are the same as already pointed out by Blyth. (3) The
Bat is said to be ‘probably the smallest known species of the
genus,” the forearm measuring only 1°3 in. (33mm.). (4) Width
of horse-shoe 0:2 in. (5'1 mm.); a very narrow horse-shoe is also
characteristic of the species (5°5 mm., as measured by myself).
In the type of garoénsis p, is, according to Dobson, in the tooth-
row; this is of no importance for the identification ; the position
of this tooth is ‘“‘ vacillating ” in the whole lepidus section.
22. RHINOLOPHUS MONOCEROS, sp. Nn.
Diagnosis. Subbadius-type. Larger: forearm, in a not full-
grown example, 38°2 mm.
Details. Connecting process (text-fig. 22 ¢, on p. 121) and lancet
as in subbadius. Horse-shoe markedly broader. General size
considerably larger. Tail proportionately longer.
The type, and only specimen known to me, is not full-grown
(supraorbital crests still separated posteriorly ; no saggital crest ;
metacarpals far from having acquired their full length). In the
table p. 132 I give only those measurements which may be of
some use for comparison with Rh. subbadius.
Dentition. p, external. p, and p, in contact, p* in row; cusp
very minute.
Type. © jyav. (in alcohol). Baksa, Formosa; June 5th, 1893.
Collected by Mr. P. A. Holst. Presented by Henry Seebohm,
Esq. Brit. Mus. no, 94.2.4.1.
* This view was held by the late Dr. Blanford, who, however, put the names
down as synonyms of Rh. minor (J. A. S. B. lvii. pt. ii. no. 3 (1888) p. 262; Fauna
Brit. Ind., Mamm. pt. ii. (1891)'p. 277). .
9
132 MR. K, ANDERSEN ON BATS [May 16,
Measurements of Rh. gracilis, subbadius, and monoceros.
Rh. gracilis. | Rh. subbadius. | Rh. monoceros.
@ ad. gad. ® juv.
Type. Type.
| mm. mm. mm.
Ears, length . se eoadomoae 15°7 145
- createst ‘breadth... rep ineeievaee 11 112
Nose- leaves, total length. ons 112 10 a
“i breadth of horse-shoe _... 6:2 55 65
Rorearm.. EE Maen eee een 36:2 34:2 382
3rd metacarpal .. Be ems 25 24:8 she
GB ifs 8 ame A toe eee A ee a NE 9-7 9°8 11:2
1 Gane nee Reet tantn to sacecaanicn 12 118
4th metacarpal... Sounkaueecuantoco ees 26°5 | 25 BN
IV. 4 Secale ata tae | EU 7-2 88
BV) Pa 88 87
Sula 4 metacarpal... 265 25 Ne
Tail RE Aer enn eo Re Aare 13:5) 14. 178
J DraKiiGred Gee Ss eearsh ucagereaseadcnmocescnonenc: 148 14°8 165
DOO soo BF Ge MUST TEC 8 | 7:3
Skull, total length — Ot lh rear eee ante BS Y/ |
eivemastoidiwidthie ane. ee nial |
op WGUEI Ose LOMEMNAGCAEE 55000 cceovosce i |
Pye omatic wid ulin eer peeeeeetrrr Tegel
» supraorbital length . A | a
width of nasal swellings .. seette 45 | 4.
Mandible, IUSTeVER dle eeiepaudonendoe toeead scones 10 | 10:2
Winperstectly serw tegen siaserorenees a see 6 6
Mower teeth ei. foecs cae ese dacetenee 63 6-2
93, RHINOLOPHUS ACUMINATUS Peters.
Diagnosis. Connecting process of the Jlepidus-type. Sella
parallel-margined, Fore earm 47-51 mm.
Details. This species, together with Rh. sumatranus and calypso
described below, form a small, well-marked section of the lepidus
group, which might conveniently be termed the acuwminatus
section, confined to Java, Lombok, Sumatra, and Engano,
and differing from all the foregoing species:—(1) in being
very much larger; 7h. lepidus is in size like a Kh. hipposiderus ;
Rh. swumatranus like a small Rh. ferrwm-equinum; (2) in being
a trifle more advanced in dentition: there seems to be no
“‘vacillation” in the position of p,.
Sella in Rh. acwminatus practically parallel-margined ; on very
close examination an extremely faint indication of an expansion
below the middle can be traced. Lancet. strongly hastate.
The rest of the nose-leaves, the mental grooves, the ears, the
wing-structure, the length of the tail, and the insertion of the
plagiopatagium (on the ankle, or slightly above or below) as in
th. lepidus.
1905.] OF THE GENUS RHINOLOPHUS. 133
Skull. Very much larger than in lepidus. There is no essential
difference in the shape *.
Dentition (two skulls). p, external. p, and p, quite, or
almost, in contact. p* in row; a minute cusp, pointing
inwards.
Measurements. On p. 134.
Geographical races. There ave two forms of Rh. acwminatus,
differing in size and in geographical habitat.
23 a. RHTNOLOPHUS ACUMINATUS Peters, TYPICUS.
Rhinolophus acuminatus Peters, MB. Akad. Berlin, 1871,
p- 308; Dobson, Cat. Chir. Brit. Mus. (1878) p. 113.
Rhinolophus peterst (partim, nec Dobson 1872 et 1880) Dobson,
op. cit. (1878) p. 114.
Diagnosis. Larger: forearm 50°5-51 mm.
Colour.—(1) Dark phase: ¢ ad., skin; teeth unworn. As
Rh. refulgens.
(2) Russet phase: 9 ad., in alcohol, unfaded; teeth unworn.
‘¢Cinnamon-rufous”” above; base of hairs of the same colour ;
under side lighter.
Distribution. Java.
23 6. RHINOLOPHUS ACUMINATUS AUDAX, subsp. n.
Diagnosis. Smaller: forearm 47—49°5 mm.
Colow. Two adult females, in alcohol, unfaded; teeth unworn,
or worn. As Lh. refulgens.
Type. Q ad. (in aleohol). Lombok. Collected by A. Everett,
Esq. Brit. Mus. no. 97.4.18.16.
Remarks. This form ought perhaps to be separated specifically
from Lh. acuminatus. The mandible is markedly shorter, the
teeth a trifle smaller, the nasal swellings slightly narrower, the
geographical habitat quite isolated from that of RA. acuminatus.
But the Bali form, still unknown, may perhaps connect them
together.
24. RHINOLOPHUS SUMATRANUS, Sp. n.
Rhinolophus petersi (non Dobson 1872 et 1878) Dobson, P. Z.8.
1880, p. 462 (specimen examined).
Diagnosis. Acuminatus section, but sella very distinctly
expanded below the middle. Width of horse-shoe 8-3 mm,
Forearm 51—51-2 mm.
Details. Chief characters :—(1) compared with acuminatus : the
very different shape of the sella, as described above ; width at base,
at expansion, and at summit: 2, 2°4, and 1-7 mm.; (2) compared
with calypso : the much narrower horse-shoe.
Colour. 3 ad., in alcohol, unfaded; teeth unworn. Upper
* The skull of the species of the acwminatus section is much like that of RA. rouxt.
It can, however, always be discriminated by the broader nasal swellings. The
mandible is, proportionately, longer.
134 MR. K. ANDERSEN ON BATS [May 16,
side darker than “ mars-brown,” lighter than “ burnt-umber”
base of hairs scarcely differing in colour; under side “russet.”
This looks like an intermediate stage between a “dark phase ” and
a “russet phase.” A second specimen (Gottingen Museum) is,
however, quite of the same colour.
Skull. As in Rh. acuminatus.
Dentition (one skull). p, external. p, and p, quite in contact.
p? in row; a minute cusp, pointing inwards. The interspace
between the upper canine and p* is narrower than in acwminatus.
Measurements. Below.
Type. & ad. (in alcohol). Lower Langkat, Sumatra; 1898.
Presented by Herr Gustav Schneider. Brit. Mus. no. 4.4.1.1.
25. RHINOLOPHUS CALYPSO, sp.n. (Plate IV. fig. 19 a, 6, ¢.)
Rhinolophus affinis (aon Horsf.) Thomas, Ann. Mus. Civ. Genova
(2) xiv. (1894) p. 108.
Diagnosis. Similar to Rh. swmatranus, but horse-shoe much
broader: 10:2 mm.; ears longer and much broader. Forearm
52-52°3 mm.
Measurements of Rh. acuminatus, sumatranus, and calypso.
Rh. acuminatus. aes Rh. calypso.
| f. typica. audax.
2 specimens, 2 specimens, 2 specimens, 2 specimens,
1 skull. 1 skull. 1 skull. | 1 skull.
Sar eae = || a
| Min. Max. Min. Max. Min. Max. | Min. Max.
| mm. mm. mm. mm. mm. mm. mm. mm |
Kars, length .. sels 18 19 187 19 I 19:5 2s
» greatest breadth... | 14 14 145 143 14:3 163 168
Nose-leay es, total leng th ssceall . U4 14 =14°8 EG 16 =-16°8
8 breadth of horse-shoe a8 82 Sule e2 82 83 10:2 102
| Forearm | 505 51 47 495 Sl S152 O23
3rd metacarpal ... | 35:8 365 33°7 35°2 35'°2 36'8 37 883
| TIT.} 162 162 15 15 15:2 163 15 158
TIL 198 20°7 175 20 20 21" || 2079) Mais
4th metacar pal... 374 38:7 351 383 372 38 || 3882 39:3
LENSE oi 112 118 97 105 11 17 «|| 10:3 108
V2 ey 13 eu 12 13 13 13°6 12°8 13°8
Sth metacar pal... 3877 38°7 386-388 87°5 38'3 38:2 39°3
Vue ee trea. Selene Gas soma on mah MOG il OTS Tiles; Wes} 12°2 12:7 ily nil}
Ven Ree ete vc ate tin ne RTOS 13 13°5 13°7 14:6 12°8 13°8
Tail poacsccvecs santas veboondaeoancacceal| LE 217 = 23°5 25:2 265 24-7 265
Wbowerslecwcrae gc ey ee aena eae ea a eee nee 21 217 22°5 22°5 22°5 23°2
INGOU co ocos 118 10°8 11 10°8 11 10°3 11
Skull, total length . Fea PIG tel Mma nie 21°6
» mastoid width . a3 Fea NI Ne Es ee Oe PATIOS 2 aes 102
» width of Braintcases co ine ie Bike OPS yall pea 92
» zygomatic width ©. .0......-.e.ce 114 C112 socal hemi coe | 109
» supraorbital length . eee 5 53 5 54.
width of nasal swellings . Bae eee 6:2 6 62 || 683
Mandible, eae gs 16 148 15°8 15:2
Upper teeth . Ss ci Pea RU GN ha 88 8:2 88 87
Lower teeth ...........0 9°65 9 9°65 9:2
1905. ] OF THE GENUS RHINOLOPHUS. 135
Colour. $ ad.and 9 ad., in alcohol, unfaded; teeth unworn.
As Lh. refulgens.
Skull. As in Rh. swmatranus, but maxillar width, across the
antero-external corners of m’*, narrower (8°1 mm., as against 8°6
in Kh. swmatranus).
Dentition. Kssentially as in Rh. swmatranus, but the interspace
between the upper canine and p‘ broader; p, and p, not quite in
contact.
Type. 3 ad. (in alcohol). Kifa Juc, Engano. Collected by
Dr. E. Modigliani. Presented by Marquis G. Doria. Brit. Mus.
no. 94.1.7.3.
General Remarks on the Rhinolophus lepidus Group.
The ancestral species—The ancestors of the simplex and lepidus
groups were very closely related. The latter had a projecting
connecting process, a slightly smaller skull and teeth. But the
general shape of the skull, the dentition, the nose-leaves, apart
from the process and a very slight difference in the shape of the
sella, the ears, the wing-sirwcture, the length of the tail, and, we
might even say, probably the size, were either identical or ex-
tremely similar in both of these extinct Bats.
The place of origin.—There can scarcely be any doubt that
the lepidus group originated much farther westwards than the
simplea group. If we regard Japan as a continental group of
islands, and put aside Java, on account of its peculiar geological
history, we still find, not only the most primitive, but in fact all
the species of the /epidus section on the Continent. It is only
the aewminatus section which has spread over the adjacent larger
islands, one of which (Sumatra) has comparatively recently been con-
tinental, while another (Java), probably in a more remote period,
seems to have been connected with some part or other of Indo-
China; and only one form, still so closely related to the Java
species as hardly to be specifically different, has found its way so
far eastwards as Lombok. The hypothesis, therefore, cannot be
called unfounded, that of the two ancestral species, the ancient
“simplex” and the ancient “ lepidus,” the former was Hastern in
vange (Austro-Indo-Malayan), the latier Western (Oriental).
Differentiation * —From a systematic point of view I found it
convenient to divide the lepidus section into three “types”; I
think that, phylogenetically speaking, there are two only: the
lepidus and the minor type. The former, as coming nearest to
simplex in the proportionate size of the skull and teeth, is,
probably, the more primitive; it is now distributed over the
Jndian Peninsula (/epidus), the Himalayas (monticola), and Malacca
(refulgens). The latter, the minor-type, has spread from the
Himalayas (minor) eastwards through 8. China to Japan (cornutus) ;
it is represented on the now quite isolated Anambas Islands
(“ minutus”); its occurrence in Java is not surprising, considering
* Compare the diagram on p. 1388.
136 MR. K, ANDERSEN ON BATS [May 16,
the faunistic attinities of that island; and it has established itself
on the western coast of the Indian Peninsula (gracilis). I have
but very little doubt that now, when attention has been called to
the differences of all these forms of the mznor-type, it will be
found algo in other parts of the Indian Peninsula.
Tf any inference can be drawn from fragments of a skull and
the external characters, the swbbadius-type would appear to be
an offshoot of the minor-type: already in minor and cornutus
the process is a little sharper-pointed than in lepidus; in swbbadius
and monoceros this tendency is carried much further,
The skull of the species of the acwminatus section (Java—
Lombok, Sumatra—Engano) is of the lepidws-type; the process
too; the colour remarkably like that of refulgens. This leads me
to suppose that acuminatus and its allies (swmatranus, calypso)
are scarcely more than giant representatives of the lepidus-type.
Tt is the subbadius-type which, from a zoogeographical point
of view, is by far the most interesting: it has spread southwest-
wards over a vast part of the Ethiopian Region, and westwards
over the Mediterranean countries :—
(1) The empusa-type.—Rh. empusa* and blasti have progressed
further on the way already indicated by Rh. subbadius. They
have the small skull and the small teeth characteristic of m¢nor-
subbadius ; in the shape of the skull there is no essential difference ;
the dentition is identically the seme; the process is that of a swb-
badius; the sella is deltoid, that is: the tendency, in the subbadius-
sella (as emphasised above), towards assuming a subacute summit
has been further developed; and we still see the constriction at
the middle of the sella. But empusa and blasii are (as‘always the
Ethiopian and W. Palearctic species) in several points more highly
developed: III.? is lengthened (about, or more than, 14 the length
of I11.); also IV. is very much longer (not far from twice the
length of IV'.). 2h. empusa is, however, an inhabitant of Nyasa-
land, far 8. of the Equator, Ah. blasii of the Mediterranean
Subregion; thus, the two extremely closely allied species are
now separated by an enormous tract, where no relative appears
to occur. As we now know that they are descendants of the
Oriental subbadius-type, the explanation seems to be quite clear:
one branch spread southwestwards, into the Ethiopian Region,
and developed into 2A. empusa (slightly more primitive dentition ;
shorter ears, broader horse-shoe); another westwards into the
Mediterranean countries, Rh. blasii. There is an instructive fact
connected with these two Bats: I believe them to be compara-
tively recent intruders into their areas; Ah. empusa is known
from one specimen only, from the very Hast of Tropical Africa ;
Rh. blasii is much more common in the Hastern Mediterranean
tract, and still it does not seem to have reached Spain ’.
* Andersen, Ann. & Mag. Nat. Hist. (7) xiv. (1904) p. 378 (there is a misprint on
p. 380: the length of the mandible is 1271, not 13°1 mm.).
+ Not recorded in Cabrera Latorre’s “Quirépteros de Hspafa,” Mem. Soc. Espan.
Hist. Nat. ii. (1904). Iam also not satisfied that there is any reliable record from
the African coast of the Mediterranean.
1905. ] OF THE GENUS RHINOLOPHUS. 137
(2) The landeri-euryale type—The Ethiopian Rh. landeri
(Fernando Po, Gaboon), Rh. lobatus (Lower Zambesi to Mombasa),
and Rh. dobsoni* (Kordofan) have the small skull and the small
teeth characteristic of minor-subbadius; the same shape of the
skull; the same dentition (no vacillation in the position of p,);
the process is that of a swbbadius. In so far there is no difference
at all between this section and the former (empusa-blasii). But
in the shape of the sella and in a certain peculiarity in the wing-
structure they have taken a course of their own :— We have seen,
in the simplex group, a progressive development from a sella
constricted at the middle, through a parallel-margined stage, to
a pandurate sella; we have seen in the lepidus group, too, the
constricted sella (minor) modified into the parallel-margined
(gracilis); the Hthiopian species here under consideration represent
the third and final stage, the pandurate sella. In addition to this:
in all of them IV. is peculiarly shortened: less than (extremely
rarely, as a slight individual atavism, equal to) half the length
of IV*. Asin Fh. empusa and blasii, II.’ is lengthened.
Rh, euryale, from the Mediterranean Subregion, is so extremely
closely allied to the above-named Ethiopian species that it shares
with them ql essential characters (even the highly peculiar
shortening of LV."), with one exception: i¢ has retained the parallel-
margined sella.
Summary.— When discussing the affinities of the Ethiopian
species of the Ah. simplex group (above, pp. 117-20), I arrived
at the conclusion that they are undoubtedly derived from
Oriental types, and that, most probably, the ancestral species
have spread directly from South Asia into the Ethiopian Region.
As will be observed from this, a study of the Ethiopian repre-
sentatives of the 2h. lepidus group leads to quite the same
result: they have thei closest known allies in the Oriental
Region, but they are, without exception, considerably more
highly developed than any of their Oriental relatives. Bats of
the subbadius-type have evidently spread from some part of
South Asia southwestwards into the Ethiopian Region (empusa ;
landeri, lobatus, dobsoni), and westwards over the Mediterranean
countries (blasii; ewryale). Of all the species of the 2h. lepidus
group only one has found its way to Lower Egypt, Rh. euryale.
Tt is a species exclusively Mediterranean in range, and unusually
lable to differentiation imto slightly differmg local forms’.
Its presence in Lower Egypt is easily explained by invasion
from the adjacent Asiatic coast of the Mediterranean, where it
is very common (specimens from Lower Egypt are indistinguish-
able from the Palestine form, Rh. e. judaicus) <.
* Thomas, Ann. & Mag. Nat. Hist. (7) xiv. (1904) p. 156.
+ Andersen and Matschie, “ Ueber einige geographische Formen der Untergattung
Euryalus” (SB. Ges. naturf. Fr. Berlin, 1904, pp. 71-83).
{ Although it is beyond the strict limits of the present paper, I propose to insert
a tew words on the remaining Ethiopian species of the genus :—The ethiops section
(Rh. ethiops, hildebrandti, and fumigatus) are very closely related to the Hima-
layan Rh. macrotis, but much more highly developed in the dentition, the wing-
138 MR. K. ANDERSEN ON BATS [May 16,
The probable affinities and phylogeny of the principal forms of
the Rh. lepidws group are expressed in the subjoined diagram
(Ethiopian types marked with an asterisk) :—
ewryale.
* landeri-type.
Se
% * py -tv
*“empusa-type. _» (midas group.)
es
/ ra
y Baa
subbadius-ty pe. ean,
Pnenanee ae
acuminatus-ty pe.
Re PRS sch
O ze —___—->(simplex group.)
IIL. Tart RarwoLorxus uipAs GROUP.
Diagnosis. Cochlee large, making the basioccipital, between
them, extremely narrow (linear). Posterior connecting process
very low and rounded off.
26. RuINOLOPHUS MiDAS, sp. n. (Plate IV. fig. 204, 6, ¢, d.)
Diagnosis. Sella almost deltoid, summit rounded. Forearm
37°7 mm.
Details. Horse-shoe as broad as the upper lip; no “tooth” on
the sides of the median notch; no crenulation of the border.
Lateral margins of sella converging from base to tip; breadth
at base (2°3 mm.) much more than half the vertical height of the
sella (3°5 mm.); a very slight (rather easily overlooked) constriction
at the middle; summit rounded (breadth 1°6imm.). Connecting
process very low, and broadly rounded off. Lancet long (4 min.)
and cuneate. One mental groove only.
Kars a little longer than in minor, outer margin immediately
below the tip somewhat more emarginate; tip more distinctly
pointed.
Wing-structure, compared with that of mor, considerably
structure, and the mental grooves (Andersen, Ann. & Mag. Nat. Hist. (7) xvi. Sept.
1905, pp. 291-92). Rh. maclaudi is an Ethiopian representative of the Rh. philip-
pinensis group, but on a considerably higher stage of development in the same
respects as the species just named (Id., tom. cit. Aug. 1905, pp. 254-55).
This completes the account, showing that all the Ethiopian Rhinolophi, without
exception, are of Oriental origin.
1905.] OF THE GENUS RHINOLOPHUS. 139
modified, chiefly in two respects:—(1) the third metacarpal is
shortened ; but at the same time the fourth metacarpal has
remained the longest (as in all primitive species of hinolophus) ;
(2) IIT’, IV.’, and V.’?, that is all the distal phalanges, are
lengthened. Compare the table of measurements of Rh. midas
and hipposiderus on the one side, with those of minor, lepidus,
and all their allies on the other (see p. 143).
Tail rather long, 13 the length of the leg. Plagiopatagium
inserted on the ankle-joint.
Colour (somewhat faded in alcohol) probably as light as in
Lh, blast.
Skull, In all species of Ahinolophus the cochlee are large,
making a narrow basioccipital (compare the genus Hipposiderus) ;
but in Ah. midas and hipposiderus the peculiarity is carried
to an extreme: the cochlew are so much increased in size as to
reduce the basioccipital to a linear bridge of bone; in some
individuals (of Lh. hipposiderus) the cochlee are almost in
contact. This character alone makes the skull of these two
species easily distinguishable, at a glance. But in every other
respect, in the shape, the size, and the teeth, the skull is so
exceedingly like that of Kh. minor, that there can scarcely be any
doubt as to the very close relationship of the minor and midas
types.
Dentition. On the minor stage :—p, external. A very narrow
interspace between p, and p,. p quite in row; a small cusp,
pointing inwards. Upper canine and p* well separated.
Type. 9 ad. (in alcohol). Jask, Persian Gulf. Presented by
A. Butcher, Esq. Brit. Mus. no. 94.11.16.1.
Remarks. The discovery of this highly interesting species seems to
remove all doubt as to the close affinities of minor and hipposiderus.
The sella of midas is intermediate between that of minor and
hipposiderus ; it recalls that of empusa and blasii, which also
are modifications of the minor-type; to the peculiarly long and
cuneate lancet we have a parallel in one of the modifications
of the minor-type described in this paper, viz. Rh. gracilis.
The geographical habitat of midas is, too, rather intermediate
between the Oriental minor and the W. Palearctic hipposiderus.
Rh. midas is, of course, readily distinguishable from Zh.
hipposiderus by the shape of the sella. In the width of the
brain-case, as well as in external dimensions, it is like the
southern, more primitive form of Aipposiderus (Lh. h. minimus).
27. RHINOLOPHUS HIPPOSIDERUS Bechst.
Diagnosis. Sella cuneate; summit pointed. Forearm 34:7—
41°7 mm.
Details. Breadth of sella at base never more, but generally less,
than half its vertical height.
Colow’. (1) Younger, but quite full-grown individuals; skins;
Cyprus, 8. Carpathians, Switzerland. Very nearly ‘‘ mouse-grey ”
above; horse-shoe patch faintly, or not at all, indicated; base
140 MR, K. ANDERSEN ON BATS [May 16,
of hairs of the upper side and the whole of the under side “ drab-
erey.”
(2) Aged individuals; skins; Cyprus, Malta, Balearic Islands,
Switzerland, Germany. Much browner. General colour above
brownish “ drab,” with some individual variation in the shade of
the colour: sometimes almost ‘“wood-brown” (lightest extreme),
sometimes with a tinge of “ Prout’s brown” (darkest extreme) ;
horse-shoe patch indicated, or quite obliterated; base of hairs
“ecru-drab”; under side ‘“ ecru-drab,” sometimes with a tendency
towards “ drab-grey.”
Skull, As in Rh. midas.
Dentition. AS in minor and midas. In the series of skulls
examined (20; of all races) there is, of course, some variation in
the position of p,; the general rule is: p, external, p, and p,
almost or quite in contact; one extreme: p, almost in row
(one skull), and p, and p,, therefore, well separated ; the other
extreme: p, not only external, but hair-fine (four skulls; teeth
unworn), or disappeared and the alveoli obliterated (two skulls;
teeth unworn).
Distribution. From Gilgit to Ireland; from the Baltic to
Sennar,
Geographical races. The series examined—95 examples, from
almost the whole area occupied by the species—enables me to
recognise three races of 2. hipposiderus. 'The first two of these
would probably be called distinct species by other zoologists.
27a. RHINOLOPHUS HIPPOSIDERUS MINIMUS Heugl.
Khinolophus minimus Heuglin, N. Act. Acad. Czs. Leop.-Car.
xxix. (1861) p. 6.
Rhinolophus hipposiderus minimus Andersen, Ann. & Mag. Nat.
Hist. (7) xiv. (1904) p. 455.
Diagnosis. Small: forearm 34:7-38 mm.
Details. As lately pointed out by me elsewhere (1. s. c.),
v. Heuglin’s 2h. mininws, first described from Keren in Erythrea
(type in the Stuttgart Museum), is a well-marked geographical
race of Kh. hipposiderus, differing from the Central Huropean
form by its considerably smaller size. At the same time I
mentioned that the British Museum possesses an example from
Sennar indistinguishable from the type specimen of minimus.
A subsequent examination of the whole series of Rh. hipposiderus
preserved in the British Museum has revealed the rather surprising
fact that Kh. h. minimus is by no means confined to Keren and
Sennar, but generally distributed over the Mediterranean Subregion.
It differs from the Central European form in being in every respect
smaller ; in some respects, as it seems, absolutely smaller, in others
at least on an average. I find the length of the forearm to be
the best means for a ready discrimination: in minimus,
347-38 mm.; in the typical form, 39-41:7 mm. For other
details, cf. the measurements on p. 143.
1905.] OF THE GENUS RHINOLOPHUS. 141
The skull is markedly smaller, the nasal swellings a trifle
narrower, the teeth slightly smaller.
Distribution. 32 specimens examined. As it is of some interest
to have the range of this hitherto overlooked form exact]
determined, I subjoin a list of the localities from which I have seen
examples, together with measurements of the forearm; it might
perhaps lead to further investigation :—
Keren (1, the type*): forearm 36°3. Sennar (1): 36°5. Cyprus
(6): 34°7-37-7. Smyrna (1): 37°5. Malta (8): 36-37. Middle
Italy (Ostia 2): 35°7-36°8. Corsica (1): 37:7. Haute Savoie and
Geneva (2): 37°7-38. Balearic Islands (7): 36°2-37°6. Seville tT
(1): 37-7. Morocco (Tangiers 1): 37:7. Portugal (Cintra 1):
362.
Summary of Distribution :—The Mediterranean Subregion,
southeastwards to Sennar and Keren. Ee it noted: there is no
record from Hgypt (and, very likely, it does not occur there: ¢f.
remarks on p. 143).
Remarks. In the whole series of Rh. hipposiderus examined
(apart from the British specimens, of course) I have not found
any individual which I could not easily refer either to the
southern or the northern form. I have some reason to believe
that in certain border districts (e.g. 8.W. Switzerland ; perhaps also
Cyprus) the two forms occwi together, perhaps side by side, but
intermediate examples I have never seen. They will probably be
found.
27 6, RHINOLOPHUS HIPPOSIDERUS Bechst., TYPICUS.
Vespertilio Ferrum equinum (partim) Schreber, Siugthiere, i.
(1775) pp. 174, 188, pl. 62 (lower fig. only).
Vespertilio equinus (partim) P. L. 8. Miller, Natursyst., Suppl.
(1776) p. 20.
Vespertilio Ferrum equinum, 6. minor, Gmelin, Linn, Syst.
Nat. i. (1788) p. 50.
Vespertilio Hippocrepis (partim) Schrank, Fauna Boica, 1. (1798)
. 64,
‘ Vespertilio Hipposideros Bechstein, in Pennant’s Allg. Uebers.
vierfiiss. Thiere, 11. (1800) p. 629, footnote (compare also pp. 615
and 736).
Vespertilio hippocrepis Hermann, Obs. Zool. (1804) p. 18.
Rhinolophus bi-hastatus Geoftvoy St.-Hilaire, Descr. de lKgypte,
i. (1812) p. 132; id., Ann. Mus. d’Hist. Nat. xx. (1813) p. 259,
pl. 5.
* Wor the loan of this specimen I am indebted to Prof. Dr. Kurt Lampert, Director
of the Royal Natural History Cabinet, Stuttgart. The type is a young, but apparently
fullgrown, individual. 4/2 other examples otf hipposiderus, of allvaces, of which I give
the measurements, are fully adult (distal epiphyses of metacarpals ossified).
+ As I have seen only one example frem Spain, I may mention that of the whole
series examined by Cabrera Latorre, for his “‘Quirépteros de Espafia,’ no Spanish
specimen had the forearm more than 37°5 mm. (Mem. Soc. Espan. Hist. Nat. ii.
(1904) p. 252). IT am unacquainted with the Rh. phasma (allied to hipposiderus)
described by Cabrera in the same paper.
142 MR. K. ANDERSEN ON BATS [May 16,
Rhinolophus HHipposideros var. typus, alpinus, et pallidus
(partim) Koch, Jahrb. Ver. Naturk. Nassau (1862-63) pp. 530—
ol.
Rhinolophus hipposideros (partim) Peters, MB. Akad. Berlin,
1871, p. 310; Dobson, Cat. Chir. Brit. Mus. (1878) p. 117.
Rhinolophus bihastatus var. Kisnyiresiensis Daday, Orvos-Term.
Ertes. x. pt. 3 (1885) p. 274.
Rhinolophus hipposideros var. troglophilus Daday, Magy. tud.
Akad. Ertekez. xvi. pt. 7 (1886) p. 8, figs. 1, 2.
Rhinolophus euryale helvetica Bretscher, Vierteljahrsschr.
naturf. Ges. Ziirich, xlix. (1904) p. 256 f.
Diagnosis. Large: forearm 39-41-7 mm.
Distribution. 33 specimens have been examined, from the
following localities :—
Gilgit (1): forearm 39°8. Urmi, N.W. Persia (1): 39°8. Van,
Armenia (2): 39°2-39°3. Cyprus (1): 39°64. N. Bulgaria (1): 39.
Roumania (13): 89-41:2. Transsylvania (2): 40-41. 8. Car-
pathians (1): 39:3. Hungary (1): 41-7. Schlangenbad (2):
40-40-1. Strassbourg (3): 39-40°1. Thurgau and Vallais (5) :
40°2-41°7.
Summary of Distribution :— From the extreme N.W. Himalayas,
through N.W. Persia and Armenia, over the whole of Central
Europe N. of the Balkans and the Alps.
27c. RHINOLOPHUS HIPPOSIDERUS MINUTUS Montagu.
Vespertilio minutus Montagu, Trans. Linn. Soc. ix. (1808)
p. 162, pl. 18. figs. 7-8.
Diagnosis. Forearm 36°3--39 mm.
Details. English and Irish individuals of 2h. hipposiderus differ
from the Central European form in being on an average (and
nearly always also absolutely) smaller. The length of the forearm
yavies, in 30 adult specimens from England, Wales and Ireland,
between 36°3 and 39 mm., the average being 37:6. In other
words: the average size of the British race is considerably below
the minimum of the typical form, and almost exactly like maximum
of Rh. h. minimus.
Distribution. England, Wales, Ireland §.
Technical name. Till the close of the 18th century, the two
Bats now called Rh. ferrwm-equinum and Lh. hipposiderus were
** Koch’s “varieties” are scarcely determinable, his descriptions being utterly vague
and based upon such characters as are subject to individual variation or dependent
on age: var. typus and alpinus belong, probably, to the Central Muropean form ;
var. pallidus seems to be a mixture of this and the southern race.
+ A glance at the measurements in Bretscher’s paper is sufficient to show that
what he takes to be “eine ausgesprochene Lokalform ” of Rh. ewryale is an ordinary,
typical Rh. hipposiderus !
+ Lought perhaps to mention that this example, the only typical hipposiderus T have
seen from Cyprus, is a dealer’s specimen; a Cyprus series collected and presented by
Miss Dorothy M. A. Bate (cf P. Z.S. 1908, ii. p. 342) are unquestionably of the
Mediterranean form.
§ For details, cf. J. E. Kelsall, “The Distribution in Great Britain of the Lesser
Horse-shoe Bat,” The Zoologist, xlv. (1887) p. 89.
1905.] OF THE GENUS RHINOLOPHUS, 143
regarded as a large and a small variety of one species. In 1808,
Montagu pointed out some of their distinctive characters, and
proposed for the smaller species the name Vespertilio minutus,
being evidently unaware that the two Bats had already twice been
specifically separated—by Bechstein in 1800, and by Hermann in
1804, Montagu’s name, as being antedated by “ hipposiderus,”
was soon almost completely forgotten (it is not recorded in
Dobson’s Catalogue). The original description of V, minutus
being, however, based on English specimens, the name is now
available for the British race ot hipposiderus.
Remarks. We are now able to form a much clearer idea of the
past history of Ah. hipposiderus. It originated from a Bat
allied to Rh. minor, somewhere in Asia, most probably near the
western border of (if not within) what is now called the Oriental
Region. From there it spread southwestwards into Africa, west-
wards through the Mediterranean countries to Central Europe
and the British Islands. There is, to my knowledge, no record
of Rh. hipposiderus from Egypt; if this is evidence that it does
not occur, and has not occurred, there, it is at the same time a
Measurements of Rh. midas and hipposiderus.
| Rh. midas. Rh. hipposiderus.
| |
| Sad | minimus. | f. typica. minutus.
| Typ ni 132 eee | 33 specimens,| 30 specimens,
| : | 12 skulls. | 6 skulls. 2 skulls.
Min. Max. | Min. Max. | Min. Max.
mm. | mm. mm.| mm. mm.| mm. mm.
Ear 8, leng Gee sono anddod so AGU CeO 1/ | 14 16 | 15 165 14:2 15°5
|, greatest breadth 00... ccc. 13 VoO)) ula esl dar 12:8) hasten Ties
Nose- Teav es, total Teneth) .2...2.0...... 12°8 ) WOR TY) hale) 18) 10 118
3 breadth of horse-shoe ... 73 6 68 Goa 6 67
IM OTeaTITENe SS EY, hth readies emcee By Sule, Bis} |) BD) ae || BS) BD)
rol AACA! — soasoonaceadbon soa sasusa x08 242, 22:2 25:7 | 248 27:3 | 29°38 249
TITEL EN Sh nee ea en a UI Pte WAG yp Ha 128 | 197 14-9 11:6 13:2
OLY. PE GASRIGoaEComtmchob dasa acne Noe | ists} |) dlse7/ US) ey USF 163 18°7
4th metacarpal — Eee eetcaenanaeeernces 27 25) e292 P28 3072) Zu 29
1A OU enon peacend aaacoe nen sosgmaacasnscs ors Wal IN, G8 a8 7 8 Gia 8
Tee i Sys UE cutie hn Semeachaa saan a 12 I 109 13:2 12 141 ile Wee
5th metacarpal — HES 2 Sener tN 25:8) || 2315 27e7 | 272 29:7" |" 2av7 98:2
Vv. Sa Ul Ae) Oe a Koe39 72 98
LR ED MMe Connect Bena Sao Hine aoc rR OGG 12:2 | ils) 1g) TBS} 233 12:5 1438
Tail PE SLs REA GaSe SEEM Nee ana CSS 2405 | 235 277 | 262 30:3 23°5 27
io werslera eae ee nce ieee: NO Gays} |) AS UD). | GSS. S55
Foot ....: Rees eythane cate ae 76 RD IY a RSS 7-5 R7
Skull, total length | Pe etree coke ccts ol 15:9 145 15° 16 16°2 16 16
» mastoid Rridthen eecet ane fae i ee ee “en ARS} 73 7:8
width of bram-case 07 00.-.0......| i il Gl GH | G8. Ge 68 68
5 “zygomatic width .......6:0......:. IAS eee EAD VRS 8 8 8
fy WaECIMENP GrAGhAN aac soo oodosscnavcs dee 58 Be Gs) | BS) BS 56 57
.», Supraorbital length . 45 4 45 | 42 5 43 AA
width of nasal sw ellings .. 4-2 a7 83 | Be al 4, 4,
Mandible, length .. Re on EL HORS it Srey TO. || NO 10°2 co | LOD
Upper 1 aT REA Os Nang easel Si SS i Ba Bul Ar) By. i
IDO WGP WEALD “ang ansooanoe soo ops eto-aboonn gaoa00 6-2 56 8658 58 6 AD 6
144 MR. K. ANDERSEN ON BATS [May 16,
proof that it did not reach Erythrea and Sennar from the Mediter-
ranean, by way of the Nile Valley, but via the formerly existing,
broad land-connection between 8.W. Asia and N.E. Africa. The
individuals which established themselves in Central Europe, N.
of the Balkans and the Alps, gradually making their way as far
north as the Baltic, developed into a distinct, larger race (Lh. h.
typicus). The British colony, originally the extreme western off-
shoot of the larger form, but soon cut off from communication
with the Continental main stem, also developed into a distinct
race (Rh. h, minutus); it got the not unusual stamp of an island
form: the smaller size; and so it came to occupy, seemingly,
but neither phylogenetically nor geographically, a somewhat
intermediate position between the northern and southern
races of hipposiderus, between its immediate and its more remote
progenitors.
It is worth noticing that Rh. hipposiderus is distributed over the
whole of England, occurring also in several places in Ireland,
whereas Rh. ferrum-equinum is confined to the extreme south
of England, apparently not farther north than Hssex, Gloucester,
and Pembroke, and has never reached Ireland. It may indicate
that of these two comparatively recent immigrants into the
British Islands, Rh. hipposiderus was the earlier comer. ‘This
assumption seems strengthened by another fact. On the Continent
Rh. hipposiderus goes farther northwards and considerably higher
up on the mountains than ferrwm-equinum. Tt is but reasonable
to suppose that the more hardy species was also the first to make
its way to England.
TV. SUMMARY.
1. A progressive evolution is pointed out from the Austro-
Malayan 2h. simplex, through a long series of Oriental forms, to
the Western Palearctic Rh. ferrum-equinum (pp. 76-120 ; résumé
pp. 116-120).
2. A similar chain from the Oriental Ah. lepidus to the
Western Palearctic Rh. blasii and Rh. euryale (pp. 123-138 ;
résumé pp. 135-138).
3. The Western Palearctic Rh. hipposiderus has no closer
known relative than Rh. midas from the coast of the Persian
Gulf, which again can be traced back to the Oriental Ah. minor
(pp. 138-144).
4, All the Ethiopian representatives of the genus Rhinolophus
are of Oriental origin (pp. 117-120, 186-138).
5. The following 26 forms (14 species and 12 subspecies) are
described as new, all of them Austro-Malayan, Oriental, or
Asiatic-Palearctic :—h. simplex, p. 76; megaphyllus monachus,
p- 80; nanus, p. 82; celebensis, p. 83; virgo, p. 88; nereis, p. 90;
stheno, p. 91; rouwi sinicus, p. 98; thomasi, p. 100; affinis hima-
layanus, p. 103; a. tener, p. 103; @ macrurus, p. 103; a. supe-
rans, p. 104; a. nesiées, p. 104; a. princeps, p. 1065 ferrum-
1905. ] OF THE GENUS RHINOLOPHUS. 145
equinum regulus, p. 112; f. proximus, p. 112; monticola, p. 124;
refulgens, p..124; cornutus pumilus, p. 127; gracilis, p. 129;
monoceros, p. 131; acuminatus audax, p. 1383; swmatranus,
p- 133; calypso, p. 134; midas, p. 138.
6. The following 10 forms, hitherto usually regarded: as iden-
tical with other species, are shown to be distinct species or
subspecies :—Fh. truncatus Peters, p. 80; borneensis Peters,
2
p. 84; roux: Temm., p. 93; (ferrwm-equinum) nippon Temm.,
p. 110; (f) tragatus Hodgs., p. 111; lepidus Blyth, ie SS
cornutus Temm., p. 127; suwbbadius Blyth, p. 129 ; (hipposiderus)
muumus Heugl., p. 140; (h.) minutus Mont., p. 142.
7. The following names, hitherto usually regarded as indicative
of distinct species, are referred to the lists of synonyms :—
Rh. petersi Dobson, p. 95; garoénsis Dobson, p. 181.
EXPLANATION OF THE PLATES.
Prats IIT.
Rhinolophus simplex group; skulls; front views 2, all other figures te
Fig.1. Rh. simplex (p. 76); Lombok; type of the species. Front view.
2a, b,c. Rh. megaphyllus f. typica (p. 79); Cooktown; B.M. no. 3.8.3.3.
Upper, lateral, and front views.
3. Rh. nanus (p. 82); Goram; type. Front view.
4a, b. Rh. celebensis (p. 83); Makassar; type. Upper and front views.
da, b,c. Rh. borneensis f. typica (p. 84); Labuan; topotype; B.M.
no. 65.5.9.15. Upper, lateral, and front views.
6. Rh. malayanus (p. 89); Biserat; topotype; B.M. no. 3.2.6.84. Front view.
7a, b,c. Rh. nereis (p. 90); Siantan, Anambas; type. Upper, lateral, and
front views.
8a, b. Rh. stheno (p. 91) ; Selangor ; topotype; B.M. no. 98.3.13.2. Lateral
and front views.
9a, b, c,d. Rh. rouxit f. typica (p. 93); Ceylon. Upper, lower, lateral, and
front views.
10, Rh. thomasi (p. 100); Taho, Karin Hills; topotype; B.M. no. 90.4.7.9.
Upper view.
lla, b. Rh. affinis himalayanus (p. 103); Nepal. Lower and front views.
12. Rh. a. tener (p. 103); Pegu; type. Upper view.
13. Kh. a. princeps (p. 106); Lombok; type. Upper view.
Prats LV.
Rhinolophus simplex, lepidus, and midas groups; skulls; front views 2,
all other figures 2.
Fig. 14a, 6, c,d. Rh. ferrum-equinum tragatus (p. 111); Nepal; one of the
cotypes. Upper, lower, lateral, and front views.
15. Rh. f. proximus (p. 112); Gilgit; type. Upper view.
16a, b,c. Rh. refulgens (p. 124); Perak; type. Upper, lateral, and front
views.
17a, 6, ¢. Rh. cornutus pumilus (p. 127); Loo-choo Isl. ; topotype; B.M.
no. 2.10.7.2. Upper, lateral, and front views.
18 a, 6, c. Rh. gracilis (p. 129); Malabar coast; type. Upper, lateral, and
front views.
19a, b,c. Rh. calypso (p. 134); Engano; type. Upper, lateral, and front
views.
20a, b, e, d. RA. midas (p. 138); Jask, Persia; type. Upper, lower, lateral,
and front views.
Proc. Zoou. Soc.—1905, Vor. II. No. X. 10
146 DR. E. BERGROTH ON STRIDULATING [May 16,
4. On Stridulating Hemiptera of the Subfamily Halyine,
with Descriptions of new Genera and new Species. By
Dr. E. Bercrory, C.M.Z.8., Tammerfors, Finland.
[Received April 1, 1905.}
In his paper “ Zur Kenntniss der Stridulationsorgane bei den
Rhynchoten,” Handlirsch * has described three different kinds of
stridulatory organs in the Rhynchota : the prosternal furrow of the
Reduviide ; thestrigose ventral patches of the Division Tetyraria
of the Scutelleride ; and the, at that time, still incompletely known
stridulating apparatus of the Corixide, of which Kirkaldy? has
since given us a complete description and a probably correct
interpretation. There is, however, one group of Rhynchota in
which these organs have remained unknown to Handlirsch and
all other zoologists, except the distinguished systematist Stal, who
knew them without recognising their function. In his important
paper “ Bidrag till Hemipterernas systematik” { he states that
the Pentatomid genera Platycoris, Viarius, Alphenor, and On-
cocoris have the following character in common: “‘segmentis ventris
secundo et tertio latera versus vitta longitudinali nonnihil curvata,
opaca, vix elevata, transversim densissime subtilissimeque strigosa,
instructis.” Although Gilippus is described in the same paper,
Stil seems to have overlooked the fact that this genus possesses
the same structure, and in the systematic arrangement he places
Oncocoris far apart from the other genera above mentioned.
In a subsequent memoir$ he ascribes the same character to
Mecidea, the species of which are mostly African, though it is also
represented in India and the temperate parts of America. In a
third work ||, finally, he gives “‘ventre anterius vitta laterali
transversim strigosa vel rugosa instructo” to a group of genera
comprising Jecidea Dall., Platycoris Guér., Niarius Stal, Oncocoris
Mayr, Gilippus Stal, Alphenor Stal, and Caridophthalmus Assm.
(Allocotus Mayr, preoce.). Mayr has also seen these organs in
his Oncocoris punctatus, but simply mentions them as a “ schwache
Erhéhung,” without having observed that they are strigose.
That they were not quite unknown to Dallas and Walker, will
be shown below. Distant** has lately removed J/ectdea from the
Halyine, placing it together with a part of the genus Viphe Stal
(Aenaria Dist. nec Stil) in a division which he names Mecidaria,
without mentioning the transversely striolated ventral patches of
Mecidea at all. This is, however, no systematic improvement,
these two genera scarcely having anything in common except the
* Ann. Naturhist. Hofmus. Wien, xv. (1900) pp. 127-141.
+ Entomologist, 1901, p. 9; Journ. Quekett Micr. Club, (2) viii. pp. 33-46 (1901).
{ @tv. Vet.-Ak. Forh. 1867, pp. 491-560.
§ Enum. Hem. ii. p. 17 (1872).
|| Enum. Hem. v. p. 34 (1876).
@ Reise d. Novara, Hem. p. 46 (1866).
«* Rhynch. Brit. India, i. p. 140 (1902).
1905. ] HEMIPTERA OF THE SUBFAMILY HALYIN&, 147
more or less ‘‘elongated body.” Berg* has described two new
genera from the southern parts of South America, Proczelicus
and Lobepomrs, which he says are allied to the genera Amawrochrous
Stal and Oncocoris Mayr; but judging from the descriptions it
seems very doubtful whether they belong here, the more so as
Amaurochrous does not appertain to the Halyineatall. Distant >
has also described an African genus, Crolliws, which he places
near Platycoris, but as nothing is said in the description as to the
presence or absence of the strigose ventral patches, its position is
uncertain, It is said to have the “rostrum about reaching the
anterior cox”; if this be correct, it scarcely belongs to the
Halyine. Besides the seven genera referred to this group by Stal,
there is one described genus which appertains to the same group,
viz. Commius Stil. Stal overlooked the striolated ventral patches
of this genus and therefore incorrectly placed it among the
Pentatomine s. str., near Chaleocoris Dall. For this division of
the Halyine I propose the name Platycoraria; all its genera,
except Mecidea, are Australian, two of them (Oncocoris and
Caridophthalmus) extending to the Austro-Malayan region (New
Britain, New Guinea, Timor, Flores, Ceram).
As Stal= calls the strigose ventral patches of the Tetyraria
“ macule stridulatoric,” but only speaks of “ vitic strigose” in the
Platycoraria, it is evident that he did not recognise their true nature
in the latter division. A close examination of the ventral patches
of the Platycoraria shows, however, that they are perfectly
homologous to the strigose areas of the Tetyraria. As described
by Handlirsch, the stridulatory organs of the Tetyraria are made
up of two different parts—(1) the passive element, consisting of the
strigose ventral patches ; and (2) the active element, consisting of
a series of minute wart-shaped tubercles, bearing a subapical
tooth or bristle and placed on the inner side of the tibie, The
ventral patches are straight and situate on each side of the
median line of the fourth and fifth segments, sometimes extending
to the third or sixth segment; they converge behind and the
striz are arranged longitudinally, beimg nearly parallel to the
axis of the body. When the insect bends the tibia against the
femur and again stretches it, the spinous tubercles of the tibia
pass across the strigose surface of the venter, thus enabling the
insect, by rapidly repeating these movements, to produce an
audible sound. In the Platycoraria both the active and the
passive parts of the stridulatory organ show the same structure
as in the Tetyraria, but the ventral patches are usually comma-
shaped, a little elevated and placed near the base of the venter,
beginning with a rather broad base at the anterior margin of the
second segment and proceeding, gradually tapering and curved
inwardly, to the posterior margin of the third (rarely second)
segment, where they end not far from the median line, The
* An. Soc. Cient. Arg. xxxii. pp. 234 & 236 (1891).
+ Aun. & Mag. Nat. Hist. (7) vii. p. 21 (1901).
~ Enum. Hem. iii. p. 3 (1873).
Os
148 DR. E. BERGROTH ON STRIDULATING [May 16,
patches are transversely strigose in the basal part, but the striz
gradually become more oblique and are often practically longi-
tudinal at the narrow end. From the position of the patches it
is clear that the tibize cannot come in contact with them, and the
active part of the stridulatory organ must be sought for elsewhere.
{ have found it on the inner side of the hind femur, where it
consists of a number of very small spinous knobs arranged either
in a single regular row or in two or three irregular ones. | They
are visible under a common pocket-lens, but under a compound
microscope they present exactly the same structure as the tibial
spinules of the Tetyraria. I propose to call them “ spicula
stridulatoria.” The movements of the femur exactly correspond
to the different direction of the striz of the ventral patches, these
strie being always crossed at a right angle by the “‘ spicula.” By
rubbing the inner side of the femur over the ventral patch I have
experimentally produced a stridulating noise. Stal seems to have
observed the “spicula stridulatoria” in Platycoris and Niarius,
for in his above-quoted paper of 1867 he says they have the
“femoribus posticis intus granulatis.” In his larger work of
1876 he has omitted to mention it.
In his revision of the Hemiptera Heteroptera of the British
Museum, Distant was apparently not satisfied with the state in
which he left the genus Dictyotus. He says* : ‘‘ Dictyotus requires
revision; all the species which Dallas included in his genus do
not appear to be congeneric.” Without having seen Dallas’s types
T had myself, in deterrnining some species of this genus, come to
the same conclusion. In some of his specific descriptions Dallas
speaks of “‘a curved raised line on each side of the second and
third segments” of the venter. Walker has also described his
Mormidea detersa as having the ‘‘abdomen beneath with a short
curved smooth line on each side near the base.” I therefore
suspected that these particular species belong to the genus
Oncocoris, and this supposition has proved to be correct, my
friend Mr. Distant having at my request kindly re-examined the
types of the British authors previously referred by him to
Dictyotus. It is therefore necessary to give a complete revised
list of the species of Oncocoris, which follows here, and which is
essentially founded upon the communications received from
Mr. Distant.
Oncocoris Mayr.
Verh. zool.-bot. Ges. Wien, xvi. p. 362 (1866); Reise d.
Novara, Hem. p. 44 (1866).
Dictyotus Dall. List Hem. Brit. Mus. i. p. 139 (pro parte).
Tarba Walk. Cat. Het. Hem. Brit. Mus. i. p. 236 (1867).
1, ONcocorRIs APICALIS Dall. West Australia.
Dictyotus wpicalis Dall. List, i. p. 141 (1851).
* Aun. & Mag. Nat. Hist. (7) v. p. 388 (1900).
1905. | HEMIPTERA OF THE SUBFAMILY HALYIN&. 149
2. Oncocoris ca@LeBs Fabr. Australia *.
Cimex celebs Fabr. Ent. Syst. iv. p. 111 (1794).
Oncocoris celebs Stal, Hem. Fabr. i. p. 23.
3, Oncocoris ConFrINIS Dall. Australia.
Dictyotus confinis Dall. List, i. p. 143.
4, ONcocoRIS DETERSUS Walk. _ Ceram.
Mormidea detersa Walk. Cat. ii. p. 554 (1868).
Dictyotus detersus Dist. Ann, & Mag. Nat. Hist.-(7) v. p. 388
(1900).
5, Oncocoris DIMIDIATUS Mont. Victoria.
O. dimidiatus Mont. Bull. Soc. Sc. Bucarest, xii. p. 291
(1903).
6. ONCocoRIS DIscoIDEUS Dall. North Australia.
Dictyotus discoideus Dall. List, 1. p. 144.
_ 7, ONCOCORIS FAVILLACEUS Walk. North Australia.
Tarba favillacea Walk. Cat. i. p. 237.
Dictyotus favillaceus Dist. Ann. & Mag, Nat, Hist. (7) ve
p. 484 (1899).
8, OncocorIs GENICULATUS Dall. South Australia.
Dictyotus geniculatus Dall. List, i. p. 142; Dist. l.c.
Dictyotus lineatus Walk. Cat. i. p. 181.
9, ONCOCORIS INSULANUS Bergr. New Britain.
O. insulanus Berger, Rev. d’Ent. x. p. 202 (1891).
10. OncocoRis LETHIERRYI Mont. Australia.
0. lethierryi Mont, Bull. Soc, Sc. Bucarest, xii. p. 294 (1903).
11, Oncocoris MopEstus Horvy. New South Wales.
O. modestus Horv. Term. Fiiz. xxv. p. 601 (1902).
12, OncocorIS OVALIS Berer., infra, p. 153. Queensland.
13. Oncocoris PuNcTATUS Mayr. New South Wales,
O. punctatus Mayr, Verh. zool.-bot. Ges, Wien, xvi. p, 362
(1866); Reise d. Novara, Hem. p. 46, tab. 1. fig. 6.
14. ONCOCORIS SEMIMARGINATUS Westw. West Australia.
Pentatoma semimarginata Westw. Cat. Hem. Coll. Hope, 1.
p. 42 (1837).
Dictyotus semimarginatus Dist. P.Z.8. 1900, p. 810.
15. Oncocoris stmiuis Dall. Tasmania.
Dictyotus similis Dall. List, i. p. 143; Dist. Ann. & Mag. Nat.
Hist. (7) iv. p. 434 (1899).
Pentatoma truncatula Walk. Cat. ii. p. 311 (1867).
__% Fabricius gives no nearer habitat; I possess examples of the species from
Queensland,
150 DR. E. BERGROTH ON STRIDULATING [May 16,
16. Oncocoris suBsIMILIS Mont. Victoria.
O. subsimilis Mont. Bull. Soe. Se. Bucarest, xii. p. 293 (1903).
17. ONCOCORIS TRANSVERSUS Car'p. Murray Isl.
Dictyotus transversus Carp. Proc. Roy. Dublin Soe. vu.
p. 138, pl: xa £1 (US3p):
18. ONCOCORIS TRUNCATELLUS Walk. Australia.
Eysarcoris truncatellus Walk. Cat. 111. p. 558. é
Dictyotus truncatellus Dist. Ann. & Mag. Nat. Hist. (7) iv.
p. 434 (1899).
19. ONCOCORIS VENTRALIS Walk. North Australia.
Mormidea ventralis Walk. Cat. iii. p. 555. :
Dictyotus ventralis Dist. Ann. & Mag. Nat. Hist. (7) iv.
p. 434 (1899).
The species of Oncocoris are very similar in facies to those of
Dictyotus, but, apart from the stridulatory patches, are easily
distinguished by having the antenniferous tubercles visible from
above and the metasternal orifice prolonged in a keel.
Before proceeding to describe some new forms of this group,
I may remark that in Oncocoris and Commius the ‘“ spicula
stridulatoria” are arranged in a single straight row, whilst in
Platycoris and Niarius they are placed in two or three irregular
rows. The other described genera of the group are unknown
to me.
NIARIUS TRYONI, sp. n.
Ovatus, opacus, niger, subtiliter sat dense punctulatus, supra
callulis minutis flavidis conspersus, vitta swperiore posteriore
et margine angusto laterali capitis, basi hujus subtus, basi
articuli primi, tertii quartique antennarum, rostro (articulo
ultimo excepto), limbo laterali prothoracis et partis basalis
corti, epipleuris, macula prope angulos basales et «pice
seutelli, macula oblonga laterali intus rotundata segmentorum
abdominalium, acetabulis pedibusque (annulo anteapicalt
femorum excepto) flavo-ochraceis, ventre medio impunctato,
dilute piceo, nitido. Articulus primus antennarum apicem
capitis haud attingens, secundus duobus wultimis wiitis
equilongus, tertius et quartus subeque longi. Pronotwm
lateribus leviter sinwatum. Scutellum apice impunctatum.
Hemelytra apicem abdominis attingentia, corio basin segmenti
sextt connexivt superante. Segmentwum genitale maris medio
segmentis tribus precedentibus unitis subeequilongum. (Pedes
postici desunt.)
Long. 5 10 mm.
Queensland.
Allied to WV. dluminatus Dist., but in Distant’s species the
1905. | HEMIPTERA OF THE SUBFAMILY HALYINA. 151
head, pronotum, and scutellum seem to be differently sculptured,
and there is no annulation to the femora.
LEVENNA, gen. nov.
Caput longitudine latius, leviter convexum, apice rotundatum,
marginibus anguste refleais, ante oculos magnos globosos
sinuatis, tylo et jugis wque longis, illo postice elevato, his
antice valde approuimatis, ocellis majusculis, in linea wneter
marginem posticum oculorwm ducta positis, a linea media
capitis quam ab oculis saltem duplo et dimidio longius
distantibus, bucculis humilibus, rectis ; rostro coxas posticas
attingente, articulo secundo duobus apicalibus wiitis breviore,
tertio quarto longiore, tuberculis antenniferis @ supero
distinguendis, extus spinula porrecta armatis ; antennis
quadri-articulatis, articulo primo apicem capitis paullum
superante, secundo longissimo. Pronotwm medio capite
parum longius, marginibus lateralibus anticis acutis, leviter
explanatis et reflexis, angulis lateralibus haud prominulis,
anguste rotundatis, angulis basalibus latissime rotundatis,
margine basalirecto. Scutellum pone medium leviter sinwatum.
Mesosternum carinatum. Orificia metasternalia m rugam
mediocrem continuata. Hemelytra apicem abdominis longe
superantia, corio apicem abdorinis subattingente (3 ) vel hoc
puullo breviore (2), margine apicali levissime sinuato, angulo
upicali acuto, membrana venis circiter sex instructa, exterioribus
tribus furcatis et pone medium vena transversa conjunctis.
Ale apicemabdominis superantes, sed hemelytris paullo breviores.
Abdomen hemelytris haud vel vix latins, subtus utringue prope
basin vitta stridulatoria curvata usque ad apicem segmente
tertii pertracta instructum, segmentis quingue primis ventralibus
in mare medio valde retractis, quam lateribus fere triplo
brevioribus, segmento sexto hujus sexus permagno, precedentibus
unitis medio longiore, angulis apicalibus hujus segmentt in
mare latissime rotundatis, fere deletis, margine apicali recto,
in femina obtusiusculis, margine apicali late arcuato-sinuato,
segmento genitali maris latissimo, angulis apicalibus productis,
margine basali sub segmento sexto ventrali subocculto, medio
processu liguliformi verticaliter recurvo instructo. Pedes
longiusculi, femoribus posticis intus spiculis stridulatorus
umseriatis instructis; tibtis omnibus femoribus subequilongis,
superne sulcatis ; tarsis triarticulatis, articulo primo tarsorum
posticorum tncrassato.
This remarkable genus is to be placed near Commius Stal, but
is at once distinguished by the four-jointed antenne, the very
long hemelytra, and the enormously developed sixth ventral and
genital segments in the male. The considerable length of the
hemelytra is probably due to the necessity for preserving the
inner parts of the very wide and open male genital segment from
injury.
=
152 DR. E, BERGROTH ON STRIDULATING [May 16, |
LEVENNA SALAX, sp. n.
Supra niger, sat dense et fortiter punctatus, linea longitudinali
media plus minusve distincta verticis, vitta vel linealongitudinali
media interdum medio late interrupta pronoti hujusque limbo
laterali ab angulis apicalibus ultra medium interdumque
etiam margine postico, macula parva ad angulos basales,
maculis duabus mediis magnitudine variabilibus fasciaque
subapicali scutelli, fascia corii ab angulo apicali interno ad
marginen costalem ducta ibique dilatata segymentisque connewiri
basi flavis, remote fusco-punctatis, venis membrane presertim
apice sepe pallescentibus. Ale fusco-violacee. Caput subtus
cum rostro et antennis violaceo-nigrum, bucculis scepeque
macula utrinque adjacente flavidis. Pectus violaceo-nigrum,
limbo laterali prosterni ab apice ultra medium, carina media
et margine laterali mesosternit ac limbo postico metasterni,
interdum etiam acetabulis omnibus et prosterno medio, flavis.
Abdomen subtus flavo-testaceum, disco medio interdum rufo-
piceotincto vel segmento sexto medio macula fusca notato, limbo
laterali ventris violaceo, macula quadrata ad angulos basales
segmentorum flavida cum disco ventris interdum confluente
signato. Pedes nigro- vel fusco-violacei, femoribus posterioribus
interdum basin versus flavescentibus. Caput subtus et pectus
remote punctulata, articulo secundo antennarum tertio fere
dimidio vel saltem tertia parte longiore, tertio et quarto
subeque longis. Pronotum longitudine media fere duplo et
dimidio latius, marginibus lateralibus rectis. Abdomen subtus
impunctatum, appendicibus duabus internis (lateralibus,
Sharp) segmenti genitalis maris longe subulatis.
Long. 3 6-76 mm., cum membr. 8-9°6 mm. 2 7:8 mm., cum
membr. 9°8 mm.
Queensland ; South Australia (Yorketown).
CoMMIUS MINOR, sp. n.
| Flavus, capite (exceptis bast subtus, macula triangulari ab hac
ad tubercula antennifera ducta bucculisque), maculis duabus
magnis transversis triangularibus anticis pronoti, macula
magna basali triangulari seutelli medium hayjus attingente
maculaque ejusdem angusta elongata marginali pone medium,
meso- et metasterno medio (carina illius excepia), macula
magna pleurarum, maculis quingue ventralibus, una utrinque
sublaterali segmenti quarti et quinti et wna magna media
segmenti sexti, maculaque transversa segmenti genitalis maris
violascenti- vel viride-ceneis, maculis duabus magnis basalibus
bast contiguis pronoti fuscis, hemelytris subpurpureo-fuscis,
opacis, levissime cenescentibus, corio fascia fava inter angulum
apicalem internum et marginem costalem ornato; antennis,
rostro pedibusque castaneis, his cenescentibus. Caput vertice
medio et pone juga remote subtilissime punctulatum, jugis
oblique strigosis, articulo secundo antennarum primo plus
1905. | HEMIPTERA OF THE SUBFAMILY HALYINA. 153
quam dimidio longiore, tertio secundo tertia parte longiore
(cetert desunt). Pronotwm medio capiti subequilongwn,
remotissime et subtilissime punctulatum, marginibus lateralibus
anticis subrectis. Scutellum remotissime et subtilissime, pone
medium latera versus fortius punctulatum. Hemelytra
apicem abdominis attingentia, clavo et corio remote subtiliter
punctulatis, margine apicali hujus exterius levissime sinuato.
Pectus remote punctulatum, pleuris medio levibus. Abdomen
impunctatwm, segmento sexto ventrali maris medio segmentis
tribus antecedentibus unitis cquilongo, segmento genitalr
maris margine apicali segmenti ultimi ventralis paullo latiore,
appendicibus internis (lateralibus, Sharp) faleiformibus, dilute
piceis (in elegante longioribus, nigris).
aa 3b Imm.
Queensland.
Much smaller than C. elegans Don. and differently coloured,
with the pronotum much shorter, the hemelytra also shorter,
the apical margin of the corium much less sinuate near the
apical angle, and the genital segment of the male much broader.
ONCOCORIS OVALIS, sp. n.
Ovalis, livido-testaceus, modice dense sat fortiter nigricanti-
punctatus, ventre medio remote punctato, limbo laterali prosterni
et ventris impunctato, articulo ultimo rostri, vitta angusta
sublaterali paullo curvata dimidii antici pleurarum, macula
oblongula ante angulos posticos prosterni, mesosterno medio
(carina excepta), macula magna transversa basali ventris,
macula media segmenti equs sexti maculaque parva ad angulum
basalem et apicalem segmentorum connexivi et ventris nigrinis.
Caput pronoto medio subequilongum, tylo et jugis eque longis,
rostro coxas posticas superante ; (antennce desunt). Pronotwm
longitudine media duplo et dimidio latius, marginibus
lateralibus subrectis, angulis lateralibus levissime eminulis,
obtusis. Scutellum maculis quingue minutis basalibus et
summo apice impunctatum. Hemelytra apicem abdominis
superantia, corio areolis aliquot impunctatis predito, membrana
JSusea,venis albo-cinerascentibus. Abdomen hemelytris subeque
latwm. Pedes maculis punctiformibus nigrinis conspersi,
femoribus posticis medium segmenti sewti ventris paullum
superantibus, spiculis stridulatoriis fusco-ferrugineis.
Long. 2 8 mm.
Queensland.
HURYNANNUS, gen, noy,
Corpus parvum, late breviter rotundato-ovale. Caput planius-
culum, dimidio basali partis anteocularis antrorsum admodum
angustato, lateribus obtusissimis, convexis, in tubercula
antennifera continuo transeuntibus, dimidio ejus apical
parallelo, apice late rotundato et medio levissime inciso,
lateribus acutis, gugis tylo longioribus et ante hunc contiguis,
154 STRIDULATING HEMIPTERA OF THE HALYINE. [May 16,
oculis minutis, brevissime stylatis, ocellis perminutis, ab oculis
ac linea media capitis subceque longe distantibus, mox pone
lineam inter marginem posteriorem oculorum fictam positis,
vertice oculo circiter septuplo latiore, tuberculis antenniferis e
supero distinguendis, antrorsum convergentibus, apice extus
spinuloso-productis ; antennis ab oculis et ab apice capitis
subeque longe insertis, quinque-articulatis, articulo primo
apicem capitis haud attingente, bucculis humilibus, rectis ;
rostro coxas posticas paullum superante, articulo secundo
apicalibus duobus subceequilongis wunitis paullo breviore.
Pronotum medio capiti subequilongum, marginibus lateralibus
anticis leviter rotundatis, antice leviter sinwatis, margine
postico rotundato, angulis lateralibus vix eminulis, obtusis.
Scutellum subeque longum ac latum, parte apicali latiuscula,
Srenis medium scutelli paullum superantibus. Sterna medio
suleata ; orificia in rugam longiusculam oblique antrorsum
producta. Hemelytra apicem abdominis paullum superantia,
margine apicali corti levissime sinuato, membrana paucinervi.
Abdomen hemelytris parwm latius, subtus prope basin utrinque
vita stridulatoria curvata ad apicem segmenti tertii extensa
instructum. Pedes mediocres, femoribus posticis intus spiculis
stridulatorus wniseriatis instructis, tibiis femoribus sub-
cequilongis, supra sulcatis, tarsis triarticulatis.
Easily distinguished from Oncocoris by the structure of the
head, the very small substylated eyes, and the short and broad
body.
HURYNANNUS LIPPUS, Sp. n.
Ochraceus, opacus, sat dense ferrugineo-punctatus (disco ventris
tamen remotissime punctato), wbique maculis minutis nigris
remotissime adspersus, macula parva nigra ad angulos basales
et upicales segmentorum abdominalium notatus. Caput longi-
tudine paullo latius, rostro apice nigro ; antennis ochraceis,
articulo tertio apice a duobus ultimis totis dilute Serrugineis,
articulo secundo primo duplo longiore, tertio primo dimidio
longuore, quarto secundo subequilongo, quinto quarto equilongo
vel paullo longiore. Pronotwm capite duplo latius. Scutellum
mox pone medium levissime sinuatum. Membrana cinerea,
maculis minutis nigris remote conspersa. Abdomen (3)
dorso apice arcuato-sinuatum, segmento ventrali sexto apice
medio subrecto, latera versus levissime sinuato, medio segmento
quinto duplo longiore, segmento genitali perpendiculari, ultra
segmentum ultimum abdominale haud producto. Pedes
maculis punctiformibus iigris remotissime conspersi, femoribus
posticis apicem abdominis attingentibus, spiculis stridulatoriis
ferrugineis.
Long. 3 5:6 mm., lat. 4:3 mm.
(Queensland.
1905. | ON THE ANATOMY OF LIMICOLINE BIRDS. 155
5. On the Anatomy of Limicoline Birds; with special
Reference to the Correlation of Modifications. By
P. Cwaumers Mrrcuent, M.A., D.Se. (Oxon.),
Secretary to the Society.
[Received May 16, 1905. |
(Text-figures 23-28.)
In this memoir I use the term Limicole in the sense of
Gadow (3) as a major subdivision of the Order Charadriiformes.
I have dissected examples of the following forms, and where, in
this paper, I refer to family-characters, I must be understood as
limiting my remarks to the birds I have myself dissected, unless I
definitely state otherwise :—
Suborder Limicoa.
Family Charadriide ...... Charadrius pluvialis.
Timantopus nigricollis.
Vanellus vulgaris.
Gallinago celestis.
Rhynchea capensis.
Scolopax rusticola.
Chionide............ Chionis alba.
Glareolide ......... Glareola pratincola.
Thinocoride ...... Thinocorus species @
(Edicnemide ...... “dicnenus scolopax.
Paaridee. apices. Hydrophasianus chirurgus.
The greater part of the actual dissection was completed in
1902, in continuation of my work on Gruiform Birds (7); pressure
of other duties has made it impossible to finish it sooner. JI am
indebted to the facilities afforded by this Society in the prosectorium
at the Gardens for the material, and to my friend Mr. F. E.
Beddard, F.R.S., the Society’s Prosector, for much kindly interest.
DIASTATAXY IN THE LIMICOLA.
In the arrangement of the feathers on the wing, all Limicoline
birds are closely similar. They are diastataxic in the most typical
form. The condition in Chionis alba (text-fig. 23, p. 156) may
serve as an example. Along the edge of the ulna, from the wrist
towards the elbow, the great quills with their associated coverts
are arranged in an orderly series, but after four of these rows, each
headed by a quill, there is a row from which the quill is missing,
forming the diastataxic gap (text-fig. 23, x, p. 156). The carpal
remex and covert are present (C.R., C0. ), the covert, in most cases
(although not in Chionis), beimg ‘conspicuously larger than the
remex. These two feathers lie closer to the most pr oximal primary-
156 DR. P, CHALMERS MITCHELL ON THE © | May 16,
quill than to the most distal secondar -quill in most Limicole,
but the position varies, and that shown in the diagram is more
primitive. As evidence of their association with the secondary
series, there is to be taken into account first the fact that the
covert crosses the remex as in the secondary rows, not lying distal
to it as in the primaries, and, secondly, that a plica (pl.), to
which I have called attention in other groups (4 and 5), unites the
carpal remex with the most distal secondary remex.
Text-fig. 23.
A
S
Wing-structure of Chionis alba.
V/-c. R
C.C.
Diagram of the distal secondary quills and coverts,
showing the diastataxic arrangement.
S. First secondary. P. First primary. «. Diastataxic gap. C.R. Carpal remex.
C.C. Carpal covert. PI. Plica, binding carpal covert to first secondary.
The condition of the wing in the Limicole is similar to that
found in the greater number of the Columbe, but whereas in some
Columbee (4) the eutaxic condition is found—or, as I have tried
to show, has been attained,—it has not been attained by any of
the Limicole, In the Gruiformes: a somewhat incoherent group
certainly closely related to the Charadriiformes, both conditions
of the wing are present (7).
GUT-PATTERNS IN THE LIMICcOLa.
T have already shown (6) that the pattern of the gut in Limicole
is of considerable interest. It displays a configuration which
differs from the pattern which is archecentrice for all birds in a
fashion similar to the divergence shown by the Gruiform birds,
1905. | ANATOMY OF LIMICOLINE BIRDS. 157
and notably different from that of the Columbe, or, indeed, of any
other group except the Lari. The duodenal loop is simple and
definite (text-figs. 24 and 25, A-B); the portion of Meckel’s tract
proximal to Meckel’s diverticulum (Div.) tends to be enlarged in
such a way that the diverticulum is not at the apex of a loop as
in Columbe or Passeres, but on the distal limb of a loop, which
is short in the forms which are less specialised in this respect,
such as the Chionide, Glareolidee, Thinocoride, Cidicnemide,
and the simpler Charadriide (such as Mumeniws and Vanellus),
Text-fig. 24.
R
Diagram of intestinal pattern of Rhynchea capensis.
A. Cut proximal end of duodenal loop. B. Distal end of duodenal loop.
Div. Meckel’s diverticulum. C. Origin of ceca. R. Cut end of rectum at cloaca.
but which in other Charadriidz and Parride (such as Scolopaa,
Himantopus, and Hydrophasianus) is elongated and _ spirally
twisted. The portion of Meckel’s tract between this and the
duodenal loop is ill-defined in the simpler forms, but in others
tends to be thrown into a definite narrow loop. The portion pos-
terior to the diverticulum is in close relation to the colic cxca,
which are long in the simpler forms (text-fig. 24, C.), but become
158 DR. P. CHALMERS MITCHELL ON THE | May 16,
almost atrophied in the more specialised types of gut-pattern—
as, for instance, in Hydrophasianus (text-fig, 25, C.).
With regard to these two features of their structure, the con-
ditions of which in Birds generally are pretty well known, the
position of the Limicole is easy to define. In wing-structure they
are diastataxic, like all but the most specialised Columbe, and like
many of the Gruiformes. In the gut-pattern they are not much
modified from the archecentric condition, but the modification is
definite, characteristic, and progressive, and, in its simpler form,
Text-fig. 25.
o
a:
Diagram of intestinal pattern of Hydrophasianus chirurgus.
Lettering as in text-fig. 24.
similar to that shown by the Gruiformes. In the more specialised
types the elongation and spiral twisting of a portion of Meckel’s
diverticulum brings about a superficial resemblance with the
arrangement in the long-gutted Columb and Passeres, but the
morphological condition is different, as a different portion of
the intestinal tract is affected. I shall now endeavour to set
out the chief modifications in muscular anatomy that I have found
to be of interest in these birds.
MuscuLar ANATOMY.
Latissimus dorsi anterior et posterior.—The anterior division in all
these birds is a broad flat muscular strap, without any peculiarities.
1905. ] ANATOMY OF LIMICOLINE BIRDS, 159
Its insertion is muscular, and just below that of the posterior
division (text-fig. 26, L.A. and 3). The posterior division is absent
in Scolopax, present in the others, and its proximal edge touches
the distal edge of the anterior division in Wdicnemus (text-fig. 26,
L.P. and 4) and Hydrophasianus, but not in the others. In Hydro-
phasianus and @dienemus the two muscles are almost continuous,
although they cross before insertion, at which point they are closely in
contact ; whilst in the others the tendon of the posterior division is
separated by a short gap from the muscular and more distal insertion
to the humerus of the anterior division; this tendon is always
in close association with the humeral anchor of the anconeeus.
Text-fig. 26.
Shoulder-muscles of Gdicnemus scolopazx.
Left shoulder ; external view.
2, Tendon of supra-coracoideus. A.S. Anconeus scapularis, the reference lines
pointing respectively to the humeral origin and the scapular anchor. S.A.
Scapuli-humeralis anterior. §S.P. Scapuli-humeralis posterior. S. Expansor
secundariorum. L.A. Latissimus dorsi anterior. L.P, Latissimus dorsi
posterior. 3. Insertion of lat. dors. ant. 4. Common insertion of lat. dors.
post. and humeral anchor of ancon. scapularis.
The posterior division, where present, tends to spread backwards
to reach the ilium and part of the ribs. In Chionis its origin is
limited to the vertical anterior edge of the ilium, whilst the gap
between it and the anterior muscle is wider than in any of the
other birds.
The archecentric, or most generalised, condition of these muscles
in Birds appears to be the existence of an anterior and posterior
division, fairly well separated at their origins and close together
160 DR. P, CHALMERS MITCHELL ON THE | May 16,
at their insertions. Any well-marked deviation from this condition
may be regarded as derivative. I have shown that in the more
specialised Columbide the posterior division of the muscle tends
to disappear (4); in the Kingfishers the anterior division sunilarly
is in progressive diminution (5); in most of the Gruiform birds
the anterior division is less strongly marked, whilst the posterior
division tends to increase greatly in size and strength, whilst in
the Crane and Bustard it is the posterior division which dis-
appears (7). In the Limicoline birds generally the anterior
division remains in the primitive condition, whilst the posterior
tends to enlarge as it does in the Rails, the enlargement being
specially a backward and downward extension of the origin. On
the other hand, in the Woodcock, as an exception, there is a
disappearance of the posterior division.
Latissimus dorsi imetapatagialis. —This muscle is probably
present in all these birds, but it is very slightly developed and apt
to be removed in the process of skinning.
Rhomboideus superficialis et profundus— OF these two muscles,
the superficial is phylogenetically older. In all these birds it is
the thinner of the two muscles, but is longer, being longest in
Udienemus and Chionis, whilst it shows a general tendency to die
away posteriorly. In Chionis it is nearly divided into a proximal
and distal portion by a thin central area, a secondary cleavage which
is well marked in the deep muscle of the eutaxic Kingfishers.
The deep muscle in Hydrophasianus is almost of the same length
as the superficial muscle and it is difficult to separate the two. In
the others it is well separated by its greater thickness and by the
slope of its fibres upwards and for wards from the scapula to the
vertebre. Its origin begins at the extreme posterior end of the
scapula and extends forwards under the origin of the superficial
muscle, but never reaching so far forwards.
In the condition of these muscles, then, the Limicolz are fairly
homogeneous; the older superficial muscle is well developed,
extending in front of the deep muscle, but, except in Scolopaw,
leaving a portion of it exposed behind. The deep muscle has made
comparatively little progress in forward extension along the line
of the scapula and clavicle.
Biceps brachialis——This muscle displays in Wdienemus the
condition normal in the majority of birds; it arises by a narrow
tendon from the acrocoracoid, and by a broad tendon from the
proximal end of the humerus; the rounded belly runs down the
arm and ends in a forked tendon, the thicker fork being inserted
to the radius, the thinner to the ulna. No doubt, fleshy origins
must have preceded tendinous origins, and there is considerable
variation as to the relative size of the two origins and insertions in
different birds; but the @dicnemus condition is a fairly central one,
and it is interesting to notice that in this respect @dicenemus stands
apart from other Limicoline birdsand might be associated with many
other groups. In Hydrophasianus there is a comparatively slight
deviation from the normal, consisting in the complete disappearance
1905. ] ANATOMY OF LIMICOLINE BIRDS. 161
of the humeral head. This has already been noted by Fiirbringer
and Beddard (1 and 2), and the latter author states that he found
a similar reduction in Rhynchea. In the example of Rhynchea
that I dissected, however, I found a very different condition, the
well-marked occurrence of a peculiar Limicoline deviation which
occurs in a more or less modified form in all the other birds which
form the subject of this paper.
The Limicoline peculiarity of the biceps brachialis is well
marked in Chionis (see text-fig. 27). The main mass of the
Text-fig. 27.
AG
Biceps of Chionis alba.
AC. Coracoid head. BI.P. Biceps patagialis. BI. 1. Chief portion of biceps.
BI. 2. Accessory biceps. R. Radial insertion. U. Ulnar insertions.
muscle arises by a tendon from the acrocoracoid (AC.) and by a
large and fleshy head from the humerus (BI. 1); this tapers
towards the lower end of the humerus and then divides into a
Proc. Zoot. Soc.—1905, Vou. II. No. Xi. 11
162 DR. P. CHALMERS MITCHELL ON THE [| May 16,
large tendon inserted to the radius (R.) and a very small tendon
to the ulna (U.). There is also a second belly, smaller and rounder,
arising almost wholly from the coracoid tendon of origin (BI.2), and
towards the lower end of the humerus passing into a round tendon
which is inserted to the ulna only (U.), distal to the insertion
of the ulnar branch of the tendinous fork of Biceps 1. This
doubled condition of the biceps is practically repeated in Scolopax,
except that Bi. 1 appears to supply only the tendon to the radius,
and the same state of affairs is present in Gallinago, Charadrius,
Himantopus, Vanellus, and Rhynchea. It occurs also in Glareola
and in Thinocorus, but in the latter the humeral head is
degenerate although present.
This complication of the biceps shows a link between the
Charadriidee, through Chionis, with a more exaggerated peculiarity
in some of the Gulls. The condition in Scolopax differs from that
in Chionis practically only in the tendon of Bi. 1 in the latter
being forked so as to be inserted both to the radius and ulna. If
we suppose this fork in Chionis to be split up into the body of the
muscle so as to separate the portion of the belly arising from the
acrocoracoid tendon from the portion coming from the humerus,
the Gull condition would be reached. In Larus, for instance, the
tendon of origin arising from the acrocoracoid divides into two
fleshy bellies, the one representing Bi. 2 in text-fig. and running
to the ulna, the other, fused with Bi. 1 in the figure, running
independently to the radius. As there is very strong evidence of
other kinds for supposing that the Gulls are modified from a
Gharadriiform stock, it would seem natural to suppose that here
we have to deal with a case of progressive complexity, starting
from the Scolopax condition and leading through Chionis to the
Gull condition. But it is important to remember that, in cases
of muscles and tendons of birds, the general morphological course
is from the more complex to the simpler, and, to my mind, it is
more probable that the Scolopax and general Limicoline condition
is a simplification from the Gull condition, Chionts showing how
the simplification may have come about.
Deltoidis patagialis—This muscle is of moderate width in all
these birds, and gives off the longus and brevis tendons from its
relatively broad distal extremity, with not more than the slightest
indication of division into peaks for the different tendons, and so
far remaining in a primitive or archecentric condition. With
regard to the tendons, Wdicnemus displays a condition markedly
different from that found in all the others. The longus tendon is
simple and slender ; it has an anchor to the humerus, and, after
being joined by the biceps slip, gives off one or two very weak
slips of fascia to the patagium, and then takes the usual course
towards the wrist. The brevis tendon is simple, flat, and well
marked ; it runs an undivided course towards the elbow, parallel
with the biceps, and, close to its insertion, broadens out into a
fan-shaped termination, which displays in a reduced condition the
three slips named respectively a, 8, y by Firbringer. In all the
1905. ] ANATOMY OF LIMICOLINE BIRDS. 163
other birds on my list the condition is much more complex, but
as the complexity is similar in all, it is unnecessary to add to the
figures given on plate xxi. of Fiirbringer’s great monograph (2).
The longus tendon has an anchor to the humerus in all: it is
broad and partly doubled in Chionis, Scolopax, Vanellus, and
Himantopus ; it is single in Glareola, Thinocorus, Hydrophasianus,
Charadrius, Rhynchea, and Gallinago, although in these a greater
width in the elastic portion shows a tendency to duplication. In
all, from just below the middle of its course, it sends a tendinous
anchor inwards and downwards to join with the a portion of the
brevis tendon ; the width of this anchor and the exact point and
mode of junction with the brevis tendon differ, but the details do
not appear sufficiently important for individual description. The
brevis tendon is doubled in all, the duplication being complete
from origin to insertion. A well-defined tendon nearest to the
biceps runs towards the elbow, where it is practically free from
the second portion of the brevis; its extremity corresponds
with y of Fiirbringer and it occasionally turns in towards the elbow,
or may run a straight course towards the ulnar margin of the arm.
The second division of the brevis is stronger and wider; it runs
parallel with the latter, and nearer the longus tendon. At its
distal extremity it divides into two well-marked slips—the proximal,
being the # of Fiirbringer and spreading out into a fan running
tonal ds the ulnar margin of the arm, whilst the more distal,
the a of Fiirbringer, receives the anchor from the longus.
Pectoralis propatagialis—This slip is present in all the birds
on my list. Leaving the pectoralis major it joins the deltoides
patagialis before the muscular part of that muscle has given off
the longus and brevis tendons, but its fibres run towards the
longus rather than to the brevis. It is weakest in Glareola and
Thinocorus.
Biceps patagialis.—This muscular slip, to the presence or absence
of which Garrod attached so much importance, is present in all
these birds and joins the longus. It is much weaker in Glareola
and Hydrophasianus, where it is little more than a tendon. In
Edicnemus it sends a slip to the patagium, recalling the arrange-
ment which I have described in Heliornis (7, text-fig. 78, p. 640).
Its length varies, it being much longest in Himantopus, where its
distal end nearly reaches the radial margin of the arm—an
extremely specialised condition. Where the biceps is double, the
origin of the biceps patagialis is sometimes from both portions (text-
fig. 27, BI. P. p. 161), but in other cases it comes from the acro-
coracoid head only, and in others again from the humeral head.
The condition of these alar muscles and tendons is of con-
siderable interest. The first salient point is that Mdicnemus
stands markedly apart from the others, showing in these
structures, as in the biceps, an arrangement much more resembling
that found in the Gruiformes, and, indeed, in many other birds,
than the typical Limicoline condition. On the other hand, just
as the complexity of the biceps in the Limicole recalls the similar
ie
164 DR. P. CHALMERS MITCHELL ON THE [May 16,
complexity in Gulls, so Gulls exhibit the doubling of the brevis
tendon and the anchor from the longus to Fiirbringer’s a, which
are the conspicuous features of the Limicoline alar complex.
The general trend of change in the formation of the alar tendons
seems to have been, first, the formation of distinct tendons from a
series of scattered fasciz and cutaneous slips, and next a reduction
of the complex tendons to a more and more simple form. The
most ready interpretation of the facts appears to me to be that
in the ancestors of the Laride and Limicole a complex and
specialised alar series of tendons had been elaborated; this
condition has been retained by the Gulls and by most of the
Limicolous birds, whereas in the Gruiformes and in Wdicenemas
it has more or less completely disappeared, leaving traces such as
the separation of the distal fan of the brevis into the small
divisions which can be recognised as the a, 3, y of Fiirbringer.
Deltoides major et minor.—In all these birds both muscles are
present and display little divergence. The minor is extremely
small in Chionis, Gallinago, and Hydrophasianus; m the others
it is normal. The major isa muscle which in many birds displays
a progressive tendency to creep down the humerus. It is shortest
in Hydrophasianus, not reaching more than three-eighths of the
proximal end of the humerus, and is without the usual scapular
anchor. In Gallinago it reaches rather less than halfway down
the humerus, in Zhinocorus rather more; in the others nearly
an exact half, the scapular anchor being well marked in all but
Hydrophasianus.
Scapuli-humerales anterior et posterior (text-fig. 26, p. 159).—
The posterior muscle(S8.P.) is present in all these birds and is
large and important, converging from an extensive origin
occupying the greater part of the scapula toa rounded tendon
inserted to the median process of the humerus. The anterior
muscle (8.A.) is small and occupies the usual position across the
angle between the scapula and the humerus. It is normal in
Edienemus and Hydrophasianus, very small, merely a few fibres,
in Glareola and Thinocorus. In Charadrius it is small but quite
distinct, whilst in Himantopus it is represented by a narrow
band of fibres. In Chionis, Vanellus, Rhynchea, Gallinago, and
Scolopax it is absent.
There seems little doubt but that the normal, or archecentrie,
condition in Birds is for both divisions of the muscle to be present,
whilst the anterior division is frequently absent. The Limicole
obviously form a group with a marked tendency to the disap-
pearance of this muscle, but there is no special correlation between
specialisation in other directions and the degree au reduction of
the muscle.
Expansor secundariorum.—The specialised bined of the
anconeus to which Garrod gave the name of ‘expansor
secundariorum ” is a muscle in obvious course of disappearance in
this group. It is present in a well-marked condition in
Gdicnemus (text-fig. 26, 8., p. 159) and Hydrophasianus. Its
1905. | ANATOMY OF LIMICOLINE BIRDS. 165
proximal portion is well marked in Scolopax, Himantiopus,
Gallinago, Rhynchea, Vanellus, Charadrius, Thinocorus, and
Glareola, but it disappears before reaching the elbow. It 1s
absent in Chionis.
Ilio-tibialis internus seu sartorius.—This muscle is practically
identical in all the birds on my list. It arises from the anterior
edge and a narrow portion of the anterior dorsal extremity of
the ilium, and has the usual insertion to the fascie over the
knee-capsule. In most cases, it shows little sign of fusion with
the anterior edge of the ilio-tibialis.
Iio-tibialis.—In all these birds this muscle is large, the post-
acetabular portion having a strong fleshy origin, whereas the
anterior portion is more membranous.
Iio-trochanterici posterior, anterior ct medius.—These muscles
are all present in typical form in these birds, except that in
Thinocorus, Edicnemus, and Hydrophasianus the anterior and
medius are nearly fused, showing only a trace of separation at
their tendon of insertion to the femur.
Nio-trochantericus externus.—This variable muscle is present
in all these birds, but is extremely small in Zhimocorus.
Ambiens.—This important muscle is present in all the birds
on my list, and, in the normal fashion, ends in a tendon which
passes through the capsule of the knee-joint and is reinforced
(except in Chionis) by a ligament from the head of the fibula,
finally forming one of the heads of origin of the muscle complex
which gives rise to the perforated flexors of the second, third, and
fourth digits.
Femori-tibiales sew Crureus and Vastus.—These muscles are
alike in all the birds on my list, corresponding almost exactly
with the condition I found in Gruiform birds (7), with the
exception that in Thinocorus the femoro-tibialis externus is not
developed as a separate slip.
Caud-ilio-femoralis (Femoro-caudal and accessory F.-c.) (text-
fig. 28, p. 166).—The condition of these muscles, to which the
researches of Garrod, Forbes, and Beddard have given special
importance, differs in @dicnemus from that found in the others.
In @dicnemus, as in Otis and many Gruiform birds, the portion
with a caudal origin (“ femoro-caudal ” of Garrod) is totally absent ;
the portion arising from the ilium (“accessory femoro-caudal” of
Garrod) is present and has the usual relations, but displays a
considerable tendinous area in the middle of its muscular belly—
an obvious sign of degeneration, to which I have already called
attention (7).
The condition in Chionis (text-fig. 28, p. 166) is more generalised.
Both muscles are present, the caudal portion (CAUD. IL. F. 2)
displaying a fairly large rounded belly, which tapers to the tendon
of origin which is inserted to the femur just distad of the in-
sertion of the iliac portion. The iliac portion (CAUD. IL. F. 1)
has a fan-shaped origin from the ilium, displaying on its proximal
border a well-marked area of tendinous degeneration (X), and is
166 DR. P. CHALMERS MITCHELL ON THE [May 16,
inserted to the femur along a narrow vertical line. In Vanellus
the caudal portion is very large, whilst the accessory portion 1s
present, but minute and with a tendinous degeneration similar
to that just described. In Thinocorus, Hydrophasianus, and
Rhynchea both portions are present and large. In Glareola,
Charadrius, and Himantopus the caudal portion is large, and the
iliac is extremely minute, represented by not more than a few
fibres. In Gallinago and Scolopaxc the caudal portion is of
moderate size, the iliac portion completely absent.
Text-fig. 28.
IL.FIB (1)
NK
Wes fits Z.
Wizz
Vp
UY
1
CAUD ILL,
TRAE.
FT. 6.
11 FIB (2)
Thigh-muscles of Chionis alba. Right thigh, external view.
IL.TR.E., P., M., A. Tlio-trochanterici externus, pesterior, medius et anterior.
IL.FIB. (1). Origin of ilio-fibularis seu biceps, cut and reflected. IL.FIB. (2).
Insertion of biceps, cut and reflected. I.F. Ischio-femoralis, seu obdurator
externus. CAUD.IL.F. 1,2. Insertions of caud-ilio-femoralis (accessory femoro-
caudal (1) and femoro-caudal (2)). CAUD.IL.FL. Caud-ilio-flexorius, cut, and
origin reflected. IS.FL. Ischio-flexorius. P.I.F. Pub-ischio-femorales, seu
adductores longus et magnus. The tendinous areas are dotted. X. Tendinous
area on accessory femoro-caudal. F.T.E. Femoro-tibialis externus.
(dicnemus in this respect, as in others, shows its wide diver-
gence from the typical Limicoline condition. Of the others,
Thinocorus, Hydrophasianus, and Rhynchea show what is probably
the archecentric or generalised condition for birds, the presence
of both muscles in a well-marked form. The remaining birds of
the list show that the tendency of modification in the group is for
the disappearance of the iliac portion (the ‘‘accessory ” of Garrod) ;
and complete disappearance has been reached by Gallinago
and Scolopax, two birds in other respects relatively highly
specialised.
Caud-ilio-flexorius (Semitendinosus and Accessory semitendi-
nosus), Ischio-exorius (text-fig. 28).—In all these birds the three
1905. | ANATOMY OF LIMICOLINE BIRDS. 167
muscles are present, and, save that in Hydrophasianus and
Himantopus the semitendinosus and its accessory or femoral head
were very small, the conditions I did not find to differ from the
generalised state found in Gruiform birds.
Insertions of Caud-ilio-flexorius, Ischio-flexorius, and middle or
posterior femoral head of Gastrocnemius—In a former
communication to this Society (7) I described the differences
that exist amongst Gruiform birds in this respect, and
I grouped these divergences round four central types. The
conditions in the Limicole are more uniform, and may be
explained by comparison with the figure of the Otis type (7, text-
fig. 83, p. 651). In all the birds the internal adductor muscle
(Pub-ischio-femoralis internus) sends a strong slip to the middle
head (internal femoral) of the gastrocnemius, or may be actually
fused with it. The internal femoral head of the gastrocnemius
at its Insertion to the femur is parallel with and ‘distad of the
accessory or femoral attachment of the caud-ilio-flexorius; in
Vanellus and Himantopus the edges of the two are in close contact,
although they are not actually fused asin the Rallide. In all
the other birds on my list they are quite asin Otis. From the
raphe between the accessory and main portion of the caud-ilio-
flexorius a strong fibrous band runs downwards fusing with the
middle head of the gastrocnemius, whilst another band from
the same point of origin runs across to be inserted into the
tibia, under the tibial portion of the gastrocnemius, generally in
association with the similar insertion of the ischio-flexorius.
Gastrocnemius, external femoral head.—This is double in
Vanellus, Himantopus, and Charadrius, single in all the others.
The two heads unite before the muscle joins with the conjoined
tibial and inner femoral portions. This recalls the similar
doubling in Cariama, the three heads in Ofis and Hurypyga, and
the enormous undivided head in AHeliornis. I have not in-
formation as to the occurrence of a similar variation of the external
head of the gastrocnemius in other groups.
Ilio-fibularis (text-fig. 28, IL.FIB. (1) & (2))—This muscle,
with its sling and connections, exhibits practically identical
conditions, and these not differing from the state in the Grui-
formes generally in all the birds on my list. The fleshy origin
is unusually large.
Pub-ischio-femorales (adductors).—These are both present in
all the birds on the list. As I have mentioned above, the internal
adductor has usually a strong connection with the middle head of
the gastrocnemius. It is wider than the external adductor and
shows traces of tendinous degeneration.
Tibialis anticus and Solews.—These are present and normal in
all the birds on the list, the tibialis anticus passing through a
ligamentous ridge.
” Bectensor digitorum communis.—This has the normal arrange-
ment and relations in all. Its tendon of insertion breaks up into
two central slips for digit 3 and a single lateral slip at each
168 ON THE ANATOMY OF LIMICOLINE BIRDS. [May 16,
side for digits 2 and 4 respectively, except in Glareola and
Thinocorus, where it is a fan-shaped slip of fasciee common to
the three digits, with the slightest trace of specialisation into
tendons on the edges of the fan.
Peroneus superficialis (with slip to perforated tendon of digit 3),
Peroneus profundus.—These muscles are present, with one
exception, in the normal or archecentric condition in all the birds
on the list. The exception is the peroneus profundus in
(dicnemus, in which bird it is practically absent, the absence
being another point in which W@dicnemus differs from the
Limicole and recalls many of the Gruiformes, such as Otis.
Flexores perforantes et perforati.—These muscles and tendons,
including the slip connecting the tendon of digit 3 with the
corresponding tendon of the perforated flexor, all present a
practically identical condition, which does not differ in any
important respect from the condition in the majority of the
Gruiformes.
Flexores perforati.cThese muscles in all the birds on my list
have the usual inter-relations and divide mto tendons for the
three digits in customary fashion. The muscular mass has three
heads: of these I have already described the ambiens head, which
is similar throughout, except that there is no accessory ligament
from the head of the fibula in Chionis. The external head is
fleshy in Himantopus; it 1s small and tendinous in Chionis,
Glareola, Thinocorus, Hydrophasianus, Charadrius, Rhynchea,
and Gallinago. Itis absent in @dienemus and Scolopax.
Pleaor profundus and Flexor longus hallucis.—In my communi-
cation on the Gruiform birds I described various ways in which
the tendons of these two muscles (which are similar in their
origin in all the birds on my list) are united with one another
and distributed to the toes. I suggested that probably the
most primitive condition was such as is to be found in Hurypyga
(7, text-fig. 85, VII), where the longus hallucis sends a slip to the
hallux, and distad of this blends so completely with the profundus
tendon that each tendon supplies each of the three digits. The
condition in Chionis resembles this closely, except that, as in
Rhinochetus, the hallucis tendon, after giving off its slip to the
toe, is not so markedly spread out for the other toes. Mdicnemus
shows a state practically identical with that of Otis; there is no
great toe, and therefore no slip to it; the spreading out of the
junction of the hallucis tendon with the profundus tendon has
become obliterated.
In Hydrophasianus the condition is exactly as in Hurypyga,
except that, although there is a long great toe, there is no slip to
it. In Rhynchea the condition is also the primitive one, except
that the slip to the great toe comes off a considerable distance
above the branching of the conjoined main tendons for the three
other digits. In Scolopax the condition is similar to that in
Rhynchea, but although there is a small great toe there is no
slip to it, and the long junction of the two tendons is ossified.
1905. ] MR. R. I. POCOCK ON A HAINAN GIBBON. 169
Glareola and Thinocorus are like Scolopax, but have a slip to the
great toe. Vanellus and Gallinago are exactly like Scolopas: ;
Charadrius and Himantopus are also identical with it, except
that there is no great toe.
The conditions of these tendons in Limicole are similar and
much alike, being not far removed from the condition that I
take to be archecentric or primitive for Birds. But in the group
there is a tendency to lose or reduce the great toe, and that
loss or reduction has produced modifications which are similar
in character and very easy to derive from the primitive type.
SUMMARY.
With the exception of Mdicnemus, the Limicoline birds
examined, so far as relates to the characters dealt with, show a
definite and coherent series of modifications. The group is
moving, or has moved, along the same anatomical lines. The
limits of its variations overlap in a special way the variations
displayed by Gulls, and in a general way those exhibited by
Gruiform birds.
REFERENCES.
(1) Bepparp, F. E.—The Structure and Classification of Birds.
1898.
(2) Forprincer, M.—Untersuchungen zur Morphologie und
Systematik der Vogel. 1888.
(3) Gavow, H.—‘“ Aves” in Bronn’s Thierreich.
(4) Mrroneii, P. Coatmers.—“ Quintocubitalism in the Wing of
Birds.” Journ. Linn. Soc., Zool. vol. xxvii. p..237.
(5) Mrrcnetn, P. Cuatmers.—“‘ Anatomy of Kingfishers.” The
libris; SON p. 9%:
(6) Mircuett, P. Coatmers.—“ On the Intestinal Tract of Birds.”
Trans. Linn. Soc. ser. 2, Zool. vol. viii. p. 173.
(7) MircHEett, P. Coatmers.—“ On the Anatomy of Gruiform
Birds.” Proc. Zool. Soc. Lond. 1901, vol. ii. p. 629.
6. Observations upon a Female Specimen of the Hainan
Gibbon (Hylobates hainanus), now living in the Society’s
Gardens. By R. I. Pococs, F.L.S., F.Z.8., Super-
intendent of the Gardens.
[ Received May 16, 1905. ]
(Plate V.*)
Age at Maturity.
On Jan. 26, 1904, the Society received on deposit a female
specimen of the Hainan Gibbon, the property of Mr. E. H. de
* For explanation of the Plate, see p. 180.
170 MR. R. I. POCOCK ON A HAINAN GIBBON. [May 16,
St. Croix, who procured her in the island of Hainan on July 11th,
1897. She had thus been in captivity nearly six years and seven
months. On the testimony of natives, her owner believed her to
be about six weeks old at the time of capture; but since, as he
affirms, she was already weaned and capable of fending for
herself in the matter of food, it is probable that she was very
much older than was supposed. On the assumption that she was
at least six months old, it may be inferred that the beginning of
1897 was the approximate date of her birth.
Menstruation set in at the end of the first week of December
1903; and taking this as the sign of maturity, coupled with
the fact that she has not increased appreciably in size since
her arrival in the Gardens, it may be assumed that she became
adult when about seven years old. And in view of the close
aftinity between the various species of Gibbons and the subequality
in size of full-grown individuals, it may be further inferred that
about seven years are required on an average for these animals to
reach maturity *
Menstruation.
Very little appears to be known about the menstruation of
Gibbons. In Chimpanzees, according to Dr. Keith (P. Z.8. 1899,
p- 297), the discharge is sanguineous in colour, profuse, monthly in
occurrence, and three days in duration. In our Hainan Gibbon
it 1s also sanguineous, stains the floor of the cage, and, according
to her keeper, Mansbridge, who also looked after the Society’s
historic Chimpanzee ‘“ Sally,” is about the same in quantity
relatively to the size of the animals as in that ape. The pudendal
organs are always conspicuous by reason of their turgescence,
and no very conspicuous change in their condition precedes the
menstrual discharge. In this particular the Gibbon differs
markedly from certain Cercopithecide (such as Baboons, Macaques,
and Mangabeys), and also, to judge from published and verbal
accounts, considerably, though to a lesser degree, from Chimpanzees.
With the help of Mansbridge and Robertson, the two keepers of our
Anthropoid Apes, I recorded the dates of the appearance of the
discharge during the autumn, winter, and spring. The first noted
was from Sept. 12 to 14, the second from Oct. 14 to 16, and the
third from Noy. 19 to 21. During December the animal had a
severe illness, beginning with an influenza cold and ending with
diarrhoea, which was accompanied by extreme wasting and weak-
ness. This illness extended over the time for menstruation, which
did not appear in December. In January also there was no sign
of it observable, although by the middle of that month she had
apparently recovered her normal health. It is probable, I think,
that the cessation for these two midwinter months was due to
the illness. But it is by no means impossible that cessation
during that time of the year is normal. The question can only be
* Perhaps the Siamang (Symphalangus), which exceeds the other Gibbons in
dimensions and differs from them in other respects, will be found to be an exception.
1905. | MR. R. I. POUOCK ON A HAINAN GIBBON. 171
decided by observing what happens in the ensuing winter, should
the animal still be in the Gardens. Menstruation reappeared on
Feb. 6 to 8, and has continued at tolerably regular monthly
intervals since. Hence it may, I think, be laid down as an
established fact that in Gibbons the interval between the men-
strual discharges is a little over the calendar month and that the
discharge continues for from two to three days.
Determination of the Sex.
When Mr. de St. Croix brought the specimen to the Gardens
he informed me that she was a castrated male; and in support of
his opinion drew my attention to the large size of the clitoris,
which he most naturally mistook for the penis. The naked and
turgid labia of the vulva he regarded as the unhealed wound
caused by castration; and the menstrual discharge which first
appeared in December of 19053, when the Ape was on her way to
England, he attributed to normal bleeding induced by enforced
sitting on the hard floor of her travelling-box. He also told me
that it is commonly believed in Hainan that female specimens
of the Gibbon are never brought to the coast and are practically
unobtainable.
There can be no doubt that this belief, coupled with the peniform
clitoris of the Gibbon, misled Mr. de St. Croix as to the true
sex of his animal, the castration of which, he admitted, he had
not himself witnessed. And it seems probable that the belief
itself is traceable to repeated mistakes on the part of Europeans
in determining females as castrated males on account of the unusual
length of the clitoris in these Apes as compared with the same
organ in the Monkeys of the Old World generally. In this con-
nection it is interesting to recall the fact that Dr. Harlan *, after
dissection of the generative organs, described his specimen of Hylo-
bates concolor as ‘an hermaphrodite Orang Outan.” It appears to
me, however, that Lesson’s criticism of this opinion was perfectly
justifiable and his decision that the specimen was an immature
female undoubtedly correct. Pousargues, also, who evidently did
not know Lesson’s paper, came independently to the same con-
clusion, and stated that in the type of Hylobates nasutus, a young
female, the clitoris was well developed and grooved below; and that
the animal resembled in every particular, so far as the generative
organs were concerned, the Gibbon determined as an hermaphrodite
by Harlan. And since Harlan and two other doctors, presumably
acquainted with human anatomy, who assisted at the dissection,
were deceived as to the true sex of the specimen, in spite of the
best possible opportunities for investigation, it is no wonder that
the Europeans living in Hainan fall into a similar mistake.
So far as can be seen, the clitoris of our Hainan Gibbon is
like that of the specimen figured and described by Harlan, which
resembled the penis of a Primate in a state of hypospadias. A
* For Bibliography, see ixfra pp. 174-175.
172 MR. R. I. POCOCK ON A HAINAN GIBBON. [May 16,
comparatively slight structural modification would convert such
an organ into a closed tube for the passage of the urine—a fact
perhaps of some significance in connection with the low position
of the Gibbons in the Anthropomorphous series, seeing that in
the Lemurs, the lowest of existing Primates, the clitoris is
traversed by the urethral canal.
Change of Color.
IT am informed by Mr. de St. Croix that the young of both
sexes of this species are alleged by the natives to be lighter-
coloured at birth and for a short time afterwards than their
parents. His animal, when first purchased, was a dark smoky
grey, which, however, soon turned to black; and perfectly black
she remained all the years she was in his possession. But within
a few weeks of being brought to the Gardens she began to go
grey, Mr. de St. Croix himself noticing a decided alteration in
this respect when he visited her on March 8th, about six weeks
after her arrival in London. During the spring and early
summer the greyness progressed rapidly, but not quite uniformly
all over the body. In midsummer, according to my notes, the
head was black with a grey band extending on each side from
the eyebrow over the ear; the beard was whitish and the nape
of the neck blackish ; the greater part of the body was blackish
grey, with a considerable quantity of blacker hair on the sides of
the belly close to the thigh and a broad triangular black patch,
narrower posteriorly, extending from the collar-bones on to the
fore part of the belly and bordered on each side by a grey area
paler in tone than the back; the thigh and upper arm were
paler than the distal portion of the limbs. By this time she
was not recognisable as the animal that reached the Gardens
in January. Still the greyness continued to spread, the black
pigment died out from the areas mentioned above, lasting longest
upon the chest and the crown of the head. At this period she
presented a decided similarity to the left-hand figure on the
plate depicting H. pileatus Gray (P.Z.S8. 1861, p. 136, pl. xxi.),
although the black pectoral area was smaller and the patch on
the crown less sharply defined at the edges. In the early autumn
she was a stone or silvery grey practically all over except for a
black median band, fading away laterally and posteriorly, down
the middle line of the head.
At the present time (May 1905) she is brownish grey or silvery
grey in colour, the tint varying according to the light. The black
cap is still retained as a patch broadest and blackest between the
ears, fading into brown upon the forehead and narrowing towards
the nape of the neck, The hair on the chest has grown pale and
thin, showing the blackish-grey tint of the underlying skin as
a dark triangular shield. On the penultimate phalanges of the
hands and feet the blackness of the hairs persists. The long hairs
on the brows are also black.
1905. | MR. R. I. POCOCK ON A HAINAN GIBBON. 173
It is known that in some species of Gibbons, e. g. H. leuciscus,
according to Mr. Hose, the individual variation in colour is con-
siderable, like unto that which obtaims indeed in some Squirrels
and Lemurs. But, so far as I am aware, it was not previously
known that a given individual after reaching maturity may change
in colour in the way exemplified by Mr. de St. Croix’s specimen.
This change may be compared to that which takes place in the
hair of the human head concomitantly as a rule with senescence
or to that exhibited by some specimens of the Arctic Fox upon
the approach of winter*. It is not accompanied by any replace-
ment of coat, nor is it directly attributable to any change in the
environment or to external agencies. The cause, whatever it may
be, lies within the organism itself; it is constitutional or subjective,
and as such may be distinguished by the term “ canescence,”
from the decoloration or fading which is caused by exposure to
sunlight or other bleaching agencies.
In the case of the Hainan Gibbon it is important to note the
coincidence between the appearance of menstruation and that of
the colour-change. The former phenomenon began in December
1903, the latter about February 1904.
Of the two specimens of this species in the British Museum (both
of which are jet-black), one is only about two-thirds grown; the
other, the type, as Mr. Oldfield Thomas states, not quite adult ;
and since Mr. de St. Croix’s specimen is, on the contrary, full-
grown, it might be inferred that it is characteristic of the species to
change from black to grey upon reaching maturity. This, however,
is not the case; for Mr. de St. Croix informs me that he was
acquainted in the island of Hainan with another specimen,
alleged to be a male, which was jet-black, like his own before
coming to the Zoological Gardens, and had been in captivity
sufficiently long to justify the belief that it was about twelve
years old when he last saw it.
Is the canescence, then, a matter of sex and exhibited only by
mature females? The balance of evidence seems to be on the
whole in favour of an affirmative reply to this question. For,
apart from the change here recorded of the only adult female
known, it must be remembered that Mr. Swinhoe, in his published
account of all the information respecting the Hainan Gibbon he
was able to gather, quotes from the Chinese gazetteer of the
Kiung Shan district of the island a passage stating that the
male is black and the female white (P.Z.8. 1870, p. 244, &e.).
* There are two Arctic Foxes living in the Zoological Gardens at the present time.
One remains dark-coated throughout the year; the other turns snow-white towards
the winter. In both the winter coat, whether “white” or “blue,” is replaced
in the summer by a darkish brown clothing of new hair, which is at its best in
August, but becomes paler and loses to a large extent its richness of tint as it
crows. In neither is there an autumn moult comparable in extent to that of the
spring; and there is no doubt that in the animal which turns white the meta-
morphosis is effected by the destruction of the pigment in the hairs themselves. This
bears out Major Barrett-Hamilton’s statement as to what occurs in the Arctie Hare.
174 MR. R. I. POCOCK ON A HAINAN GIBBON. [May 16,
The Name of the Species.
The correct name for this species is still unsettled. The
specimen now living in the Gardens is specifically identical with
the type of H. hainanus Thos., and with the specimen previously
exhibited in the Menagerie * and now in the British Museum,
with both of which I have compared it. According to
Matschie 7, however, hainanws 1s a synonym of concolor Harlan =.
This opinion was based apparently upon the similarity in colour
between the types of concolor and hainanus ; but it untortunately
involves the assumption that the locality given for concolor,
namely Borneo, is erroneous. It is also objectionable on the
grounds that the hair of concolor was described as “thick,
woolly, and frizzled.” The last two epithets are in no sense
applicable to the hair of either of the three specimens of hainanus,
comprising young and adult animals, available for examination.
In these the hair, although thick, 1s smooth, depressed, relatively
coarse, and quite unlike the hair of a young specimen of //. lar
from Pahang, now in the Gardens, which is essentially rough and
woolly ; and also equally unlike that of examples of H. agilis in
the British Museum, which is beautifully silky and woolly.
Furthermore, Trouessart § adopts for the species the name harlani,
unlawfully proposed by Lesson || as a substitute for concolor Harl.,
alleging that concolor was first applied by Harlan in 1825 toa
young specimen of H. (Symphalangus) syndactylus. _Concolor,
therefore, falls as a synonym of syndactylus, and harlani comes
in for the species described by Harlan in 1827, which Trouessart
follows Matschie in identifying with hainanus. Trouessart,
however, gives no reference to Harlan’s paper of 1825, and since
T have failed to find it in the Royal Society’s Catalogue, and
there is no suggestion in Harlan’s paper of 1827 (contained in
a volume dated 1825), or in Lesson’s almost contemporaneous
criticism of it, that the name concolor had been previously
published, I must conclude that Trouessart has fallen into some
error.. But in any case, since the specimen described by Harlan
in 1827 as concolor and renamed harlani by Lesson in the same
year and erroneously quoted as niger by Ogilby (P. Z. 8. 1840,
p. 20) was definitely stated to have come from Borneo and to have
had thick woolly frizzled hair, and since it 1s only known to have
resembled the type of hatnanus in the matter of coloration, an
admittedly variable feature in the genus and one in which it also
resembles H. syndactylus 4, it 1s, in my opinion, premature to state
without qualification that hainanus is a synonym of concolor.
* Sclater, P. Z. S. 1892, p. 541.
+ SB. Ges. nat. Freunde Berlin, 1893, p. 211.
t+ Jr. Acad. Sci. Philad. v. pt. 2, p. 231 (1827).
Cat. Mamm. Suppl. 1904, p. 6.
|| Bull. Sei. Nat. xiii. p. 111 (1827).
€ Since Harlan states (loc. cit. p. 231) that concolor differs from HA. syndactylus
and other species in being of a universal black colour, it is assumable that he did not
know H. syndactylus. I do not, however, suggest that concolor is a synonym of
syndactylus, because Harlan states that his specimen had no guttural sacs.
Or
1905. | MR. R. I. POCOCK ON A HAINAN GIBBON. 175
Again, Pousargues * believed hainanus to be established upon a
specimen of the same species as the type of H. nasutus, from
Tonkin. This belief was also based upon resemblance in colour.
Nothing else is known of the characters of nasutus except the
alleged presence of a “ fine and delicate little nose,” whence the
name was derived. But since hainanus is not distinguishable from
other Gibbons by the fineness and delicacy of its nose, judgment
on the synonymy suggested by Pousargues must be suspended
until the type of nasutus has been re-examined and described.
Trouessart, who may have seen the type, gives nasutus the rank
of a subspecies of the Hainan form.
No further justification need, I think, be sought for retaining
the name hainanus for the subject-matter of these remarks.
Description of the Species.
Face, ears, palms of hands, soles of feet, and skin black, the
face with a slightly brownish tinge; iris and exposed portion
of eyeball blackish. Colour of hair either uniformly black, with
shining tips, or grey, the roots of the hair being tinged with fawn or
washed-out brown, their exposed portion shining with silver-grey
lustre in reflected light, but of a more stone-grey in direct light.
During the change from black to grey, the coloration is a mixture
of the two, the black or the grey predominating according to the
nearness of the time of observation to the incipience or com-
pletion of the change.
On the crown of the head a median longitudinal black patch
with ill-defined edges and extending posteriorly as a narrow
evanescent stripe persists. A few scanty hairs upon the penul-
timate phalanx of the fingers and toes and the long hair on the
brow also remain black. The hair on the body and limbs is
longish, soft, and thick, but depressed and smooth. It is not
woolly in the sense that the hair of our young Lar Gibbon is
woolly, i. e. much resembling a Sheep’s fleece ; nor does ib exhibit
the fine and silky woolliness of the skin of 1. agilis in the British
Museum. On the forehead. and crown of the head the hair is
shorter, fine, and close, and in the living specimen grows some-
what &@ la Pompadour, being erect on the crown and almost
porrect on the forehead, so that the head has the appearance of
being very much higher than in our living example of the Hoolock
(Hf. hoolock) and in adult skins of H. lar, H. pileatus, and
H. leuciscus in the British Museum, in which the hair lies smoothly
backwards. The difference may be briefly expressed by saying
that in our Hainan Gibbon the hair looks as if it had been
brushed up, whereas in the others it looks as if it had been
* Bull. Mus. Paris, 1900, p. 272. Pousargues gave A. Milne-Edwards the credit of
naming nasutus. Milne-Edwards, however, published no description of the species
when the name was quoted (Le Naturaliste, 1884, p. 497). Hence if seems that
Kunckel d’Herculais, who first associated the name with detinite characters, must be
regarded as the author (Science et Nat. ii. no. 33, p. 86, 1884).
176 MR. R. I. POCOCK ON A HAINAN GIBBON. { May 16,
brushed down. In the two skins of H. hainanus in the British
Museum, however, the hair on the crown is not so markedly up-
standing, nor so long, as in the living example. On the cheeks
the direction of the hairs is, generally speaking, upwards. On
the upper surface or back of the hand and on the corresponding
surface of the forearm the points of the hairs lie towards the ulnar
side of the limb, assuming a more and more elbowward direction
as that joint is approached. On the palmar and radial side of the
forearm, on the contrary, the hairs point for the most part towards
the wrist. The palmar surface, however, is marked by a crest
formed by the meeting of the two opposing streams of hair, the
crest extending obliquely from the radial side of the elbow to the
ulnar side of the wrist, the hairs on the ulnar side of it being
directed proximally, those on the radial side distally. On the
body the hairs lie backwards, except on the belly, where they
incline towards the middle line and form a median longitudinal
crest where the two streams meet. This is the area against
which the inner sides of the thighs are pressed when the Gibbon is
in a sitting posture. On the outer side of the thigh the direction
of the hair is upwards (proximad) and backwards, below the
knee it is downwards (distad).
Additional Notes.
The voice of our Hainan Gibbon is quite different from that of
the Hoolock. It is a high-pitched trill all on the same note,
and shriller even than the high note of the Hoolock’s cry. It
consists of from about three to six distinct cries repeated in very
rapid succession, suggesting almost production by vibration of the
tongue, although, as a matter of fact, I believe the lips alone are
instrumental in producing the effect. There is then a momentary
pause, after which the cry is repeated. It may perhaps be
represented in the following way:—hoo hoo hoo hoo—hoo hoo
hoo—hoo hoo hoo hoo hoo—ke. The Hoolock, on the contrary,
cries as follows:—hah, hoo, hah, hoo, hah, hah, hoo, hah. The
“hoo” is on a lower note than the “hah,” with which the cry
frequently ends.
The ordinary expression of anger or remonstrance in the
Hainan Gibbon is a prolonged and guttural grunt, which is
repeated rapidly and often, and frequently interspersed with a
kind of warble when the excitement rises.
Both the Hoolock and the Lar Gibbon in the Gardens drink
habitually by dipping the back of the hand and knuckles into the
dish and licking the water off. They do not scoop it up, in the
strict sense of the word, at all. Hence Col. Tickell’s generalisation
to the effect that in its habit of scooping up water in its hands the
Lar Gibbon differs from the Hoolock, which applies its lips directly
to the fluid, is contradicted on both counts by our specimens of
these species. The Hainan Gibbon, on the contrary, almost
invariably drinks direct with her mouth, only very rarely using
her left hand for the purpose. It is possible she may have
1905. | MR. R. I. POCOCK ON A HAINAN GIBBON. 177
abandoned the habit of employing the hand at the time when an
injury deprived her of the use of her right arm. And since the.
left is frequently occupied in supporting herself upon the bars or
perches in the cage, she has no hand available for the purpose of
drinking without quitting her hold.
This method of hand-drinking, probably common to all Gibbons,
may have arisen in connection with thei arboreal life. To avoid
descending to the ground, they would naturally lick the rain-drops
off the leaves near by, and their great stretch of arm would
enable them to wipe the water off foliage hanging beyond reach
of the mouth, the hairy back of the hand being clearly more fitted
for the purpose than the smooth palm. In connection with this
habit, it is interesting to recall the story told by Duvaucel of
female Gibbons carrying their young to the waterside and washing
their faces with their hands. This alleged proceeding, presumably
witnessed in the jungle, can hardly, I think, be accepted without
confirmation, on account of the absence of any obvious reason for
the ablutions. If the young Gibbons of which the tale is told
were hanging, as is their wont, to the breasts of the mothers, the
action of hand-drinking by the latter might very easily be mistaken
at a distance for the face-washing.
Amongst ‘“ quadrumanous” Primates the Gibbons have no
equals in proficiency in the use of the arms for arboreal and the
legs for terrestrial progression. Moreover, within the limits of
the entire order, they are only surpassed in bipedal activity by the
specialised biped Man.
Although able to stand and walk to a very limited extent,
Monkeys are essentially quadrupedal and employ then arms and
legs to an approximately equal extent in traversing the level
ground, scaling rocks, or climbing trees. Generally speaking, the
most active climbers are long non-prehensile tailed species, such as
the Mangabeys*, in which the tail actsas a balancer, like the pole
of a tight-rope dancer. Monkeys of this kind leap with great pre-
cision and strength, and pass with speed from branch to branch in
virtue of the great propelling power in their hind-quarters. ‘They
ave specialised for that manner of progression, which only differs
in degree of perfection from that of other Monkeys and Lemurs
as a whole. The method, however, is entirely distinct from that
practised by the Gibbons, which swing from branch to branch, with
the legs tucked up out of harm’s way against the body, the motor
power lying exclusively in the arms. Both groups have been
specialised for arboreal progression, but along totally different lines;
and it is as difficult to believe that the Gibbons, expert gymnasts
though they be, have been derived from active long-tailed climbers,
like the Mangabeys or Langurs for instance, as it is to believe
that the tail-swimming Cetaceans have been derived from forms.
like the flipper-swimming Seals.
* T have never yet seen the Baboon or Macaque that could catch a Mangabey
single-handed, given equal conditions as to health and age, in a large-sized cage.
Proc. Zoou. Soc.—1905, Vou. Il. No. XII. 12
178 MR. R. I. POCOCK ON A HAINAN GIBBON, [May 16,
This conclusion respecting the descent of the Gibbons may be
inferred from their habits alone, quite apart from structure.
If the Anthropoid Apes be ranged in series according to
proficiency in bipedal locomotion, the order will be (1) Gibbons,
(2) Gorillas, (3) Chimpanzees, (4) Orangs. Gibbons not only stand
erect and habitually walk without putting the hands to the
ground; they can even run with astonishing speed, a speed indeed
comparable to that of Man, allowance being made for difference in
size. Like Man they race away when scared; and, unlike the
other Anthropoid Apes, they do not use their arms as crutches.
Sometimes also, but rarely, they leap over the ground with both
feet together *.
Gorillas can stand and walk upright, but not with the ease
of Gibbons, and it may be doubted if they ever run erect or leap,
i.e. progress with both feet off the ground at one time; and
they probably never run from danger, standing upright, as Man
and Gibbons do. Their usual walk is quadrupedal.
Chimpanzees, too, are essentially quadrupedal; and under
ordinary conditions, and when in perfect health, almost always get
over the ground on “all fours,” like a Baboon or Rhesus. In this
respect, indeed, they more resemble the Cercopithecoid Monkeys
than does any other Anthropoid Ape; and they are able to cover
the ground with much greater speed than either Gorillas or Orang-
Utans ; but I am unable to say if their quadrupedal method is so
fast as the bipedal method of Gibbons. Like Baboons, they can
stand erect and walk to a certain extent, but not with the facility
of Gorillas.
The gait of young Orang-Utans may be described as a clumsy
quadrupedal shuffle, J never saw one stand unsupported by the
arms. Weakness of leg and weight of body make exclusively
bipedal action, if not an impossibility, at least so great an effort
that it may be doubted if it is ever resorted to. Their whole
organisation suggests unfitness for terrestrial locomotion.
Thus, if the Apes be classified according to their quadrupedal
activity on the ground, they will stand:—(1) Chimpanzees,
(2) Gorillas, (3) Orangs, (4) Gibbons.
It is interesting to compare this series with one based upon
dexterity in climbing and addiction to arboreal life. It is:
(1) Gibbons, (2) Orangs, (3) Chimpanzees, (4) Gorillas. The
Gibbons stand quite alone both in method and expertness; the
others differ inter se merely in degree.
The foregoing results may be briefly summarised as follows :—
The Gibbons are the most expert climbers and bipedal walkers,
the least expert quadrupedal walkers. The Orangs rank second
in climbing, third in quadrupedal and fourth and last in bipedal
activity. The Gorillas take fourth place in climbing, second in
bipedal and second in quadrupedal activity. The Chimpanzees
* These and the following statements and reflections are based upon my own
observations of the Anthropoid Apes that have come under my notice in the Society’s
Gardens.
1905. | MR. R. I, POCOCK ON A HAINAN GIBBON, 179
stand third in climbing, third in bipedal and first in quadrupedal
powers.
Since, therefore, the action of Monkeys, whether Cercopithecide,
Cebide, or Hapalide, and of Lemurs is essentially quadrupedal,
the fore and hind limbs being used to an approximately equal
extent, both .in terrestrial and arboreal locomotion, it may be
inferred that the Chimpanzees have departed least in these
respects from the primitive Primate stock; the Gorillas a little
more in the line of bipedal erection and, concomitantly, loss of
climbing power; the Orangs still more in the direction of loss
of terrestrial activity and increase of arboreal expertness; the
Gibbons most of all in the line of bipedal activity, dexterity in
hand-climbing, and loss of quadrupedal power.
This serial arrangement of the Apes is the exact opposite
of the one prevalent in text-books, where the order adopted is
based upon structure with Man placed first as the standard for
comparison. It suggests that for the origin of Gibbons we must
look not to forms resembling any known Cercopithecoid type, but
to forms which had already acquired the Simiine or Authropo-
morphine characteristics and had either lost or never learnt the
method and skill in climbing found in the former group. They may
have started from a type somewhat on a level with the Chimpanzees
with respect to terrestrial and arboreal activity ; and to swing with
greater facility from tree to tree and to obviate the risk of injury
in ease of a fall, it is highly probable that they have become
dwarfed in stature and grown lighter in build. Their muscularity
and length of arm, slightness of body and strength of leg, all factors
of importance in enabling them to traverse the jungle and, in
case of 2 miss or a breaking branch, to drop lightly to the ground
and run to the nearest tree for safety, were probably perfected
concomitantly. That Gibbons are able to drop with safety a
considerable distance is substantiated by the fact that Mr. de
St. Croix has seen his specimen come to the ground without
injury from a height of about 20 feet. When leaping to the
ground Gibbons swiftly draw up the knees as the feet touch,
exactly as a man does under similar circumstances, to break the
shock.
Another interesting feature connected with the habits of the
Anthropoid Apes is the size of their ears. T have already suggested
that the difference in size between the ears of the Orang and
those of the Chimpanzee may be connected with the difference of
habits of the two animals. ‘The Orang lives a more arboreal and.
therefore a safer life than the Chimpanzee, which requires quick
heaving to enable it to escape to the trees when feeding on the
ground *, Gibbons also, which have relatively large ears, need
auditory acuteness for the same purpose as Chimpanzees. This
explanation, however, is not complete and appears at first sight to
be contradicted by the case of the Gorillas, which have small ears
* ‘Nature,’ Oct. 11th, p. 585 (1900). ©
jake
180 ; MR. OLDFIELD THOMAS ON [June 6,
and yet are less arboreal in habit than other Anthropoids. It
must be remembered, however, that they are far more capable of
self-defence and much less liable to attack and therefore need less
keenness of ear as an aid inavoiding enemies. In this connection
it is important to note that of the two Apes inhabiting W. Africa,
namely the Chimpanzee and the Gorilla, and of the two inhabiting
the Hast Indies, namely, the Orang and the Gibbon, the larger
and stronger has in each case small insignificant ears and the
smaller and weaker large eaxs.
EXPLANATION OF PLATE V.
Hainan Gibbon (Hylobates hainanus), from the female specimen now living in the
Society’s Menagerie. ‘The lower figure, taken from an obscure photograph by
Mr. W. P. Dando, F'.Z.S, represents the Ape when she first came to the Gardens.
The upper figure, modified from a photograph of another Gibbon, shows her as
she has been since the change of colour took place.
June 6, 1905.
Dr, Henry Woopwarp, F.R.S., Vice-President,
in the Chair.
The Secretary read the following report on the additions that
had been made to the Society’s Menagerie in May 1905 :—
The registered additions to the Society’s Menagerie during the
month of May were 367 in number. Of these 174 were acquired
by presentation and 27 by purchase, 129 were received on deposit,
25 by exchange, and 12 were born in the Gardens. The total
number of departures during the same period, by death and
removals, was 185.
Amongst the additions special attention may be directed to :—
A Crowned Duiker (Cephalophus coronatus) from West Africa :
deposited on May Ist.
A Maxwell’s Duiker (Cephalophus maawelli) from W. Africa :
presented by Lieut.-Col. Bartlett, R.A.M.C., on May 16th.
A Nepalese Hornbill (Aceros nepalensis) from the Himalayas :
received in exchange on May 18th.
Two Sulphur-breasted Toucans (hamphastos carinatus) :
purchased on May 13th and May 23rd respectively.
Mr. Oldfield Thomas, F.R.S., exhibited a specimen of a Bush-
buck which had been obtained by Mr. C. W. Haywood in British
Kast Africa and which appeared to represent a new species of
the group. It was described as follows :—
1905. ] A NEW BUSH-BUCK. 181
TRAGELAPHUS HAYWOooD! Thos.*
Thos. Abstr. P. Z. 8. No. 21, p. 9, June 13, 1905.
A large heavily-built member of the group of small species
without a definite short-haired collar. Under surface darker
than upper.
Fur comparatively coarse and long throughout, the hairs of the
back 35-40 mm. in length. General colour very dark, the nape
black; the fore-quarters blackish brown (near ‘‘seal- brown”), passing
into dark reddish brown (“ vandyke-brown”) on the middle back
and deeper rufous (dark “ tawny”) on the rump. Sides gradually
darkening downwards to the wholly black belly. Dorsal crest black
as far as the withers, then whitish mixed with some black hairs.
Three inconspicuous transverse whitish stripes on each side. No
longitudinal bands, but a few white spots on the sides of the rump.
Shoulders and proximal part of limbs deep black, succeeded by tawny
below. (Feet unfortunately lost in the type.) Top of muzzle nearly
black, with prominent interorbital whitish streaks nearly touching
each other in the middle line. Forehead and crown deep
ferruginous. Cheeks tawny ochraceous. ‘Two white spots on
each side behind and below the eyes. Ears thinly haired, dull
tawny brown with blackish edges; hairs of inner surface white.
Chin and interramia white and a large throat-spot duller white;
between this and the white chest-band the throat was glossy
blackish, mixed with some tawny hairs. White axillary and
inguinal patches present. Tail dark tawny, white below.
Skull very large and heavy for one of the smaller members of
the genus, much larger than in 7’. scriptus or sylvaticus. Median
alatal notch rather farther forward than the lateral ones.
Palatal foramina comparatively long.
Horns also very powerful, thick and strongly ridged, much
finer than those of any of the allied forms.
skull dimensions of type :—
Greatest length 265 mm.; basal length 247; greatest breadth
112; muzzle to orbit 154; muzzle to front of p* 77; length of
palatal foramina 36. Length of upper tooth-series 72, of three
upper premolars 31.
Horns: length mm straight line 400; on anterior ridge 470;
greatest basal diameter 59; basal circumference 171.
Hab. Nyeri, Kenya District, British Hast Africa, Altitude
6000 feet.
Type. Full-grown male. B.M. No. 5.5.16.3. Collected and
presented by C. W. Haywood, Esq.
- Mr. Oscar Neumann ~ had sorted the smaller species of
Tragelaphus into two groups, characterised by the presence or
absence of the peculiar collar of short hairs which had been so
* [The complete account of the new species described in this communication
appears here; but since the name and preliminary diagnosis were published in the
‘ Abstract,’ the species is distinguished by the name being underlined.—Eprror. |
+ SB. Ges. nat. Fr. Berl. 1902, p. 98.
182 MR. OLDFIELD THOMAS ON [June 6,
often noticed in Bushbucks, and which was evidently of definite
systematic value. But, as Dr. Hinar Lonnberg had shown*, several
of Mr. Neumann’s allocations were incorrect—certainly the Cape
sylvaticus had a short-haired collar, and fell mto the seriptus
eroup, while the Nilotie bor had a well-haired neck.
Mr. Neumann had also stated that the forms with well-haired
necks known to him did not have a darker underside, but since
his paper was written Lonnberg’s Anutson?z and the present animal
had both proved to present the combination of a hairy neck and
a black belly. This combination therefore distinguished hayiwoodi
from any of Mr. Neumann’s species, while from the Cameroon
knutsont it was separated by its whitish dorsal crest, less numerous
spotting, and other detailed characteristics.
Tn company with this handsome animal, which Mr. Thomas
had much pleasure in naming after its discoverer, Mr. Haywood
had sent home to the National Museum two immature skins,
with skeletons, of the recently described Forest-Pig (/Zylocherus
meinertzhageni). It was hoped that an adult specimen
suitable for mounting would soon be obtained, and_ this
Mr. Thomas looked forward to exhibiting to the Society in due
course.
Mr. Oldfield Thomas also exhibited a series of Mammals and
Birds from Japan as the first-fruits of an exploration of the islands
of Eastern Asia conducted for the furtherance of science by the
President, the Duke of Bedford, K.G., in order to show his
Grace’s sympathy with the technical side of the Society’s work.
The specimens obtained during this exploration would be laid
before the Society from time to time, and papers would be read
on them by various specialists, after which his Grace proposed
to present them to the National Museum.
Mr. Thomas commented on the immense value such a
systematic exploration would be to science if it were carried on
for some time, and instanced the revolution in our knowledge of
the mammals of South Africa—a region supposed to be well-
known—which had been effected by the similar exploration
conducted by Mr. C. D. Rudd.
The Japanese collection had been made by Mr. Malcolm P.
Anderson, who had already proved his powers both during the
Stone Expedition to Alaska and by the collections he had made
in California.
Of the specimens now laid before the meeting Mr. Thomas
drew attention toa fine Marten, which appeared to be different
from the ordinary Japanese Marten (M/ustela melampus) and
which, as the first new mammal discovered on the expedition, he
proposed to name in honour of the President :—
* Arkiv for Zoologi, Stockholm, 1. 15 ( 905).
1905. ] MAMMALS AND BIRDS FROM JAPAN. =).
MUusTELA MELAMPUS BEDFORDI Thos.*
Thos. Abstr. P. Z. 8S. No. 21, p. 10, June 13, 1905.
Size as in true melampus, or slightly larger. General colour
above, in winter pelage, near “ isabella,” but rather darker and with
an olivaceous tone, nearer to the yellowish brown of MM. m.
isuensis * than to the golden yellow of melampus. Wool-hairs
of back brown at base, then dark yellowish. Long hairs brown.
Muzzle dark chocolate-brown, passing backwards, on the crown,
into silvery greyish. Ears whitish both externally and internally.
Nape more yellow than back. Sides of neck brilliantly yellow
(* deep chrome ”), sharply contrasted with the upper colour along
a line halfway up the neck, and in continuation with the deep
orange ochraceous of the chest-patch. Lips pale brown, lighter
than the top of the muzzle; sharply defined from the whitish
interramia, which in turn passes without line of demarcation
into the orange of the throat and chest. Belly brown, not unlike
back, the throat-patch extending to the sternum and continued in
some specimens as an irregular line of spots to the inguinal region.
Limbs deep brownish black from halfway down the forearms and
on the hind feet. Tail pale brown for the greater part of its
length, the wnderfur dull yellowish as on the body ; tip sharply
contrasted yellowish or cream-colour, forming a conspicuous
terminal tuft.
Skull as in ésuensis, slightly larger than in melampus so far as
material for comparison existed,
Dimensions of the type, measured in the flesh :—Head and body
425 mm.; tail 220; hind foot 87; ear 40.
Skull—greatest length 84; basal length 75; zygomatic breadth
48; interorbital breadth 20; mastoid breadth 37°5; palatal length
42; length of upper p* on outer edge 9°5,
Hab. Washikaguchi, Nava District, E. of Osaka, Southern
Central Hondo, Japan.
Type. Adult male. B.M. No, 5.5.30.3. Original number 123.
Collected 13 January 1905 by Malcolm P. Anderson, and pre-
sented by the Duke of Bedford. Four specimens.
This very handsome Marten is conspicuously different from
the yellowish M. melampus, and is curiously more similar in
general colour to the I. m. tswensis of the Tsu-shima Islands.
From both, however, it is readily distinguished by its brilliant
yellowish throat and neck patches and its contrasted tail-tip.
Mr. R. I. Pocock, F.L.S., the Superintendent of the Gardens,
exhibited a female specimen of the Jamaican Scorpion, Cenirurus
* [The complete account of the new species described’ in this communication
appears here ; but since the name and preliminary diagnosis were published in the
‘ Abstract,’ the species is distinguished by the name being underlined.—EpD1To0R. |
+ Thos, Ann. Mag. N. H. (6) xix. p. 161 (1897).
184 LT.-COL, ©. DELME-RADCLIFFE ON THE NATURAL [June 6,
insulanus, carrying its young on its back. The specimen had
been presented to the Society by Mr. Henry Munt, F.Z.8.
Dr. P. Chalmers Mitchell, the Secretary to the Society, read a
paper, illustrated by lantern-shides, entitled “On the Intestinal
Tract of Mammals.”
This paper will be published entire in the ‘ Transactions.’
The following papers were read :—
1. Rough Notes on the Natural History of the Country
West of Lake Victoria Nyanza. By Li.-Col. C. Deutm&-
Rapcuirrse, M.V.O., F.Z.8.
| Received June 6, 1905. ]
These notes contain the general results of my observations on
the Natural History of the region traversed by the Anglo-German
Boundary Commission in the years 1902-4. Memoirs dealing
more exactly with the collections that were made have already
appeared in the ‘ Proceedings’ of the Zoological Society (P.Z.8.
1904, vol. i. pp. 371, 459) and ‘ The Ibis’ (1905, p. 199.).
MAMMALS.
Beginning with the larger mammals in the country under
discussion, it may be stated that Elephants appear periodically in
the swamps and forest near the mouth of the Kagera River on
the northern side. These elephants stray in this direction,
probably, at a time when it is dry in the interior. They come,
no doubt, from the herds in northern Ankole and Toru. At no
other point were traces of elephants seen except one single track
going from north to south from the Koki hills towards the
Busenya forest. In the west, a few elephants were noticed near
the shores of Lake Albert Edward, also probably stragglers from
the herds further north. There was no evidence of elephants
crossing from south to north, or vice versd, along the Ist parallel
south latitude.
it may perhaps be assumed that the herds of elephants reported
by H. 8. Grogan and other travellers in the Mfumbiro district
belong to the forest-regions of the west. ‘The herds of elephants
on the east of Lake Albert Edward and Ruwenzori probably do
not wander into the Congo forests. It has been noticed that the
elephants to the west of the great line indicated by Lake
Tanganyika, Lake: Kivu, Lake Albert Edward, Lake Albert, &c.,
and the Nile differ in many particulars from those lying to the
east of this line. At the same time, it must be remembered that
large herds of elephants are in the habit of crossing the Nile to
1905.] ISTORY OF THE UGANDA ANGLO-GERMAN BOUNDARY. 185
the north of Lake Albert, and there seems no reason why they
should not extend their wanderings into the Congo forests,
although so far observation tends to show that these herds find
their way back again, as a rule, to the countries east of the Nile.
Hippopotami are not very numerous in the Victoria Nyanza
near the mouth of the Kagera. The locality does not seem very
well suited to them. In the Kagera River itself there are more,
and parts of the river are infested by a number of very savage
brutes that make navigation in canoes or small boats extremely
dangerous. Lt. Weiss, of the German Commission, was repeatedly
attacked when in a very large canoe. He was almost upset—one
man was dragged out by the arm, but escaped. Finally his crew
refused to go on and ran away with their paddles. The actual
number of hippopotami cannot be considered large in comparison
with the huge herds in the Nile north of Lake Albert. Probably
in the great swamps of the Kagera, considerably to the south of
the area traversed by the Boundary Commission, the hippopotam1
ave much more numerous. ‘The specimens secured in the Kagera
were decidedly inferior in size and in development of ivory to
those of the Nile.
Rhinoceroses are extremely numerous on the right bank of the
Kagera, especially in Karagwe. The number of these animals is
quite remarkable, and, according to accounts received, they are to
be met with in even greater numbers a little further south. It
is a curious fact that no rhinoceroses are to be found on the lett
bank of the Kagera. All those seen belonged to the common
black African type. Stories were current of the existence of the
White Rhinoceros on the right bank of the Kagera, but these
rumours require confirmation. ‘The rhinoceroses appear to have
no hesitation in frequenting the extremely steep and difficult hills
of Karagwe. Their tracks and signs were seen up and down hills
and on ridges which appeared more adapted to the habits of
klipspringers or goats than of such bulky animals as rhinoceroses.
In the virgin forest west of the lake near the mouth of the
Kagera, in the swampy and open forest east of Koki, and in the
Busenyi forest west of the Gambaizi group of hills, several herds
of Buffaloes are to be found. These buffaloes are of a very
interesting, new, large variety. They are, perhaps, the largest
buffaloes in existence. In all, in the district referred to, there
may be 400 or 500 buffaloes, and as their numbers are not likely
to be interfered with, except by men armed with rifles, they may
be considered to be firmly established again after the devastation
caused by the great cattle-plague of some ten years back.
In Bukanga the buffaloes wander in search of young grass,
after the fires, as far as the hills of Ankole and Koki, from the
forests which form their strongholds. There is one disadvantage,
however, connected with the presence of the Buffaloes, of the
Bland, and perhaps of other Antelopes. This is the tsetse-fly,
and it is to be feared that as long as large herds of buffaloes and
the greater antelopes exist, so long will the tsetse-fly make it
186 LT.-COL, C. DELM£-RADCLIFFE ON THE NATURAL [June 6,
impossible for domestic cattle and horses to live in the same part
of the country. I myself lost an Arab horse I had had for six
years in Africa and was very fond of. He was bitten by tsetse-
fly in Bukanga.
Eland were met with at two points in Bukanga—near the
Nyakafunzo swamp, and in the districts known as Mpororo and
Rushenyi. In Bukanga there were herds amounting to, perhaps,
200 animals, and the uninhabited country surrounding the
Nyakafunzo swamp seemed admirably suited to then needs.
They were considerably preyed upon, unfortunately, by natives,
who organised hunting-parties into this district both from the
British and the German side. Still more unfortunately, the
natives are sometimes armed with rifles. The result could be
seen in many wounded animals observed from time to time, and
in dead bodies found with bullets in them. Lions also take toll
of the elands, but the natural decrease due to this cause is nothing
compared to the damage inflicted by natives with firearms.
Further west a herd of considerably over 300 elands was seen,
and this, probably, is only an outlier of still greater herds in the
open country further south. Jt seems, therefore, that this country
is abundantly supplied at present with representatives of this
magnificent antelope, which, I believe, might be made of great
economic value. The meat is equal to the best English beef, and
a bull eland weighs about 17 ewt.
Zebras occurred coincidentally with the Hland in Bukanga, and
they number, perhaps, 400 individuals. In Rushenyi another
very large herd of zebras was seen ; and it may be remarked that
in the Rushenyi herd a single zebra was seen almost entirely
pure white in colour, a few stripes only appeared on the neck
and hind-quarters. Another small herd of zebras, amounting,
perhaps, to 150 individuals, was seen in the plains in southern
Ruampara, on the left bank of the Kagera, just north of the
point where the river turns from the south to east.
Roan Antelope were encountered, a few at a time, in Bukanga,
in the narrow valley of the Kagera, and in south-west Ruampara
north of the bend of the Kagera just referred to. They were
occasionally met with in Rushenyi and Mpororo, and appeared
more numerous in Karagwe, where for some reason there
appeared to be no Hland, no Zebras, and no Damaliscus. These
last were the common hartebeeste throughout the area west of
the lake. In Bukanga, Damaliscus were very numerous. The
number in this part may be estimated at 1000 individuals. No
other variety of hartebeeste made its appearance: 200 or 300
individuals were found with the herd of zebras in south-western
Ruampara, and in Rushenyi and Mpororo the Damaliscus
hartebeestes are very numerous.
The Nile Valley variety of Water-buck (Kobus defassa) 1s
common in Bukanga, and may be mét with in herds up to a dozen
or fifteen individuals. They also appear fairly plentiful through-
out the valley of the Kagera and in western Ruampara, but
1905.| HISTORY OF THE UGANDA ANGLO-GERMAN BOUNDARY. 187
apparently not further west. These water-buck have fine heads,
as a rule considerably larger than A. ellipsiprymnus in Kast Africa,
although the heads are not nearly so big as are found in the
Semliki Valley.
Jn the swamps near the mouth of the Kagera, on the shores of
the lake, and on the islands of the Sesse group, Limnotragus
spekei was fairly common, This animal, owing to its nocturnal
and swamp-loving habits, is of course seen extremely rarely, but
it is frequently hunted by natives with nets and packs of dogs.
The horns are often to be met with in possession of natives.
There is at present a doubt whether more than one species of this
antelope is not found in the same district.
In Bukanga, especially about the Nyakafunzo swamp and to
the south of it, large herds of Mpala (Zpyceros melampus) may
be met with. These beautiful antelopes are to be seen in herds
of 200 or 300, and in the district referred to perhaps 1500
individuals exist at the present time. They were met with
at no other point throughout the country traversed.
Very common, although occurring only in ones and twos at a
time, was a species of Reed-Buck (Cervicapra? sp.). This antelope
was chiefly confined to the low-lying grassy country in Bukanga,
along the banks of the Kagera, and in Ruampara.
Another very common antelope was the Ovibi (Owrebia montana).
This little antelope appeared almost everywhere on the low
ground in the mountains, except in the highly cultivated parts of
Ankole and the mountains in the west. In general, it may be
said that no antelopes or game animals of any description were
seen in the Ruchigga mountains and their northern and eastern
extensions.- Bush-buck and Harnessed Antelope were seen at
rare intervals in the valley of the Kagera. The latter appeared
occasionally at the edges of the dense forests near the mouth of
the Kagera, and in one or two places in the narrow valley of the
Kagera between the mountains.
Bush-buck were occasionally seen in .the Koki hills and the
mountains of Ruampara, where the deep guilies choked with
vegetation afforded them shelter, and the open grassy hillsides
excellent feeding-grounds.
On the steep hills of Ankole and Karagwe, Klipspringers were
common wherever the ground suited them. The form in this
country shows some differences when compared with the klip-
springers of other parts of Africa, and may prove to be an
intermediate variety.
Of Monkeys, Colobus guereza was seen in the forests near the lake,
The common grey African monkey was also observed in many
places, and an interesting species, Cercocebus aterrimus, was also
seen in the dense forests near the lake and in the dense forests
round Minziro, The last-named monkey looks almost black and
is very shy. Its ery is very loud and peculiar, reminding one
slightly of the ery af the Chimpanzee. Baboons ave common,
especially in the mountains in Ankole and Karagwe.
188 LT.-COL, C, DELME-RADCLIFFE ON THE NATURAL [June 6,
Wart-Hogs (Phacocherus cethiopicus) were occasionally to be
met with all along the valley of the Kagera, though nowhere very
numerous. Aardvark were present, though of course never
seen unless dug for, Their holes, however, were found in all
directions in the low-lying country, and they are probably fairly
common.
Of beasts of prey Lions are fairly common in Bukanga, in the
neighbourhood of the Nyakafunzo swamp. They also appear in
western Ruampara and in Rushenyi and Mpororo. In general
terms, it may be said that they are to be found wherever large
herds of zebras and antelopes exist. In Bukanga, however, it
appears that they have taken to man-eating fairly extensively.
The natives in this part of the world have a wholesome dread of
them, and during the short time the Boundary Commission was
at work in Bukanga repeated instances occurred of lions attacking
human beings.
Leopards are also found throughout the whole area under
discussion except the extreme western portion. Although they
live principally on the small antelopes, monkeys, guinea-fowl,
&e., they also take toll of the natives’ goats, &c., and thus become
sometimes a great nuisance. At Mulema camp, for instance,
a leopard took goats from one hut or the other almost every
night for a month, and when Captain Laughlin, Dr. Bagshawe,
and Mr. Doggett endevoured to kill him at the natives’ request,
he wounded, more or less seriously, no less than thirteen men
before being finally despatched. Cheetahs apparently do not
exist in this part of the country west of the lake. Serval Cats
were occasionally met with, and a smaller grey, rather long-tailed
Wild Cat. Hyzenas appeared occasionally, but may be said to be
rare. They were of the usual spotted variety.
Otters are common in the lake. Two forms were met with,
one very large, the other smaller. These two are stated also
to be common in Lake Kivu.
Among smaller mammals, interesting species were a Peacilogale
doggetti, an extremely handsome, large, striped Stoat; Tatera
fallax; Procavia bettoni: these three being new species. Another
extremely interesting animal was Herpestes galera robustus, a
fish-eating Mongoose.
In all about 180 specimens of mammals were collected, and a
large number have been described in the ‘ Proceedings’ of the
Zoological Society of London, the most interesting being the new
Buffalo (Bubalus caffer radcliffe), Pecilogale doggetti, Tatera fallaa
and Procavia bettont. There is no doubt that a scientific inves-
tigation would disclose a much larger number of small mammals
than were secured for the collections of the Boundary Com-
mission. All the region west of the lake abounds with species
of great scientific interest, the interest increasing the further
west one goes, and it is a matter for the greatest regret that
a collection could not be made in the neighbourhood of the
Mtumbiro Mountains.
1905.] HISTORY OF THE UGANDA ANGLO-GERMAN BOUNDARY. 189
Bibs.
Lake Victoria is a disappointing sheet of water in bird-life as
in fishes. Birds are of course present, but not in the vast
numbers so extended a sheet of water in the heart of Africa
might lead a naturalist to expect. The reason is probably to be
found in the fact that the food-supply in the lake is very deficient
for birds and fishes alike—for many species of birds in consequence
of the poverty in fish.
The White-headed Fish-Hagle (Haliaétus albicilla) is fairly
common all round the lake-shore and up the Kagera River. This
bird is invariably found in pairs, and appears to divide the districts
into beats, each containing its pair of fish-eagles in possession,
Their cheerful squalling, as described by Sir Harry Johnston, is
one of the most familiar sounds near African river and lake.
An Osprey may also occasionally be seen on Lake Victoria
seizing fish on the surface of the water ina manner peculiar to its
kind
A species of Plotus is fairly common, and may be seen in small
congregations at certain points where the ambatch or rocks afford a
convenient spot for perching and hanging their wings out to dry.
With them may also be seen the large Cormorants, which here
and there form communities numbering several hundreds. The
northern end of the island Usuwgwe and the small rocky
Mwasambwa Islands and Dumo Point are favourite haunts of all
these birds.
A large Gull, resembling the black-backed gull at home when on
wing, is also not uncommon close in-shore and especially in the
rivers.
The Pied Kingfisher is fairly common inland. The two varieties
of brilliant-hued Kingfishers appear to forsake theix occupation of
fishing to devote themselves entirely to the capture of insects.
Herons are fairly plentiful in the swamps and at the edge of
the lake. The most conspicuous amongst these is the Goliath
Heron, a bird whose immense span of wing can be fully appreciated
when, disturbed by a canoe, he flaps slowly across the Kagera
River. The common Grey Heron is also a familiar sight, and at
times flocks of the White Egret. Night-Heronsare fairly common
along the Kagera River.
In the lake, Egyptian Geese and Spur-winged Geese may be seen
in small numbers; Pigmy Geese ave not wacommon near the lake-
shore, where the open reeds afford them shelter.
Yellow-billed Ducks are perhaps the commonest of the ducks on
Lake Victoria. Throughout the course of the Kagera River no
ducks and geese were observed until reaching the Rufua River, and
especially the Karenge Lake. The latter seems a favourite haunt
of wild-fowl, and for this region of Africa is very well supplied
with water-birds of all descriptions.
Huge flocks of Pelicans are to be seen, and large numbers of
Pochards and Yellow-billed Duck ; also Egyptian Geese.
190 NATURAL HISTORY OF UGANDA ANGLO-GERMAN BOUNDARY. [June6,
A few Pin-tailed Ducks were also seen, but no Mallard at any
time. ;
Teal are not uncommon; and in the Rufusa Stream and the
swampy streams draining the Karenge Lake the Snipe were fairly
numerous in December and January.
Along the lake-shore, especially among the ambatch trees, were
vast communities of Weaver-birds. No less than seventeen
forms are represented in the collection of these, many belonging
to the brilliant species found inland.
Ibiges are not uncommon near the water. The Glossy Ibis is a
common bird, and most travellers are familiar with its exasperating
ery when disturbed. The Sacred Ibis, on the other hand, is much
shyer, and confined to larger and remote sheets of water.
Crowned Cranes are common, especially in the west.
Bustards are not uncommon, especially in the open cattle-
country in the west, about December. Denham’s Bustard, the
large red-necked species, was frequently seen.
Pigeons are not often seen, but the Doves in places were very
numerous indeed, especially in Bukanga.
Parrots were scarce, except the one small species collected.
Grey Parrots, so common in Uganda, were never seen near the
Kagera.
Birds of Prey were represented by the Bateleur Eagle and
another species which was frequently observed pursuing guinea-
fowl.
Vultures were rarely seen except in Bukanga, where the lions
provided them with frequent meals.
It is worth noting that in April a migration of Hobbies appears
to pass through the country. Enormous numbers of this
handsome little faleon were seen at the same time busily
engaged in pursuing locusts, large clouds of which appear to
make their appearance at the same time.
In the neighbourhood of the lake Hornbills of two species
are common, and Touracoes of two species make their appearance
in the dense forests.
An interesting bird was the Honey-guide, which in Bukanga
and the narrow valley of the Kagera River very frequently
provided us with honey by leading to the nests of wild bees.
Goatsuckers are common, and in March, April, and May the
ennant-winged species became very conspicuous, as when the
long feathers are developed the bird has the appearance, when
on the wing, of a toy Japanese kite.
Three species of Bee-eaters were seen, but the Roseate Bee-eater
of East Africa and the Nile countries did not make an appearance.
The birds belonging to the scrub and open forest country, the
Barbets, Woodpeckers, Pittas, Swallows, Flycatchers, Thrushes,
Shrikes, Tits, and Finches, were never to be seen in large numbers,
though appearing in isolated parties sufficiently often to preserve
the district from the appearance of lifelessness, which is a
disappointing feature in other parts.
1905. ] ON MEXICAN AMPHIBIANS AND REPTILES. 191
The Larks and Pipits were, on the whole, very scarce. An
extremely handsome Glossy Starling was a very conspicuous bird,
which seemed to like the neighbourhood of camps. The White-
necked Crow and the fine Razor-billed Raven were especially
common in the west; and it was in the cattle country and on
the Ruchigga Mountains that the Tick-birds (Buphaga) were
observed, although some were seen following large herds of
elands in Bukanga and Mpororo, and the rhinoceros in Karagwe.
Perhaps the most noticeable feature in the bird-life was the
extraordinary number of Francolins of every species to be seen in
Bukanga, very valley and almost every patch of dry grass
appeared to contain a large number of these birds. In the
evenings, when the grass had been burnt in patches, numbers of
Francolins could be observed feeding in the open like pheasants
outside a cover in September at home. It would have been easy
to have shot forty or fifty brace a-day if time and cartridges had
been available.
2. The Distribution of Mexican Amphibians and Reptiles.
By Hans Gavow, F.R.S., F.Z.S.
[Received May 17, 1905.]
(Text-figures 29-32.)
CoNnTENTS.
Introduction, p. 191.
List of Species collected by H. G., p. 198.
Physical Features of the Localities, p. 196.
Review of the Distribution of Cecilia, p. 199.
= : Urodela, p. 200. Summary, p. 204.
39 29
Se F Anura, p. 205. ss p. 208.
. os Crocodilia, p. 209. 3 p. 209.
s i Chelonia, p. 209. 4 p. 210.
- = Lacertilia, p. 211. 5 p. 220.
Ophidia, p. 222, 55 p. 226.
33 3)
Distribution according to Altitude, p. 227.
List of Species occurring in High Altitudes, p. 232.
General Conclusions :—Evolution of Middle America, p. 234..
Immigration and Spreading, p. 238.
Northern and Southern Immigrants, p. 241.
INTRODUCTION.
These investigations are based upon a considerable material
which it is convenient to enumerate :—
1. The volume on Reptilia and Batrachia, by Dr. Giinther, of
the ‘ Biologia Centrali-Americana,’ with its thousands of references
to localities,
2. Cope’s posthumous work, ‘The Crocodilia, Lizards, and
Snakes of North America,’ Rep. U.S. National Museum for 1898.
3. Boulenger’s Catalogue, with the lists of ever-increasing
additions, of the Collection in the British Museum of Natural
History.
4. Collections made by Dr, Meek during his ichthyological
192 DR. H. GADOW ON MEXICAN [June 6,
tours through many States of Mexico. These, and others, I have
been able to examine owing to the courtesy of the officials of the
Field Columbia Museum, Chicago. Dr. Meek has, moreover,
given me much verbal information about the physical aspects
of the places visited by him.
5. There is a fair number of native specimens in the Govern-
mental Museums and other Institutions of various towns in
Mexico; for instance, in Mexico City, Orizaba, and Oaxaca, but
the labels vouchsafe at best no further trustworthy information
than ‘“‘ Mexico” or “ La Republica.”
6. Lastly, the material which I have collected myself, or noted
down, during two journeys in Mexico, notably in the Valley of
Mexico, the States of Vera Cruz, Oaxaca, Guerrero, Morelos, and
Puebla, and in the neighbourhood of Zapotlan s. Guzman in
Jalisco, especially the Nevado de Colima. The features of the
Central and Northern plateau, except the vicinity of El Paso,
I know only from several rapid transits, quite enough, however,
to gather the main aspects of this enormous stretch of country.
Moreover, here Dr. Meek’s information has been especially
welcome. Valuable for comparison, but of too short a time
for serious collecting, were a few days passed in New Mexico,
the Grand Cation of Arizona, the Californian Desert, and the
neighbourhood of San Francisco.
A few words are necessary as to the way in which I have
marshalled the thousands of data. The reputed localities were
marked down on an outlined map of the Republic, a separate
map for each species. In this way alone generalisations could be
formed, often at a glance, concerning the distribution of the
species and genera. Many localities, at first suspicious, revealed
themselves as very doubtful or as obviously erroneous on further
reference to the original papers.
Tt was also found that the number of different localities is
astonishingly small, less than 100, although they now cover a
fair portion of the whole country. With the exception of 20, all
these localities lie south of the line Guadalajara, Guanajuato,
Tampico. The whole State of Michoacan and the western half
of Guerrero are still an almost absolute terra incognita, but to
judge from what I have found in Middle Guerrero and what is
known from Colima, the fauna seems to be rather continuous.
However, the basin of the Lower Balsas and thence to Colima
will in all probability yield much of interest to whoever will brave
these inhospitable and positively unknown regions.
Both Godman (introduction to the volume on Rhopalocera) and
Giinther, in their statistical tables, have divided Mexico simply
into Northern and Southern by an absolutely arbitrary line which
runs from Mazatlan to Tampico right across the country! They
have done this in spite of their correct statements about the
main physical features of Mexico, the unmistakable continuation
of North American forms over the Plateau, and the extension of
1905. } AMPHIBIANS AND REPTILES. 193
Southern or Central American forms northwards into the Pacific
and the Atlantic borderlands embracing this Plateau. 'The two
columns in these tables are of no use, they are even misleading.
Giinther has properly taken off Yucatan as a separate district.
Cope’s division (op. cit. p. 1206) into a Sonoran, Austroriparian,
Text-fig, 29.
©
Revilla
Gi pedo
Tne Wy
Qa
Map of Mexico.
and 'Tolteean subregion of Blanford’s Medi-Columbian region, and
the Atlantic+ Pacific Tierra Caliente as belonging to the Neo-
tropical region, is excellent when taken broadly ; but his sub-
division of the Toltecan into an Oriental, Central, and Occidental
province is a failure.
List of Species collected by myself during the months of June
to October 1902 and during 1904.
Dermophis mexicanus. San Juan Evangelista.
Amblystoma tigrinun. Lake Xochimilco.
5 altamirant. Dos Rios. Contreras, Sierra de Ajusco.
Thorius pennatulus. Citlaltepetl, 9000’; Cerro de S. Felipe, Oaxaca,
8250’.
Spelerpes orizabensis. Citlaltepet], 8000-12,500’.
» leprosus. 5 8000-11,500’.
%, chiropterus. is 9000-10,000’.
5 variegatus. Orizaba, Presidio S. of Cordoba, Tetela, 8. Juan
Kvangelista.
*. belli. Omilteme.
Batrachoseps attenuatus. Nevado de Colima, 7000’.
Scaphiopus dugesi. Totolapan, S. Oaxaca.
Rhinophryne dorsalis. Presidio; Agua fria.
Proce. Zoou. Soc.—1905, Vor. II. No. XIII. 13
194
Bufo valliceps.
» marinus.
5 marmoreus.
>, mtermedius.
Hyla baudini.
» eximia.
» Sstaufferi.
» coper.
Phyllomedusa dacnicolor.
Hylodes rhodopis.
» beatae.
Hupemphix gadovii.
Leptodactylus albilabris.
% caliginosus.
Borborocetes mexicanus.
Syrrhopus verruculatus.
Paludicola mexicana.
Engystoma ustum.
Rana montezume.
» halecina.
3 palmipes.
Crocodilus americanus.
Caiman sclerops.
Cinosternum integrum.
5) effeldti.
99 leucostomum.
sp pennsylvanicwn.
Dermatemys mawi.
Nicoria rubida.
Chrysemys grayi.
“6 ornata.
Chelone viridis.
Spherodactylus glaucus.
Phyllodactylus tuberculosus.
Coleonyx elegans.
Holbrookia texana.
Uta elegans.
5, bicarinata.
» irregularis.
Phrynosoma asio.
4 modestum.
Sceloporus torquatus.
x spinosus.
- acanthinus.
op Sormosus.
os pyrrhocephalus.
% encus.
DR. H, GADOW ON MEXICAN
[June 6,
Orizaba, Presidio, Motzorongo, Tetela, Agua fria.
Tetela, San Mateo del Mar, Tehuantepec; Iguala,
Tierra Colorada; San Luis Allende.
Salina Cruz; Cocoyul, Tierra Colorada, Cajones
3000’, Chilpancingo, Rio Balsas, Iguala.
Tetela, Totolapan, Oaxaca; Omilteme, Chilpancingo,
Presidio, Motzorongo, La Raya; Tierra Colorada.
San Luis Allende.
Tacubaya near M. C., Buena Vista.
Motzorongo.
Chilpancingo, Mazatlan, Cajones.
Rio Balsas; San Luis Allende.
Citlaltepetl, 8000-12,500' ; Motzorongo, Agua fria ;
Nevado de Colima, 8000’.
La Perla, North of Orizaba.
San Mateo del Mar.
Agua fria, Salma Cruz, Cocoyul.
8. Juan Evangelista; S. Mateo del Mar, Salma
Cruz, Tequesixtlan ; Cocoyul, Pacific Camp, San
Luis, Tierra Colorada.
Omilteme, 7500’; Nevado de Colima, 8000’,
Buena Vista, S. Guerrero.
Chilpancingo.
Presidio and Motzorongo.
Xochimileo, Chalco, Zapotlan.
Mexico, Orizaba, Motzorongo, La Raya, Agua fria,
Salina Cruz, Tequesixtlan, near Totolapan ;
Cajones, Buena Vista, Tierra Colorada, Limon ;
Omilteme.
Motzorongo, Tequesixtlan ; Cuernavaca.
La Raya, Agua fria, Rio Balsas, Pacific Camp.
Agua fria.
San Mateo del Mar; S. Dionisio, Zapotlan.
San Mateo,
San Luis Allende.
Tetela.
Tetela, Agua fria, San Mateo del Mar.
San Mateo.
San Mateo.
San Mateo; Pacific Camp.
Salina Cruz.
Totolapan ;
Colorada.
Cocoyul.
Juarez, El] Paso.
Juarez ;San Marcial, N.M.; Grand Canyon, Arizona.
Salina Cruz, T'equesixtlan, San Bartolo, Totolapan,
Rio Balsas, Iguala, Mesquititlan, Chilpancingo,
Tierra Colorada, Cocoyul.
Cocoyul, San Luis Allende.
Salina Cruz, Tequesixtlan ; Rio Balsas.
Juarez, Hl] Paso; San Marcial, N.M.
Xochimilco; Chilpancingo; Zapotlan, Nevado de
Colima.
Totolapan.
Cuernavaca, Iguala, Rio Balsas, Tierra Colorada,
Ayutla.
Oaxaca, Cerro 8. Felipe, 6000'; Omilteme.
Oaxaca; Chilpancingo ; Nevado de Colima, 7000-
6000’.
Teuala, Rio Balsas.
Citlaltepetl, up to 18,700° ; Contreras,
Pacific Camp, San Luis, Tierra
1905. | AMPHIBIANS AND REPTILES. 195
Sceloporus scalaris.
variabilis.
f siniferus.
re melanorhinus.
eS microlepidotus.
op gadovia.
Corythophanes hernandezi.
Basiliscus vittatus.
Iguana rhinolophus.
Ctenosaura acanthura.
Be quinquecarinata.
Ameiva undulata.
Cnemidophorus gularis.
3 mexicanus.
s bocourti.
: deppet.
3 striatus.
guttatus.
39
Anolis sallei.
5, tropidonotus.
> nebulosus.
» gadovii.
» liogaster.
Gerrhonotus gramineus.
99 antauges.
55 deppet.
45 imbricatus.
5 liocephalus.
Eumeces fuscirostris.
% lynxe.
Mabuia agilis.
Lygosoma laterale.
Anelytropsis papillosus.
Chirotes canaliculatus.
Glauconia albifrons.
a; dulcis.
Boa imperator.
Tropidonotus melanogaster.
i sealiger.
“5 ordinatus,
var. eques.
var. marcianus.
i scalaris.
3 chrysocephalus.
Contreras.
Chilpancingo, Tierra Colorada, Rio Balsas.
Orizaba, La Perla; Mexico, Presidio, Motzorongo,
la Raya, Tetela, Agua fria. Chilpancingo ;
Nevado de Colima, 7000-6000.
San Mateo del Mar, Tequesixtlan, San Carlos
Yautepec. From Pacific Camp to S, Luis, Tierra
Colorada, Buena Vista, up to southern slope of
Los Cajones.
Tierra Colorada, Cocoyul, San Luis.
Citlaltepetl, up to 13,500’. Xochimilco, Contreras.
Iguala; Omilteme, Nevado de Colima.
Mesquititlan between Mescala and Chilpancingo.
Motzorongo.
Motzorongo, Agua fria, Huile; Tequesixtlan
Tierra Colorada, Ayutla.
Tetela, Agua fria ; Tequesixtlan, Totolapan.
Yetela, Agua fria; ‘Tequesixtlan; Cuernavaca,
Iguala, Tehuantepec, Salina Cruz, San Mateo.
Rio Balsas, Tierra Colorado, Cocoyul, Pacitic
Camp.
Salina Cruz, Tequesixilan.
Presidio, Agua fria; Cocoyul forest ; North and
South below Los Cajones.
Puente de Ixtla. Rio Balsas. Chilpancingo.
Cuernavaca.
Oaxaca.
Oaxaca.
San Juan Evangelista. Tehuantepec; Salina
Cruz; Tequesixtlan; Totolapan; San Carlos.
Rio Balsas. Tierra Colorada ; Cocoyul; Pacific
Camp; San Luis Allende. Ayutla.
Salina Cruz; Totolapan; ‘Tierra Colorada;
Ayutla; San Luis; Cocoyul.
Agua fria.
La Perla near Orizaba.
Motzorongo, La Raya.
Cuernavaca. Tierra Colorada; Cocoyul, San Luis
Allende, El Coquillo ; Nevado de Colima up to
7000’.
Tierra Colorada.
Omilteme, 7600’.
Citlaltepetl, 8000-9000’.
¥ 12,000’.
i 8000-10,000'.
i 8000-10, ‘000 5 La Perla; near Mexico,
7800’; Nevado de Colima up to 11,000’.
Omilteme, 8000’.
Nevado de Colima.
Omilteme 8000’.
Salina Cruz, Tequesixtlan ; Tierra Colorada, Cum-
bre del Coquillo, Buena Vista, Cocoyul.
La Perla.
Motzorongo.
Rio Balsas.
La Raya; Chilpancingo.
Rio Balsas ; Chilpancingo.
Motzorongo. North of Rio Balsas; Coquillo.
Xochimilco. Nevado de Colima.
Xochimilco.
Xochimilco. San Mateo del Mar.
Rincon, N.M.
Citlaltepetl, 8000-12,000’,
Omilteme,
13*
196 DR. H, GADOW ON MEXICAN [June 6,
Contia nasus. Contreras.
Zamenis mentovarius. San Mateo, Tequesixtlan.
35 mexicanus. Rio Balsas, Cocoyul.
3 pulcherrimus. Salina Cruz.
3 lineatus. Tguala.
Coluber eorais. La Raya; Tequesixtlan; Ayutla.
Coronella micropholis, var. B. Chilpancingo, San Luis Allende.
Urotheca elapoides. La Raya.
Drymobius margaritiferus. fotzorongo, Agua fria, San Juan Evangelista.
3 boddaerti. Motzorongo, La Raya.
Leptophis mexicana. Motzorongo, La Raya.
* diplotropis. San Mateo del Mar.
Rhadinea decorata. Presidio.
Hi clavata. Tetela.
Ws vittata. La Raya, Salina Cruz, Tequesixtlan, Totolapan ;
Omilteme, Chilpancingo.
Streptophorus atratus. Presidio, Motzorongo, La Raya.
Geophis semidoliatus. Orizaba.
Geagras redimitus. San Mateo del Mar.
Trimorphodon upsilon. Cuernavaca, Rio Balsas.
is biscutatus. Tierra Colorada.
Himantodes cenchoa. La Raya.
Tieptodira personata. Rio Balsas, Ayutla.
45 albofusca. Cocoyul, San Luis ; Nevado de Colina.
A guilleni. Rio Balsas.
Conophis vittata. Salina Cruz, Tequesixtlan.
Homalocraniwm miniatum. Tezonapan, N. of Ayutla.
Manolepis putnami. Los Cajones.
Petalognathus nebulatus. La Raya.
Dryophis acuminatus. Motzorongo.
laps fulvius. La Raya, San Juan Evangelista.
Lachesis lanceolatus. Motzorongo, La Raya.
» atroaw. Motzorongo.
Crotalus terrificus. Tequesixtlan.
43 triseriatus. Citlaltepetl, 9000-12,500’ ; Nevado de Colima.
PuysicAL FEATURES.
A list of the names of the localities where collections have
been made should be supplemented by @ short description of
the chief physical features; without these it is of no more use
than the bare mentioning of the name of the political country.
The “altitude” is supposed to be all-sufficient; but this is a
great mistake, since it conveys nothing without further informa-
tion. For instance, 2000 feet on the Atlantic slope means typical
tropical hot-country vegetation, while on the Pacific side (¢. 9.
Oaxaca and @uerrero) the same elevation implies pine- and oak-
forests, with a character devoid of tropical fauna and flora.
Mexicans divide their country into the Tierra Caliente, Templada,
and Fria, with a hot, temperate, and cool climate respectively ; the
Tierra Templada corresponding on an average with an elevation
of 3000 to 5000 feet. But the natives of the State of Vera Cruz
draw the imaginary line at a level very different from that used
by the citizens of Puebla. Chilpancingo, 4100 feet, in Guerrero,
has a much cooler climate, with nothing tropical about its
vegetation, than Oaxaca, 5060 feet, or even Orizaba at 4027 feet,
which is in many respects subtropical.
Valley of Mexico, 7600 feet. Alluvial; swampy meadows to
west and south. Lake Texcoco brackish, Lakes Chaleo and
1905. ] AMPHIBIANS AND REPTILES. 197
Xochimileo freshwater, surrounded by meadows, wooded hills
with streams.
Sierra de Ajusco, volcanic, well-wooded mountains. Contreras,
8090'; Dos Rios, 8800’, pines. Orizaba, 4027’; on the east side
of the slope of the plateau; valley with streams, pastures, and
rich vegetation, on alluvial and hard-limestone terrain. Thence
gradual ascent to the volcano Citlaltepetl; dense mixed forest,
oak, arbutus, and pines, about 9000’; giving way entirely to pines.
Tree-line about 13,500’; then tussocks of grass. Snow-line about
14,500’.
Cordoba, 2700’. Dense tropical vegetation. Thence south-
wards, through limestone terrain, along the foot of the slopes,
which are covered up to the edge with luxurious forests ; east-
wards bordered by savannahs. Permanent rivers with high
banks ; lagoons in the forests and savannahs.
Motzorongo, Presidio, and La Raya, about 1500’, in forest land.
Tetela, about 900’, near the edge of the savannah.
Agua fria, 100-200'; lagoons, swamps, and low forest; flat
country, subject to inundations. The Rio Papaloapan, with its
many tributaries, carries an enormous volume of thick, yellow
water; much of the lower basin is for months under water, only
island-like parts standing out, used as refuges, although by no
means sanctuaries, by the game and other creatures.
Then follows low, undulating, rolling, cattle-grazing land, with
sandy subsoil.
San Juan KEHvangelista, 100’. Tropical river-bed through
savannahs, bordered by dense lowland forest.
Isthmus of Tehuantepec. Eastern slope, dense humid ever-
green forest; on the ridge, less than 1000’, open country with
temporary stagnant lagoons; on the western slope prevails the dry
Pacific type without continuous forests, but with more scattered
patches of mostly deciduous trees.
Tehuantepec, 120'. Sandy, varied terrain.
San Mateo del Mar. Sandy, lagoons connected with the sea.
Flat, scanty vegetation except in occasional swamps or near the
lagoons, some of which are fringed with dense low brushwood
and small trees.
Salina Cruz. Porphyritic terrain; hilly, steep coast-range, varied
by promontories and fresh- and salt-water lagoons.
From Salina Cruz and Tehuantepec northwestwards to Oaxaca.
The coast-range, averaging 2000-3000 feet, is covered with
pines down to 2000 feet. Tequesixtlan, 560’, in a river-valley, shut
off by the coast-range; varied, rather low vegetation, volcanic
alluvial. Thence through mountainous country, across parallel
ridges. Hills at first with tropical vegetation; oak-forests from
3000’ upwards, then pines prevailing, but nowhere continuous
forests. General character of the country dry, most of the smaller
rivers run dry except in the rainy reason. An intricate system of
198 DR. H. GADOW ON MEXICAN [June 6,
hills, deep gorges with sandy river-beds and patches of xerophile
vegetation, especially cactus.
San Bartolo, 2800'; San Carlos, 2460', in more open country.
Totolapan, 2800’, in broad, sandy river-valley. Thence steep
ascent on to the plateau, the edge of which is 5300’. Looking
back, southwards, over the many ridges of mountains and hills,
the Tierra Caliente appears to be densely covered with wood,
while towards the north stretches the flat, almost treeless
Southern Plateau, here and there with outcropping low ridges
which are barren when of volcanic, wooded when of Paleozoic
formation. ;
San Dionisioand Tlacolula, 5160’; Oaxaca, 5060’. The Paleeo-
zoic terrain stretches from Oaxaca westwards. There is the
forest-clad Cerro de San Felipe, 9000 feet high, with semialpine
meadows on its slopes.
From Cuernavaca southwards to the coast.
Cuernavaca, 5000’. Fertile valleys of voleanic and limestone
terrain, with little streams. Shut off from the Valley of Mexico
by the high, voleanic, densely wooded Sierra de Ajusco, &c.,
averaging 10,000 feet.
Puente de Ixtla to Tetecala. Pleasant, fertile, varied open country;
limestone terrain, in which are the huge Caves of Cacahuimilpa.
Tguala, 2400’, in a wide plain, surrounded by limestone hills,
with scanty vegetation.
Rio Balsas Station, 1500’; in the valley of the Balsas or
Mescala River. Very mountainous ; tropical vegetation. High
and low forest, interspersed with much brushwood. The
river, during the rainy season, brings down floods of yellow or
brown water with rather little sand, but much comminuted
vegetable matter. The bed is rocky, limestone, the banks
mostly steep, but there are many sandy shelves above the high-
water mark. Mescala, 1700’.
The Balsas basin is bordered on the southern side by a long and
high range of mountains, parallel with the Pacific coast, attaining
heights of 10,000 feet, densely wooded, intersected by very deep,
steep, and long gorges, and the river-beds are the only available
roads; here and there these river-beds broaden out into meadows.
Mesquititlan, 2800’. Narrow, luxuriant gorges.
Zumpango, 3400’. Open, sandy, meadows.
Chilpancingo, 4100’. In a windswept, shallow depression of
Cretaceous terrain, surrounded by sparsely wooded hills, and
meadows on the top of the ridge.
To the west, in the mountains the hamlet of Omilteme, 7100’,
luxurious forests; at first oak, dwarf palms and pines; then
oak, pine, and arbutus; then oak and pine; and lastly pines up to
the highest summits, forming dense high forests, with the
most luxurious underwood in the gorges, especially within the
cloudbelt.
Mazatlan, 4200’. Meadows and fields.
1905.] AMPHIBIANS AND REPTILES. 199
Cumbre de los Cajones; the pass at 3500’ over a ridge which,
on the south, flank of the main range, marks the beginning of
volcanic terrain. Oak and pines and ‘columnar cactus.
Buena Vista, 2300’. Wide meadows, with pools in the rainy
season ; low hills with oak and pines.
Typical Tierra Caliente, with an essentially tropical aspect of
flora and fauna, begins on the southern slopes of the main ridge,
coinciding with what is officially and locally known as La Costa.
Its upper ~ limit may be put at not higher than 1000 feet. In the
depressions between the successive parallel ranges of ‘hills the type
is absolutely tropical and southern, but the country loses this
character at once on the ridges which rise higher than 1500 feet.
Tierra Colorada, 990'; river valley, voleanic. Andesite overlaid
with red rubble.
Valley of the Omitlan River, 500’. Limestone, densest vege-
tation on the slope which culminates in a ridge of 1600’,
called Kl Cumbre de Coquillo.
Coquillo to Chacalapan, about 700'; tropical life-—From here,
across several smoothed down ridges and to the coast, the
subsoil consists of gneiss and granite in rapid decompo-
sition, fairly well wooded in clumps or large patches, often
interrupted by meadows and natural stretches of pasture.
Numerous small rivers, carrying much sand, but nearly always
with clear water, but most of them are lable to run dry in the
winter. Near the granite-bound coast are numerous lagoons,
mostly of fresh water, and there is a broad belt of almost impene-
trable high forest, which in many places touches the sea. The
mangrove-swamps of course are permanent, but during the rainy
season many parts of these forests are inundated.
Limon, 1800’. Open, dry grass country.
Teconapan, 1500’. Broad meadows.
Ayutla, 1200’. Permanent river; rich vegetation.
Cocoyul, 160’. Near the coast forest.
Pacific Camp. Near the shore, 99° W., 16° 36’ N. Close to the
forest ; large lagoons and swamps; granitic rocks and mangroves.
San Luis Allende, oa0n Broad river-valley, with well-
wooded hills which are covered with various kinds of oak, and
from 1900' upwards chiefly with pines.
Nearly the whole Coastal District is, during and after the rainy
season, covered with a dense mass of tall herbs, which between
the trees especially take the place of underwood.
CACILIA.
Dermophis mexicanus.—This is the only Ceecilian which extends
into the Mexican Tierra Caliente. Previously known to range
from “Tehuantepec” to Panama, I found it in the low woods
near San Juan Evangelista. The American ancestral home of
this circum-tropical family is South America, and none are known
to occur on the Antilles or on the Galapagos. It is therefore
200 DR. H. GADOW ON MEXICAN [June 6,
interesting that these burrowing, slowly moving worm-like
creatures have managed to travel over at least 1500 miles of
ground, covered with humus, since the close of the Miocene epoch,
i.e. since the separation of the Antilles (cf p. 237). A not
unreasonable computation of one million years carries us back into
the Miocene epoch. The rate of spreading could in this case
have been extremely slow, only about one mile in 700 years, and
this works out at three yards a year. Of course this is mere
speculation, but it may be as well to give even such an imaginary
instance of slow spreading. The fact remains that Dermophis ~
has done it, and whether we double or treble the rate of progress,
or increase the time two- or three-fold, the result remains within
very reasonable possibility.
URODELA.
The Amblystomatine are a pre-eminently Eastern Palearctic
group; only two out of eight genera occur in North America:
Dicaumptodon ensatus in California, and Amblystoma, with some 16
species, on the North-American Continent, and one, A. persimile
in Siam. In Mexico only two species occur.
Amblystoma tigrinuwm, the larval form of which, when per-
manent, is the famous Axolotl. This species has an enormous
range, from the State of New York to Dakota and Colorado, whence,
apparently now with wide gaps between, it extends through
Mexico, as far south as the valley of Mexico City. But its dis-
tribution in Mexico is, at least now, restricted to the western
Sierra Madre and the southern part of the Mexican plateau.
Well-ascertained localities of this species are the following :—
West of Chihuahua Town; West of the town of Durango;
Cumbre de los Arrastrados in Jalisco; somewhere N.W. of Guada-
lajara ; district of Autlan in Jalisco ; Lake Patzcuaro in Michoacan,
Valley of Mexico, notably Lakes Xochimileo and Zumpango
(but not Lake Texcoco, to which alone Weismann’s dismal dream
to account for the permanent Axolotl stage could apply!).
Possibly there are Amblystoma, either metamorphosing or as
Axolotls, in or near some of the other lakes of Michoacan and
Jalisco, but they have as yet not been recorded from Lake Chapala ;
and I found none in the Lakes of Zapotlan; nor were such
creatures, or even the name Axolotl, known to the natives.
A. altamirani.—This species, which metamorphoses regularly into
a gill-less Newt, is known only from the streams of the mountains
which border the western and south-western side of the Valley of
Mexico. It was discovered in the Montes de las Cruzes, about 15
miles to the west of Mexico City, at an altitude of 8800 feet. In
1902 I found it also above Contreras, in the Sierra de Ajusco,
some 12 miles south-southwest of the city, at an altitude from
8500 feet upwards to 8800 feet. Further up the rivulets are
apparently too small. I stated in ‘ Nature,’ Feb. 5, 1903, that
searching in the streams only a little above the City of Mexico,
1905. | AMPHIBIANS AND REPTILES. 201
which lies at an altitude of about 7600 feet, was fruitless. Inthe
month of September 1904, however, when we revisited this
district, I was able to ascertain that these Newts live regularly in
the stream below Contreras (altitude 8090 feet) down to about
7900 feet, where the stream leaves the hills, and runs, still
swiftly, in its stony bed through the Pedregal, or recent field of
Java, then through rich evergreen meadows into Lake Xochimilco.
Moreover, I can now add with certainty that A. altamirai is
absolutely aquatic throughout its life. The natives (millers, field-
labourers, and boys) knew the creatures well. They called them
“axolotes sordos” (deaf, having no ears), and described them as
axolotes sit aletas (without winglets, meaning gills); when I
searched for them on land, on the bordering meadows, under
stones, or amongst the trees, the people laughed at my ignorance
of expecting to find “fishes” on dry land. ‘There are no fishes in
that stream. But this, their “ fish,” they pronounced as no good,
because these axolotes de cerro (Mountain Axolotl) are not eaten
like the ‘ axolotes del lago.”
During our last visit the mountain-streams were transformed
into turbid roaring torrents, and it was only at a few spots that
the Newts were visible, generally in some stiller water, in the
shelter of some great boulder. There they stood, or rather were
lying, on little patches of sandy bottom, the larvee working their
gills vigorously, the adult motionless except for the undulating
tail, and never rising to the surface to breathe. They were all
extremely shy, quickly hiding beneath or between the stones.
In the Montes de las Cruzes, close to the railway-station Dos
Rios, the streams form here and there little swamps or ditches,
with much watercress in the slowly-flowing water; there we
found plenty of larve; the adult only in the running water.
Not one of these mountain-streams runs dry.
The lungs are well developed.
The only specimen, a larya 100 mm. long, which I succeeded in
bringing home alive in 1902, metamorphosed within 8 weeks,
losing the fins and gills, and closing the gill-openings completely,
but it died before losing the yellow and black piebald coloration.
The distribution of Amblystoma in Mexico coincides absolutely
with the large central and western portion of the country, which
has been covered with volcanic masses, repeatedly or successively,
since the Kocene epoch ; and the last outburst, which produced the
Pedregal near Mexico, is known to have occurred after this part of
the country was already inhabited by man. It was impossible for
- Amphibia to live on such a terrain until it was weathered enough
to sustain a permanent and moisture-loving vegetation. In fact
every locality where A. tigrinwm is known to occur is on the
Quaternary, mostly sandy, patches formed by the disintegrating
debris of the voleanic masses; or it is found in the lakes, all of
which are partially filled-up mountain valleys.
We have to conclude that the Amblystomas are recent
immigrants from the North. Where they have met such lakes,
202 DR. H. GADOW ON MEXICAN [June 6,
these have become, or are becoming, too attractive for them, with
the result that A. tégrinwm has sunk, or is sinking, into a more or
less perennibranchiate state, the Axolotl. Typical Axolotl are those
of Lake Xochimilco, the condition of which I have deseribed in
‘Nature, Feb. 5, 1903, and Lake Patzcuaro, which, with its
rushes, weeds, and other abundance of vegetation, is very similai
to the Mexican lake. Sexually ripe Axolotl are also known from
Jalisco mountain tarns or lakes, and lastly from St. Mary’s Lake,
Estes Park, Colorado. It is therefore the combination of certain
favourable circumstances (permanence of water, abundance of food,
shelter, equable temperature) which produces the ‘“ Axolotl.”
Whoever has seen the very different conditions prevailing in Lake
Zumpango, to the north of Mexico City, will easily credit Velasco's
statement that A. ¢igrinwm metamorphoses into the normal gill-
less Newt, as it does in the United States, and probably in various
other parts of Mexico.
Allthe more interesting is the fact that the other species, A.
altamirani, the only one which lives in the streams of recent
voleanic mountains, has been modified into a gill-less but
permanently aquatic form.
DESMOGNATHIN#.—The three species of Desmognathus inhabit
the Kastern United States.
Typhlotriton speleus is restricted to subterranean caves in
Missouri. Thorius pennatulus, the only remaining member of
this small group, and its sole representative in Mexico, points
therefore unmistakably to the Eastern half of North America as
the original home of the group, not of Thorius itself.
This tiny Newt, less than two inches in length and thinner
than a match, with weak limbs and reduced digits, shows a peculiar
dimorphism of the size of the nostrils. They are very large and
open in the males, much smaller in the females. The lungs are
quite aborted as in Desmognathus and Spelerpes.
Thorius has a very limited distribution. It was discovered
on the south-western slope of the Pic of Orizaba. J found
Thorius in abundance on the south slope, 9000-10,000 feet, in
high, mixed forest, either on the ground beneath flat pieces of
fallen bark, or on decaying logs of pine between the bark and
the wood amongst the ‘““worm-meal” of boring beetles and maggots.
Again I met them under exactly the same conditions on the
Cerro de San Felipe, 8250 feet, near Oaxaca. These are the only
two localities so far as we know at present. It is doubtful
whether their distribution is now continuous; the watershed
between the Atlantic and Pacific, to the west of a line drawn from
Orizaba to Oaxaca, averages about 8000 feet in height, and it is well-
wooded, but there are several deep transverse depressions in it.
PLETHODONTINH.—This group, consisting of 5 genera with
about 40 species, is entirely American, with the sole exception of
Spelerpes fuscus in Kurope.
1905. | AMPHIBIANS AND REPTILES. 203
Spelerpes.—This large genus, composed of about 20 species,
ranges from Massachusetts into North-western South America.
At least 10 species live in Mexico, 9 of them south of a line drawn
from Guadalajara to Tuxpan on the Atlantic; some of them
extend into Guatemala and Costa Rica. S. yucatanicus in Yucatan.
A few occur as far south as Peru; one, S. infwscatus, inhabits
Hayti, and S. fuscus lives in Sardinia and Northern Italy.
The distribution of the Mexican species is important. The
Aztec name is “ Tlaconéte ” = little land creature.
S. cephalicus, described by Cope from ‘“ North-eastern Mexico.”
No Spelerpes seem to occur in Texas ; the nearest American species,
S. multiplicatus, lives in Arkansas; S. orizabensis and S. lineolus,
the latter with tiny, reduced limbs, are known only from the
mountain of Orizaba, S. orizabensis ranging between 8000 to 12,000
feet.
S. leprosus, of which gibbicaudus Blatchley is a not unfrequent
individual variation, is common in the mixed and pine forests of
the mountain of Orizaba, up to 12,000 feet. It has also been
recorded from the north slope of Popocatepetl, 9000 feet, and from
the mountains of Jalapa.
S. morio from “ Jalapa,” and from Tlalpam, which lies between
Mexico City and Lake Xochimilco, in flat, sandy, moist terrain,
with meadows and willows. It appears again far in the south, in
Guatemala and Costa Rica.
S, chiropterus. Mountain of Orizaba, from the town, 4000 feet
up to near 10,000 feet; ‘ Jalapa,” and Cuernavaca which has an
elevation of 5000 feet. ‘ Vera Cruz” must be left as a doubtful
locality.
S. rufescens is recorded from ‘“ Orizaba,” Cordoba, Vera Cruz,
Tehuantepec, Chiapas, and Tabasco; all in the Tierra Caliente,
except the first locality.
S. variegatus ranges from the Valley of Mexico, Orizaba (from
9000 feet downwards), Jalapa, Cordoba, right through the forest of
the Tierra Caliente and through the whole of Central America tc
Costa Rica. I found it on Orizaba mountain, as well as at San Juan
Evangelista, which lies scarcely higher than 100 feet above the
sea, in the same ground with Dermophis.
S. untformis, with reduced limbs like S. lineolus, described from
Costa Rica, elevation of 5000 feet, is said also to have come from
“ Vera Cruz.”
Lastly, S. belli: mountains of Jalapa, Orizaba, Mexico,
Zacualtipan, Guanajuato, Guadalajara, Sierra de Nayarit; and
at Omilteme, west of Chilpancingo. This species alone has found
its way across the plateau, following the belt of alluvial deposits
described elsewhere (p. 237). With the exception of this transverse
belt, the distribution of Mexican Newts coincides closely with the
broad band of Cretaceous limestone which extends from Nuevo
Leon to the Isthmus, with intricate but almost continuous
patches verging from Cordoba and Orizaba south-westwards to
Chilpancingo. This limestone terrain was the only one available
204 DR. H. GADOW ON MEXICAN [June 6,
for Newts during most of the Tertiary period: on the west the
plateau suffering from the volcanic revolutions; on the east
the sea still covering the present Atlantic Tierra Caliente. The
Cretaceous parts formed so many oases where alone Newts could
exist or survive. Later, when the volcanic ranges, even the
voleanoes themselves, became covered with forests, the Newts
spread onto them, just as they have spread into the moist hot-
lands of the State of Vera Cruz. It may appear strange that the
limestone should have been the means of their preservation, con-
sidering that lime-water is, as a rule, not favourable to their
development ; but here comes in the significant fact that most, if
not all, the Mexican Spelerpes are viviparous, unless they deposit
their eggs, like Batrachoseps, in hollow trees. Some of them, for
instance S. orizabensis, lead a partially arboreal life. We found
many on the pine-trees of Citlaltepetl, favourite hunting and
hiding places being the epiphytic plants, especially the large
TMlndstne. Orchids, and Philodendron in the hot country forests.
The humus and moisture collecting in these growths, often many
feet above the ground, swarm with insect life and with little
Scolopendras, which seem to be the staple food of these Spelerpes.
The apparent absence of Newts on the Northern plateau is most
likely due to the dearth of permanent moisture, long-continued
periods of drought, and dust. A more difficult question is the
apparent absence of Newts on the terrain of gneiss and granite
which covers so large a portion of Southern Guerrero and Oaxaca,
and on the well-wooded mountains of the Sierra Madre. For
months have we searched Guerrero during the rainy season (there
are thousands of places which, if they were on the Eastern slope,
would yield an abundance of Newts), but it was in vain. A few
specimens of S. belli, from the mountain forest of Omilteme, are
the only exception.
Batrachoseps.—B. scutatus ranges from Illinois to Rhode Island
and to the Gulf of Mexico; the other species live in the Pacific
States, from California to Oregon. Quite unexpected was there-
fore the occurrence of the Californian LB. attenwatus on the Nevado
de Colima. I found a single, young specimen on the northern
slope, at about 7000 feet elevation, in the stump of a decayed pine-
tree. There are some patches of granite and of limestone in that
district, but then comes an unbroken stretch of originally
volcanic formation, for about 200 miles, until the gneiss is
reached to the north-east of Mazatlan. We cannot well imagine
that this species is an ancient survival; it must be a comparatively
recent immigrant from the north-west, from California. Probably
it occurs all through the slopes of the western Sierra Madre, which
is mostly clad with pine-forests.
Résumé of the Distribution of Mexican Urodela.
All the American Urodela are of Nearctie origin, with their
earliest centre in Old Sonoraland. At least the Amblysto-
1905. | AMPHIBIANS AND REPTILES. 205
matinee point to the long-continued land-connection with Eastern
Asia. A later centre of dispersal lies in the Eastern half
of North America, the old Appalachia, the Alleghany moun-
tains, &e., whence Urodeles have spread, as Plethodontine and
Desmognathine, over most of the Eastern and Southern States,
also into and through Mexico’s eastern half. This spreading
dates back to Miocene times, witness the existence of Spelerpes in
Hayti, while others have reached even South America, and, lastly,
the occurrence of a Plethodon somewhere in the La Plata basin.
Much later immigrants, directly from the old north-western home,
are Amblystoma and Batrachoseps: A. tigrinum and B. attenuatus
being identical species in the States and in Mexico, only 4. alta-
mirant being a new modification ; while Spelerpes has developed
many species, different in the north, centre, south, and in Hayti.
ANURA,
PELOBATIDE.—Scaphiopus, the Spadefoot, closely allied to the
European Pelobates, is the only American genus of this family,
with about 7 or 8 species, two of which are restricted to the United
States. The zone of sandy terrain of Texas, New Mexico, and
California is richest in Spadefeet, whence they have extended over
the Mexican plateau down to the Pacific and Atlantic coasts.
S. dugest s.hammondi has the widest distribution: from Missouri
and California through New Mexico and Texas, the mountains
west of Chihuahua, in Guanajuato, and again on the southern slope
of Oaxaca, where I found it at Totolapan, its most southern locality.
The retiring habits of the Spadefoot no doubt account for the
few scattered- records. The well-wooded mountain ranges which
form the south-eastern, southern, and western borders of the
Mexican plateau are a natural obstacle to a further southward
spreading of this genus,
Buronip#.—Central America and Mexico are one of the centres
of Bufonide. Concerning Mexicans, they can be grouped as
follows :—
1. Indigenous: Rhinophryne dorsalis, the only species of the
genus, a toad specialised as an eater of Termites ; it is restricted to
the moist Atlantic Tierra Caliente, from Tuxpan, north of Vera
Cruz, through the Isthmus to Campeche and Guatemala. The
light- coloured spots on the bluish-slaty black skin are either yellow
or orange to red, varying in individuals from the same locality.
They are very sluggish, rather nocturnal, and retire beneath a
rotten stump or into a small self-dug hole in the moist humus.
Aztec name “ Poche.”
2. Southerners : Hngystomops, the few species of which range
from Venezuela and Ecuador northwards, but only 7. pustulosus
reaches the Isthmus of Tehuantepec.
Several of the 13 species of Swfo found in Mexico are southern
forms: in their spread northwards they either stop short at the
206 DR. H, GADOW ON MEXICAN [June 6,
Isthmus, B. coccifer and Bb, sternosignatus ; or they extend into
the Atlantic hot-lands, canaliferus; or along the Western Sierra
Madre into Jalisco, intermedius, with marmoreus peculiar to
South-western Mexico; or they go as typical hot-country Toads
into both the eastern and western Tierra Caliente, marinus,
valliceps on the Atlantic side from Nicaragua to 'Texas, not on the
plateau, but recorded from Jalisco and Presidio near Mazatlan ;
lastly, B. stmus from Panama on to and over most of the Mexican
plateau.
3. Northerners, chiefly at home in the South-western United
States and in the northern half of Mexico, eventuallly extending
south over the Central plateau: B. punctatus, debilis, compactilis.
Of the Bufonide which are found in the Greater Antilles all
are now separate, insular species, except B. marinus, which has
probably been introduced.
Hytipa.—The creative centre of this family is decidedly South
America, Every one of the 14 genera of Hylide is found in
America, and it is only by the large genus Hyla (incl. the slightly
modified Mylella) that this family has attained its world-wide
range with the remarkable exception of the whole Paleeo-tropical
region. From North-western South America they have spread
through Central America into the Antilles (about 7 or 8 species,
mostly peculiar), and through Mexico into North America.
Concerning Mexico they fall into the following groups :—
1. Genera peculiar to Mexico: Pternohyla, P. fodiens of
Presidio near Mazatlan ; Zriprion, 7. petasatus of Yucatan; but
Diaglena jordant of Ecuador and Corythomantis greeningi of
Brazil point to the south as the old centre of these peculiar
Mexicans.
2. Genera with preponderating numbers of species in Central
and South America, while comparatively few have reached, or have
been developed in, Mexico: Phyllomedusa with only P. dacnicolor
on the Pacific side, Agalychnis callidryas and Nototrema oviferum
in the Atlantic Tierra Caliente.
P. dacnicolor is saturated green, often with the same white
temporary patches or spots as happen so frequently in the
Australian Hyla cerulea, They were pairing at Rio Balsas in the
month of June. During the nightly thunderstorms the males
kept up an incessant noise like the snarling bark of little dogs.
The couples were sitting in low shrubs or amongst herbs, a foot
above the ground, overhanging little ditches which led into a dirty
stagnant pool. During the daytime the ditches were absolutely
dry. The eggs are very small, very numerous, and of a light
grass-green colour.
3. Hyla. About 15 species are recorded from Mexico, to which
no less than 11 seem to be peculiar, but at least 8 of these have
hitherto been found in single localities only. Our knowledge of
the distribution of Tree-frogs is still very defective. Most of them
inhabit the forest-regions of the Atlantic slope. They are dis-
1905. ] AMPHIBIANS AND REPTILES, 207
covered and caught by mere accident. For instance, I found one
single specimen of /7. staufferi at Motzorongo, a species until then
known only from Guatemala. H. bowcourti of the same country
has been recorded once from Tepic, none from the enormous
intervening stretch. H. miotympanum seems to range from the
Isthmus through the mountainous parts of Vera Cruz, going up
towards Puebla. H. venulosa is an eastern form, from South
America to Tampico, decidedly Atlantic, but once recorded from
near Mazatlan. HH. baudini, the commonest Tree-frog, ranges from
fcuador right through Central America, and then spreads east and
west through the hot countries of Mexico, absolutely avoiding the
plateau, but reaching Texas.
On July 4, 1902, when the rains were very irregular, we found
H, baudini spawning, south of Cordoba. On a piece of inundated
woodland meadow, about the size of a suburban lawn, were 45,000
frogs at a low computation, two-thirds of them in amplexus, the
other males making a deafening din. Next day the pool was dried
up completely, the grass glazed with the spawn, and there was not
a single frog to be heard or seen in the neighbourhood.
Hf, copei, known as ‘‘ Sapo blanco” or white toad, is a hill form.
Known already from Texas, Chihuahua, Guanajuato, and Jalisco,
I found it plentiful on the whitish calcareous terrain south of
Chilpancingo, not in the trees but sometimes on rather barren
and dry fields. Decidedly typical of the western and southern
plateau and its Pacific slope, and very abundant, is H. eximia.
Result.—Mexico has many Hylide in common with Central and
even South America; but the majority are now peculiar to Mexico,
and only two, H#. cope: and H. baudini, extend northwards into
Texas.
CysTiGNATHIDA, like the Hylide, of decidedly South-American
origin, Of the 15 or 16 genera of this family only Leptodactylus *,
Paludicola, Syrrhopus, Hylodes*, and Borborocetes occur also in
Mexico, altogether with some 23 species. Those marked * are also
Aoneilleen. ‘Not one reaches the United States : ; in fact the most
northern record is made by H. calcitrans at Zacatecas. B, meai-
canus is peculiar to the Central plateau and the high mountains of
Jalisco, Colima, and Guerrero. Of the 9 or 10 species of Hylodes
6 are restricted to Mexico, but their recorded localities are still
too few and scattered, The same applies to the six species of
Syrrhopus ; the others range far south to Nicaragua and Costa
Rica : H. palmatus is Pacific, HH, melanostictus Atlantic Mexican ;
HT. rhodopis on either side. The last is the commonest species and
seems to be an instance of a southerner which, although not going
on to the plateau itself, ascends the high mountains on its eastern,
southern, and western borders, e. g. Citlaltepetl up to 10,000 feet,
Cerro de Oaxaca, Nevado de Colima; it also inhabits the hot low-
lands of Agua fria in the State of Vera Cruz. Mostly of dark
brown and reddish tints and living on or near the ground; how-
ever, some specimens in the epiphytic Tillandsias, or on green
208 DR, H, GADOW ON MEXICAN [June 6,
shrubs at the edge of a forest, were quite green, but they soon
changed to reddish yellow and ultimately assumed the normal
reddish colour.
Of the 5 species of Leptodactylus, 3 are too little known,
L. microtis from “‘ Guanajuato ” would be the only instance of the
occurrence of a Leptodactylus on the plateau instead of in the
lowlands. Only two species have a wide distribution : L. albilabris
of South Guerrero, Oaxaca, and of Vera Cruz, also Antillean ;
L. caliginosus from Paraguay northwards, in Mexico in the
‘Pacific Tierra Caliente as far as Mazatlan.
ENGYSTOMATID, with an obviously South-American centre of
dispersal; not Antillean. The small genus Hngystoma reaches
through Mexico into the South-eastern United States (1. wstwm).
Ranww#.—This family is essentially Paleo-tropical. Scarcely
more than a dozen species, all belonging to Rana, occur in North
America, only 6 in Mexico, and fewer still further south, in
the north-western portion of South America. There, however,
the Ranide have found a new congenial home, which has stimulated
them into the development of 5 new genera, with about one dozen
species, all arboreal, besides Dendrobates. The Ranide have not
found their way into the Antilles.
Of the six Mexican species, 2. forreri is restricted to the district
between Durango and Mazatlan; 2. pustulosa to same district
and Western Jalisco; &. omiltemana to Guerrero mountains:
these three are peculiar to Mexico. &. halecina is the common
river-frog of the country, both in the hot parts and on the plateau,
extending from the United States through the whole of Mexico
down to Costa Rica. palmipes ranges from southern tropical
Mexico to South America. Lastly, 2. montezwme, the largest of
all, is a lake-dweller, e. g. lakes of Jalisco, near Mexico City,
Tehuantepec, extending south into Tabasco and Guatemala.
Résumé of the Distribution of Mexican Anura.
We can easily distinguish between northern and southern
immigrants.
1. Northern, decidedly of Nearctic origin. Scaphiopus, scarcely
reaching the Isthmus of Tehuantepec; and a few Rana, all water-
frogs. Both genera are comparatively recent immigrants, non-
Antillean, although Rana extends through and beyond Central
America.
2. Southern, of obvious South-American origin.—a. With
related, or identical, species in the Greater Antilles. Cyséz-
gnathide, not reaching the United States. Wylide and Bufonide,
each, especially the Hylide, with genera peculiar to Mexico,
indicating ancient residence.—b. Non-Antillean, a few Hngysto-
matine, scattered through Mexico,
1905. ] AMPHIBIANS AND REPTILES. 209
CROCODILIA.
Crocodilus americanus is the commonest tropical American
Crocodile, from Florida to Northern South America. In Mexico
it is strictly confined to the Tierra Caliente, with Mazatlan as its
north-western limit. It ascends the Rio Balsas at least up to
Meseala, but this is not much more than 1700 feet above sea-level.
Common in the lagoons on the coast of Guerrero and Oaxaca,
except where it has recently been well-nigh exterminated by
American skin-hunters. More exist in the river-systems of the
State of Vera Cruz, ascending occasionally up to Motzorongo,
i. e. 1500 feet. During the rainy season they often forsake the
then turbid rivers, and roam at night through the forests in
search of lagoons.
CO. moreleti inhabits the Tierra Caliente from Tampico to
Honduras.
Caiman sclerops s. punctulatus has its centre in South America.
In America it occurs only in the Atlantic hot-lands. I met with
very large specimens (length of skull 20 inches) at Agua fria in
the same lagoons and rivers as the Crocodile. Whilst the latter,
anyhow not averse to brackish water, inhabits the Greater Antilles,
the Caiman has found its way only into Trinidad and, if report
is true, to Martinique. The Alligator of the southern United
States does not seem to cross the Rio Grande.
CHELONTA.
It seems almost incredible that Chelydra has never been re-
corded from Mexico, considering the wide range of Ch. serpentina
in the United States and the existence of the other species,
Oh. rossignoni, from Guatemala to Ecuador. The Papaloapan
and 8. Juan Rivers of the State of Vera Cruz are certainly large
enough, with pools and backwaters, but I could not ascertain the
presence of a large, snappy species.
DERMATEMYDID#.—The few species of this family are peculiar to
Central America. Dermatemys mawi extends from Honduras
into Yucatan and Vera Cruz; it occurs, for instance, in the pools
of the forests and savannahs near Tetela, where it is known as
the “Tortuga blanca.” Stawrotypus seems to have a similar
range: S. triporcatus going up to Vera Cruz; S. biporcatus only
up to the Isthmus.
CINOSTERNIDH, with the sole genus Cinosternum. About 10
species in North and Central America, one extending to Guiana.
Well represented in Mexico by 6 species. Of these, C. pennsyl-
vanicum, previously recorded from the Valley of Mexico, was.
found by myself in South Guerrero, at San Luis Allende.
O. hirtipes ranges from Arizona and New Mexico along the
Pacific side into Jalisco, and includes the Tres Marias Islands.
Proc. Zoou. Soc.—1905, Vou. Il. No. XIV. 14
210 DR. H. GADOW ON MEXICAN [June 6,
C. sonoriense in Sonora. C’. integrum (a variety of C. scorpioides)
is likewise Pacific, from Jalisco, e. g. Lake Chapala, to which I
can now add Zapotlan and the small rivers on the plateau south
of Oaxaca and the swamps of San Mateo near Tehuantepec.
C. leucostomum extends from New Orleans along the Atlantic side
of Mexico through and beyond Central America. C. effeldti is
known from the State of Vera Cruz, San Mateo del Mar, and
Guatemala.
TESTUDINIDH.—Cistudo with two species in North America and
one in Yucatan, strictly terrestrial. (C. mexicana of Texas and
New Mexico, e. g. San Marcial. How far it extends into Mexico
is not known ; Tampico is quite possible, but I very much doubt
“ Mexico City” and neighbourhood.
Nicoria rutila I have met in swampy bush-land of the State of
Vera Cruz and near Tehuantepec, and this seems to be its range ;
allied species occur in Central America.
Chrysemys extends from Canada to Argentina, but with a
preponderance of northern forms. In Mexico restricted to the
hot countries, and even there common only about the Isthmus,
whence C’. grayi=wmobra and C. incisa go further south. C. ornata,
from Panama to Tehuantepec, has been found by Forrer also
near Mazatlan, with C. pulcherrima. I do not know of a single
locality for Chrysemys on the plateau, or to the east of it, except
for C. mobiliensis, which goes from Texas into the lowland of
Nuevo Leon.
’ This scarcity of Water-Tortoises in Mexico is rather puzzling.
On the plateau Cinosternwm alone is found, and these thick-shelled
box-like creatures are, moreover, the only kind which can with-
stand the buffeting to which they are subjected in the torrents
into which the rivers of the slopes of the plateau are converted in
the rainy season. The Tortoises hide then under the boulders in
the stream. Chrysemys shuns such waters, and neither it nor
Cinosternum occurs in those rivers which carry much sand.
Chelone viridis was laying during July and August on the
coast of Guerrero and Oaxaca.
résumé of the Distribution of Mexican Chelonia.
The Cinosternide, taken with the closely-allied Dermatemydidee
and Chelydride, are autochthonous Americans; the first a
Sonoran, the second obviously a southern group so far as the present
distribution is concerned. Both Chelydrids and Dermatemyds
are known from the Cretaceous of North America. The three
together may well be regarded as originally northern and ancient.
The same applies to the Testudinide, the only family which has,
recently, sent a United States Chrysemys into the Antilles and a
South American into the Windward Islands. The Testudinide,
plentiful in North America, scarce in Central, and with still
fewer species in South America, have clearly come from the
1905. ] - AMPHIBIANS AND REPTILES. 211
Northern continent. The earliest, probably all of the genus
Testudo, have been found in the mid-Eocene of Wyoming and
New Mexico; since Oligocene in Europe, still later in India.
With this remote occurrence in ancient Sonoraland I couple the
most important fact of the Galapagos Tortoises. They are a
strong indication of the former, let us say Oligocene, extension
of land considerably to the west and south of the present Central
America. We shall find this idea supported by Iguanide. Now
North America possesses but the single 7. polyphemus in the
South-eastern States, and South America has only 7’. tabulata.
Something has gone wrong with this genus, which has flourished
in the Miocene of Dakota, Nebraska, and Oregon, as has been the
case with so many mammals which started and flourished in the
States and aie now restricted to the Old World.
LACERTILIA,
GecKoNID#.—The distribution of American Geckos is almost
entirely tropical. The greatest number and diversity of species
occur in the Antilles, in Northern South America and the
adjoining Central America, whence few have spread into the
warmer parts of Mexico, avoiding the plateau. North America
has received only Spherodactylus notatus from the Antilles
through the Bahamas into Florida, and Phyllodactylus tuberculosus
into California; this species is the commonest Gecko in Mexico,
ranging strictly along the Pacific slope to the Isthmus of Tehu-
antepec and thence to Nicaragua. Spherodactylus sends only
three species into Mexico: S. glawews to Salina Cruz and into the
State of Vera Cruz; the Central American S. torguatus and
the Antillean S. anthracinus are recorded from the same State,
and S. torquatus has been described from Mazatlan. Gynno-
dactylus sumichrastt reaches the Isthmus, and Zhecadactylus
rapicauda, of Yucatan, Antilles, and southwards, is said by Cope
to have been recorded from Guadalajara, a very doubtful locality.
Phyllodactylus tuberculosus is common in the villages of Southern
Oaxaca and Guerrero, where it is known as “ Pata de bueye,”
i. e. ox-foot, because of its peculiar digits. The general name for
Geckos is ‘‘Salamanqueza” or ‘‘Salamanquezca,” which name, how-
ever, also applies to the slippery Mabuia and Humeces. I found
the same Gecko on the trees of dense forests near the coast of
Guerrero. Spherodactylus glaucus is typically xerophile. As in
Spain and Portugal, all Geckos are considered extremely poisonous.
EuBLEPHARIDE.—This small and very scattered family (in
West Africa, Somaliland, India, Transcaspia, and Persia) 1s
represented by three species in Mexico, a few others occurring in
Panama and Ksuador. Hublepharis variegatus is the northern
offshoot, from El Paso to the Gila River and California, probably
also in Sinaloa. L. fasciatus is known from Ventanas, north-west
of Mazatlan. These are apparently typically xerophile, like the
14*
212 DR. H. GADOW ON MEXICAN (June 6,
two Asiatics of the same genus. But Coleonyx elegans is distinctly
a forest form, I found it a few miles from the coast of Guerrero
in a moist patch of thick lowland forest on the ground under
stones and rotten stumps. A typical Central American, ranging
through the Pacific and Atlantic Tierra Caliente of Mexico, from
which country it had hitherto been recorded only by Sumichrast
from near Orizaba; extending south to Costa Rica.
Ieuanip# 7.—It is not profitable to speculate upon the or iginal
home of this family. The overwhelming majority of genera and
species is American, from Mexico to Brazil It is well known that
the Galapagos possess the semimarine Amblyrhynchus and Cono-
lophus, that a few species occur in Madagascar, and Brachylophus
fasciatus in the Viti and Tonga Islands ; further, that an Iguanid
allied to the genus Jguana existed in the Hocene or Oligocene of
Europe, and that therefore attempts have been made to explain
the present scattered distribution of the family by a formerly
subuniversal range; in other words, they are a very ancient
group.
Concerning America, it is significant that only a few species of
Sceloporus and Phrynosoma extend into the United States,
although far northwards, Of the large genus Anolis, only
A. carolinensis enters Texas to Carolina, but it is also found in
Cuba.
Mexico itself, Central America, and the Antilles are rich in
genera and species. These Iguanide can be divided into two
groups :—
A Sonoran set, comprising genera which are essentially xero-
phile and humivagous, with depressed bodies and short tails.
None of these reaches far into Central America, and none has
entered the Antilles. Crotaphytus, Holbrookia, Uta, Phrynosoma,
Sceloporus, which, in the order mentioned, extend from California
and Arizona southwards, with decidedly Pacific or Western pre-
dilection ; only a few Sceloporus, those which have spread into
the Atlantic Tierra Caliente, continue further into Central
America. Nearly all these southern Sceloporus are fitted for
arboreal life, less depressed in body, and suited to a moist climate,
be this hot or cool. They lead thereby to the second set, which
are essentially arboreal, mostly inhabitants of forests or of rocky
bush-land; all southerners, with their centre in Central and
South America, extending into the Mexican Tierra Caliente, with
prevalence on the Atlantic side, and two* have allied genera or
species in the Antilles : Anolis *, Iguana*, Basiliscus, Lemanctus,
Corythophanes, and Ctenosaura.
Of course there are transitional forms, for instance the genus
+ Iguana, or Guana, is a native word applied to-the Iguana; but where this does
not oceur, the name is given to Ctenosaura, for instance at Cuernavaca. The
Zapotec name of Ctenosaura is Tilcampo ; Basiliscus and Co1 rythophanes are called
Teteréte. At Rio Balsas, scaly lizards, e.g. Sceloporus, are distinguished as
Chintéte.
1905.] AMPHIBIANS AND REPTILES. 213
Ctenosaura, and we will not discuss the question which of the two
groups is the more primitive ; apparently the latter, but this can
be contested.
Crotaphytus, a typical old Northern Sonoran genus with several
species in Western United States. C. wisliseni ranging from
Oregon and Nevada into Sonora and Chihuahua; C’. collaris also
into Nuevo Leon.
Holbrookia, from Texas and California into the dry parts of
Northern Mexico. H. maculata into North Sonora, H. texana to
Monterey and Lerdo near Torreon. I found it running about
swiftly on the almost barren shaly ground near El Paso. A. pro-
pinqua from Texas to Presidio near Mazatlan.
Uta, with most species in South-western United States and in
Lower California. U. elegans from Utah to Texas and Sonora;
U. stansburiana from Utah to Torreon. U. lateralis from Presidio
and Tres Marias Islands and JU. bicarinata are Mexican, from
Presidio to Tehuantepec, and everywhere between these places.
Otherwise strictly confined to the western side of the plateau and
the coast, it has entered the plateau at Cuernavaca and Puebla.
J have almost invariably found it on the stems and branches of
low trees, upon which they flatten themselves like arboreal
Sceloporus; rather remarkable, since the other species are so
decidedly dwellers on the sandy or stony ground. Very important
is the occurrence of a species, U. auriculata, on the Revilla
Gigedo Islands, 280 miles south of Cape Lucas, Lower Cali-
fornia, and nearly 350 miles from the coast of Jalisco. This
genus is typically Sonoran, with its centre around the Gulf of
California.
Phrynosoma, “ Animal rey,” or “ Camaleén,” or ‘ Escorpién.”
The original centre of this genus is undoubtedly Sonoraland,
whence it extends now over most of the Central, South-western,
and Western States of North America and over the whole of
Mexico as far as Guatemala. Ph. cornutwm, modestum, and
orbiculare are, in Mexico, scattered over the plateau. Ph. asio
is the most southern and at the same time the largest and most
handsome species, ranging from Colima to Guatemala. Stejneger
and Cope have already remarked on the ‘‘metachrosis” of
Ph, douglasi. I have found Ph, modestwm near El Paso of
exactly the same delicate French-grey colour as the little slabs
of Cretaceous limestone with which the hills are strewn; the
same species at San Marcial and at Rincon in Mexico, on the red
and sandy voleanic rubble of that hilly desert region, were of the
same pronounced red tint. Examination with a magnifying-
glass showed the spirit-specimens to be covered with the iron-
stained red sand, but those which I have brought home alive
show this same red colour also to be that of their genuine skin.
Sceloporus may well be called the most characteristic genus of
Mexican Lizards. Of the 34 species recognised by Boulenger,
28 occur in Mexico, between El] Paso and Tehuantepec. Only
A live in the United States, and only 3 or 4 are found south of
214 DR. H. GADOW ON MEXICAN [June 6,
the Isthmus of Tehuantepec, and are restricted to Central
America.
Some species hate a very wide, others a very limited dis-
tribution. The majority combine humivagous with climbing
habits, and show great adaptiveness to the nature of their
surroundings ; for instance, S. scalaris and S. ceneus do not climb
the trees beneath which they live, but prefer the grassy ground,
and they are equally at home in the moist, clouded pine-forests
and on the more barren, grassy and lava-strewn slopes up to the
snow-line. S. variabilis prefers the wooded lowlands of the
Atlantic side, and likewise does not climb, loving the banks of
rivulets and well-herbed ravines. Others, e. g. S. torquatus, are
found only on rocks, stone walls, and buildings; they are swift.
Some—and these are the most depressed in body—are rather
sluggish, e.g. S. spinosus, and spend most of their time on the
ground between spiny growth of hedges and low trees, which
they ascend a little way, in short rapid jerks, when alarmed.
Lastly, S. microlepidotus is truly arboreal, ascending the trees in
the morning, with the sun, right into the green tops, where they
hunt for insects. This species has the greatest possible alti-
tudinal range ; from the hot country of Southern Oaxaca, only a
few hundred feet above the level of the sea, to the upper tree-line
of Citlaltepetl, about 13,500 feet elevation.
Many species are viviparous. According to my own observa-
tions, the following: acanthinus, eneus, formosus, microlepidotus,
scalaris—all gravid in the months of July to September.
Iguana rhinolophus is interesting for various reasons. It is
the largest Lizard in Mexico, attaining a total length of about
5 feet. Always arboreal and aquatic and truly tropical, it occurs
in the whole of Central America, but in Mexico, north of the
Isthmus, only in the States of Vera Cruz and Southern Oaxaca,
everywhere strictly below the Plateau, and on the Pacific side it
has been recorded only from Manzanillo near Colima and near
Mazatlan; undoubtedly also near San Blas and in the lower
reaches of the Balsas, but this information I have only from
hearsay. I never found it in Guerrero. The creature requires
permanent, rather sluggish rivers, or deep pools in the savannahs.
They climb about in the trees, eating the succulent leaves, which
they bolt without much chewing, for instance those of the guava
tree. Favourite places for resting are the branches which over-
hang the water, into which they plump with a loud splash,
sinking at once and remaining at the bottom for many minutes.
Whilst the adult are dusky, the young are grass-green and are
frequently found in the tall grass at the edge of a pool. They at
once take to the water and swim to the bottom, with their legs
laid back and propelling themselves, like newts, by rapid undu-
lating motions of the tail. The eggs are buried in the soft soil,
among the roots of a tree, always near the water, in the month
of May; by the end of July they are already hatched. They are
known as Guanas or Iguanas.
Ctenosaura acanthura is a common Lizard of the hot and warm
1905. | AMPHIBIANS AND REPTILES. 215
countries, from Yucatan to Tampico and on the Pacific side
as far as Southern California. It does not take to the water,
preferring rocky bush-land or savannahs. According to the
locality, it makes its home in a hollow tree, in the roof of a house,
or on the ground, where, among rocks or trees, it digs out a
permanent burrow, heaping up the soil above and around it.
This “Iguana,” or ‘‘Tileampo” of the Zapotecs, is very fierce,
bites, and lashes out furiously with its tail. Its food is varied,
from all kinds of lizards, snakes, and insects to grass and flowers ;
in turn the Tileampo itself is much prized as an article of food,
and in the markets fetches more than two fowls.
The young are entirely vivid green ; in their second and third
years the back and sides develop blackish patches upon the green
ground, and in this stage they are often very beautiful. With
approaching maturity the green colour disappears, being en-
croached upon and then entirely suppressed by the spreading
black and brown pigment. But in certain localities, where these
lizards live amongst luscious growth of evergreen trees, many
individuals retain their green livery throughout life. I caught a
young Tilcampo, which belonged to a green family, as shown by
the parents, at San Juan Evangelista, on the eastern side of the
Isthmus, where the green colour was normal; within less than
18 months my captive had lost all the green, and had assumed the
dusky brownish and patchy garb.
Ctenosaura quinquecarinata.—This much smaller, brownish-
yellow species is not arboreal, ranging from Honduras into the
southern hot parts of Oaxaca. It becomes very tame, takes a
varied diet, and defends itself in its burrow by sideward strokes
of its spiny tail, much like the Indian Uromastix, which it greatly
resembles in habits and outward appearance.
Basiliscus vittatws.—Closely allied to the Central American
B. americanus, ranges from Ecuador into the Tierra Caliente of
Mexico, where it is, however, restricted to the southern part, not
going further north than Cordoba. Until I found it at Teque-
sixtlan and Tierra Colorada in the centre of Guerrero, it was not
known from the Pacific side. The locality “ Orizaba” in the
‘ Biol. Centr.-Am.’ is erroneous; Sumichrast states clearly, and
correctly, that this species extends only up to 3300 feet. The
‘“‘ Pasarios,” its universal Spanish name, lives always on the banks
of rivers or pools. I generally found them busy on the ground
close to the water’s edge, or upon a low overhanging branch. On
the slightest alarm, they plunge or rush into the water, rapidly
running over the surface in a slightly erect position, splashing
the water with their long-toed hind limbs and the long wriggling
tail, whilst the arms are adpressed to the body. They do not
dive; arrived on the other side, they climb up the bank and hide
in the tangled vegetation. The usual statement that they propel
themselves by rapid strokes of the fore-limbs is erroneous, and
the notion that the high dorsal and caudal crests, which adorn
the male only, serve as a sail is a fable.
Corythophanes hernandexi, ‘'Veteréte.,-—From Chiapas and
216 DR. H. GADOW ON MEXICAN [June 6,
Yucatan to the State of Vera Cruz, absolutely confined to the
Atlantic Tierra Caliente, in forest-land ; arboreal, or rather amongst
shrub-like trees, the brown bark of which this curious-looking ~
gentle lizard looks to for protection. It feeds upon insects.
Lemanctus.—The two Mexican species are excessively rare,
perhaps because they live higher up in the trees, where it is then
next to impossible to discover them. J. serratus is known from
Campeche and the States of Vera Cruz and Oaxaca without localities.
L. longipes, hitherto known from Jalapa only; all the more re-
markable is the solitary specimen which I found amongst a
collection sent to.the Field Columbian Museum from the State of
Colima.
Anolis, with at least a dozen species in the Hastern or Western
Tierra Caliente. A. nebulosus has the widest range in Mexico,
from Tehuantepec to Jalapa, and to Ventanas on the west; I
found it not only on the coast of Guerrero, but also on the
Nevado de Colima, up to at least 7600 feet, together with A. lio-
gaster. A. gadovuw at Tierra Colorada, in bush-land. The Anolis
seem to spend most of their time on the lower branches of shrubs
and trees or amongst the rank herbaceous vegetation, waiting for
insects, and trusting to not being seen when basking. Especially
when they have become excited by being pursued, the males
stretch out their mostly beautifully-coloured gular sac. None
of the Mexican species which I have observed displays any marked
change of colour like the A. carolinensis, the “‘ Chameleon” of the
Americans.
TEs1IDz* are clearly a Neotropical family, with several dozen
genera in South America. Of all these, only Ameiva and the
closely-allied Cnemidophorus extend through and beyond Central
America: Amewa into the Eastern and Western hot-lands of
Mexico and into the Antilles; Cnemidophorus through Mexico
into the United States, where C. sealineatus has spread over nearly
the whole Union. This genus is entirely terrestrial, preferring
sandy districts with bush-land; only C. guttatus is a typical
inhabitant of the lowland forests of Vera Cruz. The Mexican
species avoid the high plateau, 5000 feet being about the upper
limit. The only exception is made by C. guluris, which has
been credibly recorded from Guanajuato, and of which I have
examined specimens collected by Dr. Meek close to the town of
Puebla, which lies at an altitude of more than 7600 feet, higher
than the Valley of Mexico, where Cnemidophorus does not occur.
Concerning distribution and variation, ef. my paper, “ Evolution
of the Colour-pattern and Orthogenetic Variation in certain
Mexican Species of Lizards, with adaptation to their surroundings,”
Proc. Roy. Soe. vol. lxxii. p. 109 (1903).
Ameiva wndulata, the only species in Mexico, is an inhabitant
* From the Aztec “teco-ixin,” ¢. e. Rock-lizard, the name of Sceloporus torquatus,
misspelt and misapplied. The Zapotecs and Mazatecs call Cnemidophorus and
Ameiva Zumbichi and Cachumbo.
1905. ] AMPHIBIANS AND REPTILES. 217
of the hot, well-wooded parts of Guerrero, Oaxaca, and Vera Cruz,
whence it extends far into Central America. It is far less quick
than Cnemidophorus, and I have found it invariably in the
vicinity of water.
AnGuIDa,— Anguis, with its sole species fragilis, and two species
of Ophisaurus s. Pseudopus (Morocco to Burma) are the only
members of this family which are not American, and even the
third species of Ophisaurus, O. ventralis, lives in the United
States. The countries now richest in Anguide are Mexico,
Central America, and the Antilles; a few extend into South, and
a few, Gerrhonotus with the Ophisaurus, into North America,
where the latter is widely distributed (also recorded from Jalapa).
Diploglossus is peculiar to the mountainous regions of Mexico ;
D. steindachnert from Orizaba, Jalapa, and Guatemala. The
related genus Celestws in Antilles and Central America.
Gerrhonotus is the main genus, eight species of which occur in
Mexico, entirely in mountainous districts or on the plateau; they
are consequently absent in the hot lowland forests, and references
to Vera Cruz and Tehuantepec do not apply to such towns but
to unknown places in the state or district.
G. ceruleus has the widest range, from British Columbia and
Colorado along the Pacific side of Mexico to Costa Rica. Most of
the species live on the ground, in the oak- and pine-forests,
preferring clearly a moist and by no means warm climate.
G. antauges ascends Citlaltepetl to an altitude of more than
12,000 feet, in the pine-forests, or in the grass near little streams,
and higher up amongst the tussocks of grass, basking on the top
of such a tussock and making its home among the roots or in
the mass of last year’s rotting blades. In such a place they
disappear easily, although they are not quick. The same applies
to G. inbricatus. G. gramineus, delicately light green above and
yellow below, is arboreal, ascending the highest trees in search of
insects and making its lair in hollow trees of oak, pines, and
arbutus. They all are viviparous, live on insects and worms,
and lose their shyness a few hours after having been caught and
handled.
XENOSAURIDH.— Nenosaurus grandis alone is recorded only
from the mountains near Orizaba, Cordoba, and Oaxaca.
HELODERMATID#.—The sole genus Heloderma, unless we include
Lanthanotus of Borneo. H. suspectum of Arizona and New
Mexico, and H, horridwm of Mexico. The notion that Heloderma
is a dweller on arid mountains is quite erroneous. It is restricted
to hot lowlands with sandy ground. Most of Arizona is high
and dry tableland, and there is quite a trade in “Gila monsters,”
but, so far as I could find out, they all came from such terribly hot
and low sandy places as Yuma, on the lower reaches of the Gila
river, and from similar localities in Sonora. H. horridum is
218 DR. H. GADOW ON MEXICAN [June 6,
stated by Giinther to have probably a wide distribution in Mexico.
The fact is that it has hitherto been recorded only from the
following localities :—near Tehuantepec, and near Presidio by
Forrer; and in the museum at Mexico is a specimen from
Apatzingan in Michoacan. It is very local. In Guerrero and
Oaxaca, Colima and Jalisco everybody speaks of the “ Escorpién.”
“He is unkillable unless you crush him with a big stone. When
at last secured in a cleft stick, his poison dropping to the ground
causes all vegetation to wither for yards around. There are two
kinds in Guerrero, one brown, the other black and yellow;
nocturnal, hidden in the daytime beneath the stump of a tree or
under a boulder; estivating during the dry season.” Hundreds
of times have I offered much money, even for being taken to its
lair, but all in vain. The only place where I personally know it
to occur is Juchitan, not far to the north-east of Tehuantepec ;
in the museum at Oaxaca is a stuffed specimen, a monster about
24 feet in length. At last I thought I had run the beast down,
when at Zapotlan in Jalisco. The poison, the sluggish fierceness,
difficulty in killing it, all this sounded favourable. We found the
Escorpion, but it was the harmless, gentle Gerrhonotus, which for
some unaccountable reason is feared as very poisonous! The
Zapotecan name of Heloderma is “'Talachini”; the Aztecs called it
“ Acaltetepon.” Hernandez states that “it is found in Cuernavaca
and other hot districts.” But it does not occur anywhere near
the State of Morelos, unless the huge figure of a lizard carved out
of a rock near Cuernavaca is evidence!
The last three families taken together form a very ancient
group, which seems to have its original centre in the old
Sonoraland, or let us say in the old Sonoran + Central American
+ Antillean landmass. The absence of Anguide in Eastern
Asia suggests the spread from North America into Europe and
Asia across the polar region, unless we prefer the problematic
bridge across the Northern Atlantic from the Antilles (which
possess their own genus Celestus with several species) towards the
Mediterranean.
Scincip£2—Of this large and almost cosmopolitan family
America possesses the smallest number, and it is significant that
the number of forms decreases from North to South. Mexico has
about 10 species. They may perhaps be divided into a Northern
lot, Hwmeces, which ranges from the middle of North America over
the Mexican plateau and its bordering mountains; and into a
Southern set, Jabuia and Lygosoma s. Mocoa, which love the hot
country, extending far into tropical South America, with species
in the Antilles, in Mexico restricted to the Southern States east
and west.
Mabuia agilis is fond of basking on shrubs and it even climbs
trees, hiding under the bark. Like Lygosoma laterale it hunts in
the dusk. Hwmeces, of which I have observed only lynwe and
fuscirostris, prefer mountain forests, where they live on the
1905. | AMPHIBIANS AND REPTILES. 219
ground, basking on the fallen leaves, between which, and in the
soft humus, they wriggle away with perplexing agility.
ANELYTROPSIDA, an artificial assembly of a few degraded
Scincoids in Madagascar, Tropical Africa, and <Anelytropsis
papillosus in Mexico. Of this only the two type specimens,
described by Cope, “ from near Jalapa,” were known, until I found
another in the humus of a dense forest near Motzorongo, south of
Cordoba.
XantustD#.—The range of Xantusia extends from the desert
tracts of Nevada, California with its impressive Mojave desert,
into Lower California. There is little doubt that some species
of Xantusia will be found in the desert-like country between
Chihuahua and New Mexico, which has all the characteristic
features of the home of Yantuwsia, not the least being the Yucca-
trees, the bunches of spiky leaves of which give them shelter.
The only other Mexican, Lepidophyma flavomaculatum, ranges
from Panama to the Isthmus of Tehuantepec. The few other
members of the family are likewise Central American, and one is
found in the Antilles. This little strictly American family shows
consequently division into a Northern or Sonoran, and a Southern
or Central American Antillean group.
ANIELLID#, with Aniella pubchra in California, and A. texana,
of which the only specimen known came from El Paso.
AMPHISBENIDH.—The distribution of numerous Amphisbeenidee
throughout Africa and several Mediterranean countries, as well as
in South and Central America, Mexico, Lower California, Florida,
and the Greater Antilles, seems to favour a former transatlantic
connection.
Curiously enough, Mexico possesses only one genus, but this is
the most interesting of all :—
Chirotes.—Discovered many years ago somewhere in Mexico,
Chirotes s. Bipes canaliculatus remained almost mythical. Then
Dugés received a single specimen from near Tecpan in Southern
Guerrero, which he named Hemichirotes tridactylus. Next, some
twenty years ago, the creature was discovered in Lower California
in considerable numbers, they are Cope’s Huchirotes biporus. IL
myself found Chirotes at last on the banks of the Balsas River, in
the centre of Guerrero. It lives there in the fields of alluvial
sand, well out of reach of possible floods. Our only chance of
getting these pink, worm-like creatures was the offering of rewards
to the Indians who were ploughing the fields of young Indian
corn in the month of July. They live at a depth of at least one
foot, burrowing little tunnels which lead a long way in any
direction in the moist sand, but in the drier parts collapse at
once behind the digging animal. When kept in a tin with
sand, they dug into it with their heads first and then with their
mole-like hands. They never appeared on the surface. Like
220 DR. H. GADOW ON MEXICAN [June 6,
the Portuguese Blanws cinereus they soon became flabby from
evaporation, but they soon swelled up again when the sand was
moistened.
To split these creatures into three genera is ridiculous. But it
is very interesting that the specimens from the only three localities
known differ in the number of femoral pores, the length of the
tail, and in the reduction of the number of the fingers and claws.
C. canaliculatus.—Fifth finger very small, clawless; three pores
on either side in front of the enlarged preanal scales; tail twice
as long as the head. Nasal plates widely separated.
Specimen in Berlin Museum...... Right hand 1.2.3.4.0; Left 1.2.3.4.0
British Museum I.............00006. 49 og bso SodicOs 2) Loto @o4h.@
s rep WT mean, ohne tt eee eMC SEW A Orgies RalbeOn OpeAmmO
OV Balsas Uses tee Ma tiyasite nea. iss pele sScdiaOeee VleGodaan &
PT elie, BPE. Mes. GAN, CATE, OU COURS. ARBs" FRR BROS aay
35 Pi OU Ee ee toeeSaneneane cubic ecamt er le iodotin®e mle Ho Ss dhow
(Fifth finger on both hands well-developed in Balsas If. and III.)
©. biporus (Huchirotes biporus Cope).—13 specimens in Smith-
sonian Institute, from La Paz in Lower California; said also to
be common at Cape Lucas.
According to Cope, with tail twice as long as the head, five
digits all clawed, with only one pore on either side, nasal plates
nearly in contact in front.
C. tridactylus (Hemichirotes tridactylus Duges). One specimen
from Teepan, near Acapulco. ‘Tail slightly longer than the head ;
only three digits, all with claws; a pair of pores on either side ;
nasal plates widely separated.
It is remarkable that Ohirotes, the least reduced member of the
family, is the only Mexican representative of this presumably
ancient group. Rhinewra of Florida has been found in the
Oligocene of South Dakota, whereby the former range is extended
considerably to the north. It is very difficult to imagine how
Chirotes, a helpless digger, without any chance of travelling, bound
to sandy soil, has managed to survive, unless we assume that it is
really a coast-form. Living in dunes, as it does at Cape Lucas,
Lower California, it may have ascended the Basin of the Balsas,
which river, from its mouth far into Guerrero, is bordered by
many sand-covered ledges.
The arenicolous Chirotes has retained its fore-limbs, which,
although short, are rather well-developed, while those genera
which live in humus and rich soil have lost the limbs as usual.
The natives had no proper name for these little creatures, but
described them as ‘‘culebritas con manitas.”
Réswmé of the Distribution of Mexican Lacertilia.
Geckonide.—Chiefly Antilles, North-western South America
and adjoining Central America.
Hublepharide.—North-western Mexico and Mexican Tierra
Caliente.
1905. ] AMPHIBIANS AND REPTILES. 221
LIguanide: :
1, Xerophile, humivagous; Sonoran, non-Antillean.
2, Arboreal; Central and South American and Antillean.
Tejide.—Neotropical, with Ameiva into Tierra Caliente and
Antilles, Cnemidophorus far into United States.
Anguide.—Mexican, Central American and Antillean, reaching
far North and South. ;
AXenosauride.
Helodermatide.
Scincide :
1. Northern America and plateau of Mexico, non-Antillean.
2, Central American into Mexico and Antilles.
Aantustide :
1. Sonoran, non-Antillean,
2. Central American and Antillean.
Amphisbenide.—Mexico, Central America, and Antilles;
formerly much farther north in the United States ; extending
far into South America,
} Mexican, non-Antillean.
These statements are intended, in their reduced form, to
indicate the probable centres of dispersal of the various families.
It is important that of these 10 families no less than 7 have
representatives in the Greater Antilles, and that these Insular
members belong, in not a few cases, to Insular, peculiar genera,
e.g. Cyclura and Metopoceros of the Iguanide, Celestus of the
Anguide, Cricosauras, Cricolepis of the Xantusiide ; and it is also
worth noting that Amphisbena itself occurs in Puerto Rico, on
the Virginia Islands, and South and Central America, but not in
Mexico, Xenosawrus and Heloderma, each the sole member of a
family, are restricted to Mexico in a slightly wider sense. Most
of the Anguide and Iguanide, and all the Xantusiide, are centred
in tropical and semitropical America. We may fairly conclude
that at least the Amphisbeenide, Anguide, Iguanide, Xantusiidee,
are very old inhabitants of the ancient Sonoran-Central American,
and Antillean mass of land, Of these families the Amphisbenide
may well be autochthonous. The Tejide alone are unmistakable
Southern immigrants from an original centre, probably Brazilian,
not N.W. South America; otherwise it would not be obvious wh
only so few Tejide have extended beyond the present South-
American continent. They (Anolis and Ameiva) were the latest
immigrants into the Central Land Complex just before the
Antillean separation, after which these genera and Cnemidophorus
could continue their continental progress northwards.
It is suggestive that so many of these families fall into a north-
western, typically Sonoran and Pacific, xerophile, and a southern,
more Atlantic group with predominant hygrophile characters ;
the Antillean forms naturally siding with the latter. The
Mexican plateau, instead of connecting, rather severs these two,
mainly ecological groups, the connection passing round to the south
of the plateau. It must remain a moot question which of the
222 DR. H. GADOW ON MEXICAN [June 6,
two groups is the older. Not unlikely both are, in America, the
divergent result of more generalised features; the one with the
desert, the other with the typical forest as the leading motive, or
rather the ultimate theme or goal for adaptation. We do not
know the physical features of ancient Sonoraland. There need
have been no deserts or semiarid tracts and rather barren plateaus.
The ‘petrified forest” of Arizona; the fact that many of the
present desert-like stretches from Northern Mexico, through New
Mexico to Utah and beyond, are the basins of former lakes (many
of them still rapidly receding); nay, even the prehistoric towns
in the now inhospitable parts of Arizona and New Mexico—all
these circumstances indicate that much of Old Sonoraland 1s still
further tending towards the formation of deserts, just as clearly
as enormous parts of Central Asia.
Sonoraland had originally a much wider extent. It is obvious
that the Tres Marias Islands were part of Tepic; there is also
little doubt that the peninsula of Lower California was continued
to the Revilla Gigedo Islands. That was at an epoch when the
Gulf of California did not yet exist, the peninsula as such dating
from the end of the Miocene.
OPHIDIA.
TyPHLopip£.—Only two species are known from Mexico.
Typhlops tenwis from the State of Vera Cruz, ranging south to
Guatemala; and Anomalepis mexicana from Nuevo Leon. The
present centre of this family is South and Central America,
whence they have extended into the Antilles (Puerto Rico).
GLAUCcoNIID#.—Glauconia, the main genus, ranges from New
Mexico, Texas, and Florida, far into South America, whence only
the Lesser Antilles have been entered. Mexican localities are
still very scattered. The northern species, e. g. G. humilis, ranges
over the plateau and the Pacific slope; G. dulcis from New
Mexico to Chilpancingo; while G. albifrons is a Central American,
entering the Eastern and Western States of Mexico but avoiding
the plateau.
Borp#.—In Mexico only the Pythonine Loxocemus bicolor,
recorded from Colima, Tehuantepec, and Guatemala; and the Boa
imperator (incl. mexicana), ‘ Masacoatl,” which ranges from
Eeuador through Central America into the Mexican Pacific and
Atlantic Tierra Caliente, keeping strictly to the forest and bush
lands. The Boine continue northwards as the arenicolous
Lichanura of Lower California and of similar hot desert-like
districts of Arizona; and the likewise arenicolous Charina, which
extends from California to Washington. Another set of Boas,
typical dwellers of luxurious tropical countries, occurs in the
Antilles; all these, Hpicrates, Corallus, and Ungalia, have allied
species in Central and South America.
Consequently this archaic family is clearly divided into a
1905. | AMPHIBIANS AND REPTILES. 223
Pacific, terrestrial xerophile, and a more Atlantic and southern
rather hygrophile stock. The former is almost typically Sonoran,
except that it does not enter the plateau. Since Charina shows
that it can endure a cold climate, the absence of similar forms on
‘the Mexican plateau may possibly date back to the barrier of
volcanic terrain.
CotuBRrip#®.—Of the bewildering number of these snakes in
Mexico only those have been selected for discussion which seem
to yield some tangible results, while such as are too widely
scattered or rather imperfectly known in their distribution have
been mostly left out.
C. AcLyPHm.—Tropidonotus, decidedly a Nearctic genus, ex-
tending through the whole of Mexico, with greatly diminishing
numbers of species into Central, but not into South America or
into the Antilles. 7. ordinatus (incl. varieties) is the commonest
species in the whole of Mexico. 7. validus is a western form,
from Utah to Colima. 7. sipedon s. fasciatus is eastern, from
east of the Rocky Mountains to Costa Rica. Others are confined
to the southern half of Mexico.
Ischnognathus is Nearctic, extending over the plateau, re-
occurring in Guatemala.
Contia, clearly Nearctic, through Mexico, with preference for
the plateau and its western slope, into South America.
Ficimia is Sonoran, scattered through Mexico.
Zamenis.—Sonoran. Of the 9 American species, 8 occur in
Mexico, 3 of which are confined to the southern half or extend
into Central America, but not into the Antilles. 7. constrictor,
widely spread_over the States, enters North Mexico. Z. ornatus,
semilineatus, and teniatus are typical of New Mexico, Arizona to
Sinaloa, continuing as Z. mentovarius as a western form from
Sinaloa, Colima, 8. Oaxaca to Guatemala. 7%. grahami is a
central and eastern form from the Southern States right over the
plateau and the Hast to Tehuantepec. Z. pulcherrimus is southern,
from Salina Cruz to West Nicaragua; lastly, 7. mexicanus has
been recorded from Colima, Central and South Guerrero, Guana-
juato, and from Cape Corrientes in Jalisco *.
Coluber with Spilotes and Pityophis are clearly Nearctic, with
some species in almost every State of Mexico; none is Antillean,
although some extend far into South America. (©. corais, the most
powerful Colubrine Snake of Mexico, inhabits the warm and hot
countries, with the wide range from the South-eastern States of
North America to Brazil. j
Coronella.—Nearctic. C. regalis from Kansas, over the plateau
to Mexico City; C. levis in Nuevo Leon; C. annulata =
micropholis from Texas to Para, in Mexico certainly all over the
* Bocourt (Mission Scient. Mex.) states emphatically “au cap Corrientes sur le
Pacifique”’; it is therefore rather perplexing that Gtinther (Biol. Centrali-Americ.)
adds “ Cuba, Mus. Paris,” as a locality of this species. There happens to be a Cape
Corrientes at the western end of Cuba.
224 DR. H, GADOW ON MEXICAN [June 6,
southern half; coloured and behaving exactly like Hlaps, it is
often mistaken for a true “ Coralillo,”
Urotheca, Dromicus, Drymobius, and Leptophis are mainly
Central and South American with species in the Antilles, extend-
ing northwards into the Atlantic and Pacific Tierra Caliente, on
the east side even into Texas. Drymobius margaritiferus is the
commonest tree-snake. D, boddaerti ranges from South America,
Trinidad and 8. Vincent, and on the Pacific side it has been
brought from Tres Marias Islands.
Rhadinea is South and Central American, going into Mexico
east and west and onto the slopes of the Southern plateau.
Urotheca likewise Central and South American and Cuban ;
U. elapoides from Costa Rica along the Atlantic side to Orizaba,
Streptophorus typically Central American, extending into the
Atlantic Tierra Caliente. S. diadematus from Tabasco through
Oaxaca to Jalapa and Orizaba. SS. atratus from Ecuador and
Venezuela to Jalapa, None is Antillean.
Hypsiglena torquata from Venezuela to California, in Mexico on
the plateau and the Pacific side.
Atractes, Tropidodipsas, Dirosema, and Geophis are Southern
genera, extending into the Atlantic and Pacific Tierra Caliente,
the last genus with more western range. GG. (Geagras) ridimita
I have found in the sand-dunes of the lagoons near Tehuantepec.
OpistHogLyPHA.—7rimorphodon, a Mexican genus with western
preference. 7’. wpsilon extending northwards into Arizona, south-
wards to Panama; 7’. biscutatus distinctly Pacific from Mazatlan
to Panama; 7’. aw on the Isthmus of Tehuantepec,
Himantodes, a typical Neotropical forest genus, of which H.
cenchoa has spread into the Atlantic, H. gemmistrata and
H. tenuissima into the Pacific Tierra Caliente. Cope’s statement
that H. gemmistrata has been found at Toluca seems to be
erroneous.
These 'Tree-snakes are called “‘Stchil” in Oaxaca and on the
Isthmus, are feared as poisonous, and are said to attain a very
ereat length. Every snake, when in motion, appears to be much
longer than it is, and these active creatures gliding rapidly through
the dense canopy of a tropical forest seem indeed to give one the
impression of prodigious length. Another name for Tree-snakes
is ‘¢ Bejuquillo,” in allusion to lianas, which are called bejuco.
Leptodira, Neotropical, into the eastern and western Tierra
Caliente, remaining outside the plateau, although ZL. albofusca,
which extends to Para and Ecuador, ascends outlying mountains,
like the Nevado de Colima, up to 7000 feet. Z. septentrionalis, as
the most northern offshoot, occurs in Texas and New Mexico.
Oxyrhopus, essentially South and Central American; 0. cloelia
and O. plumbeus stop at the Isthmus of Tehuantepec ; O. petiolarius
goes into Guerrero. This genus is of special interest since it
contains the only Opisthoglyph which has reached the Antilles,
but only the Lesser.
1905. ] AMPHIBIANS AND REPTILES. 225
Erythrolamprus and Oxybelis are likewise South and Central
American genera, entering the Tierra Caliente; e. g. O. acwminatus
from South America to Motzorongo in Vera Cruz, and through
Guerrero to Mazatlan; it is also on the Tres Marias Islands.
E. fissidens extends from Costa Rica along the Atlantic side of
Mexico to Tamaulipas and thence into Texas.
Conophis, South and Central American, with C. vittatus on the
Isthmus and in Guerrero.
Scolecophis.—The few species live in rather high altitudes.
S. emule im the mountains of Chihuahua; S. michoacensis ;
S. atrocinctus at Toluca (fide Cope) and in Guatemala.
Homatocranium, with two dozen species, mostly in South and
Central America, whence 8 Mexicans, chiefly on either side of the
plateau, and north-eastwards, through Nuevo Leon into Texas.
These last two genera are not arboreal.
Stenorhina degenhardti from Kcuador into the Atlantic hot
country.
Manolepis puinani, hitherto known only from Jalisco, e. g.
Cumbre de los Arrastrados, 8000 feet; I have found it on the
Cumbre de los Cajones, south of Chilpancingo, in pine and oak
forest, altitude 3000 feet.
Petalognathus nebulatus. Of this South and Central American
species I found one specimen in the forest of La Raya, south of
Cordoba.
AMBLYCEPHALID®.— With a few forms in South-eastern Asia,
but many in South and Central America. Of the 20 species of
Leptognathus, only L. elegans reaches the Isthmus of Tehuan-
tepec. :
Hiariy®.—Of the many species of the Neotropical genus Hlaps
only 2 or 3 oceur in Mexico. ‘The commonest, #. fulvius, ranges
from South Brazil far into the Eastern United States. In Mexico
it seems to live in the whole southern half, including the plateau,
e. g. Mexico and Guanajuato; it is curious that it has not yet
been recorded from anywhere north of a line drawn from Mazatlan
to Guanajuato and Tuxpan, but Cope mentions 2. ewrywanthus of
Arizona from “ Chihuahua” and “Sonora.” #. elegans seems to
range from Guatemala into the Atlantic Tierra Caliente near
Jalapa. No Hlapine snakes occur in the Antilles. These
“ Coralillos,” although well-known to be poisonous, are not feared
because they do not bite unless handled clumsily ; when they bite
they do not strike, but chew deliberately like our European
Coronella. Although occasionally found basking, they lead a very
retired life, preferring vegetation, hiding under rotten stumps,
with a predilection for ants’ nests. They are practically nocturnal
like nearly all the non-poisonous snakes which possess the same
beautiful coloration; the combination of black and red rings has
a most effacing effect in the dusk.
Proc. Zoou. Soc.—1905, Vou, Il. No. XV. 15
226 DR. H. GADOW ON MEXICAN [June 6,
VIPERIDZ.—CROTALIN®, taken together, occur all over Mexico,as
is to be expected of a group which ranges from Massachusetts and
British Columbia to Argentina, but they fall into two lots :—
I. Northerners, with their archaic centre in Sonoraland.
Ancistrodon is chiefly Nearctic; but of the terrestrial forms
A, bilineatus extends along the Pacific side of Mexico, including
Tres Marias Islands, to Yucatan and Guatemala. Of Sistrwrus, east
of the Rocky Mountains, S. ravus has been deseribed by Cope
from Vera Cruz. Crotalus, the main genus, radiates out from the
tablelands of Arizona; C. terrificus (horridus of some authors) is
the only species which extends right through Mexico to the
Isthmus, and thence right into Argentina, avoiding, however, the
moist and wooded Tierra Caliente. It is the only Rattlesnake in
South America. C. iriseriatus is confined to Mexico’s mountains,
ranging from the Nevado de Colima right across to Citlaltepetl,
where I have found it at an altitude of 12,500 feet.
Il. Southerners.—Lachesis, an essentially Neotropical genus,
a few species of which extend into the Eastern and Western
States below the plateau. JZ. lansbergi has the widest distribution,
and it is the only Pit-viper which has entered the Lesser Antilles,
the larger and older islands being free from poisonous snakes.
The Rattlers, or ‘‘ Viboras de cascabél,” are not much feared,
being ‘‘manzitos” (rather tame), meaning sluggish and not
inclined to strike unless provoked; moreover, they always try to
give fair warning with the rattle, which they sound only when
coiled up and prepared to strike, but not when crawling away as
they generally attempt doing. The Lachesis lanceolatus, the “ Fer
de lance ” of Martinique, &e., ‘‘ Rabo de hueso” or Bone-tail of the
Mexicans, on account of the curiously coloured and spike-like tip
of the tail, behaves quite differently. It is very quick, highly
irascible, and even known to make for its pursuer, therefore much
dreaded. In fact the few cases of snake-bite which I could
ascertain, mostly fatal, were due to this species.
Résumé of the Distribution of Ophidia.
Typhlopide.—Central and South American, Atlantic Mexican
and Antillean *,
Glauconiidee.— Remnants of Sonoran to Neotropical distribution;
they may reasonably be expected to be found in the Antilles.
Boide.
1. Xerophile Sonoran, not Antillean.
2. Hygrophile Central South American, Mexican Tierra
Caliente, and Antillean.
_ * For the present purpose only those Snakes are considered Antillean which occur
in the Greater Antilles. The Lesser Antilles, entirely volcanic and of much younger
date, have received the Lachesis, Oxyrhopus, and Glauconia directly from the opposite
part of Venezuela.
1905. ] AMPHIBIANS AND REPTILES. 227
Aglyphous Colubrine.—Obviously with an archaic Nearctic
centre. There is a gradual change from North to South.
1. Northerners which send a few species only into Central
and still fewer into South America *, while none reaches
the Antilles: Tropidonotus, Ischnognathus, Contia*,
Meimia, Coluber, Spilotes, Pituophis, Coronella*. Here
also Zamenis.
. Central Americans, from the Mexican Tierra Caliente into
South America and into the Antilles**: Urotheca**,
Dromicus **, Drymobius **, Leptophis**, Rhadinea,
Streptophorus.
. Kssentially Southerners with their present centre in South
America, extending northwards into Mexico, but not
into the Antilles: e. g. Afractes, Tropidodipsas, Dirosema,
Geophis, Xenodon.
bo
ise)
Opisthoglyphous Colubrine.—Kssentially South and Central
American, with many mostly arboreal forms in the hot countries
of Mexico, whilst a few terrestrials extend also over the plateau
and into the neighbouring United States. None Antillean.
Hlapince.—Neotropical, non-Antillean; but a few species of
Hlaps range through Mexico, and one far into the United
States.
Crotaline.
1. Nearctic, especially Sonoran, xerophile, non-Antillean.
Only one of them extending far into South America.
2. Neotropical, northwards into the Mexican Tierra Caliente,
and into the Lesser Antilles.
All this means that the Greater Antilles possess only the ancient
Typhlopide and perhaps Glawconiide and have received those
Boas and Aglyphous Colubrines which have near relations in
Central and North-western South America, whilst Crotaline,
Hlapine, and Opisthoglyphe ave excluded. Further, this indicates
that all these latter groups are post-Antillean, that they have
extended southwards after the Antillean separation, have developed
into the present tropical genera and species in Central and South
America, and have then, eventually, most recently extended north-
wards into or even beyond Mexico, just as some obviously
Nearctic species are still extending southwards.
DISTRIBUTION OF MEXICAN SPECIES ACCORDING TO ALTITUDE.
Our knowledge of the fauna of North-western, Northern, and
North-eastern Mexico is too imperfect. The calculations are
therefore restricted to those parts of Mexico which lie within the
following lines: Mazatlan—Guanajuato— Mizantla, north of
Jalapa in the State of Vera Cruz; and Coatzacoalcos, across the
15*
228 DR. H. GADOW ON MEXICAN [June 6,
Isthmus to San Mateo del Mar near Tehuantepec. These lines
enclose all the most varied and characteristic physical features:
the highest mountains, part of the Central high plateau with
gradual slopes into the lowlands, abrupt boundaries, the hot low-
lands, the principal rivers, lakes, swamps, forests, and savannahs ;
Central or inland, Atlantic and Pacific climate.
All the species, with available records, were sorted into six
groups :—Those which occur only in the cold and cool regions ;
those which are found in these and in the temperate zones ; in the
cool, temperate, and hot zones; temperate zone only; temperate and
hot; and, lastly, hot or tropical only.
Of course the lines of demarcation are quite arbitrary, but the
132 species collected by myself, represented by about 1000
specimens, with my knowledge of the country, gave me a lead.
Hot-lands extend from the sea-level to about 3000 feet, the
temperate zone to 5000 or 6000 according to the district. Hvery-
thing beyond 7000 feet can safely be considered within the cool
zone, and all stations above 9000 feet are decidedly cold. Lastly,
there is some safety in numbers.
I. My own Collections : 131 species employed.
No. of
Climate. species. Per cent
1. Cold or cool only...... 22 i)
2. Cold and temperate... 6 5 within cool zone 38 sp.= 30 per cent.
3. Cold to hot ............ 13 10
4, Temperate only ...... 12 9 pub temperate zone 42 = 32 per cent.
5. Temperate and hot... 11 Sh ie) pe hot zone 91 = 70 per cent.
G EGE Olly sorarosseonaane OW 51 (groups 6+5+3).
131 101°
II. My own and previous Collections and records : 247 species,
then rounded up to 250.
No. of
Climate. species. Per cent.
1. Cold or cool oniy...... 42 iy
2. Cold and temperate... 20 8 within cool zone 86 sp.= 84 per cent.
3. Cold to hot ........... 24 96 J
4. Temperate only ...... 15 6 within temperate zone 99 = 40 per cent.
5. Temperate and hot... 40 16 J 2 within hot zone 173 = 69 per cent.
GL TSUGE Orally 44. <2s prance soo! 43°6 5 (groups 6+5+3).
250 100°2
These two calculations agree remarkably well: species restricted
to cool regions 17 per cent. in both cases; species occurring
within the cool regions 30 or 34 per cent. respectively ; and species
1905. | AMPHIBIANS AND REPTILES. 229
recorded from the hot-lands 70 or 69 per cent.! TI have left the
two lists as they are, for fear that a revision would not be free
from bias and might thus prove too much *.
Fairly established is the fact that the Tierra Fria is inhabited
by about 34 per cent., one third of the total number of species, of
which one half, i.e. 17 per cent., are restricted to the cool and
cold zone.
Equally safe is the conclusion that in the Tierra Caliente occur
69 or 70 per cent., about 50 of which (51 or 43) are restricted to it.
This shows the richness of tropical life, especially if we consider
the small extent of the hot-lands in Mexico in comparison with
the rest of the country.
Text-fig. 30.
IAOOOEEE aaa teen, PNR) | TATE OA CE LIS VT LLY 2 eee
([Xofote): TSS AS ae Se re Sere tg SSS So sas coos
NOLO) RCs es tc a aot ee ty een ee el US ESE oY I asinine 2,
TIERRA FRIA.
BODO en nie aaa ee ee eS A ee
TIERRA TEMPLADA.
3000 ., — WWW co 2 REESE D a
TIERRA CALIENTE.
SEA LEVEL, Bitiw in Sti SEAS ZZ SSS SSS
Diagram of the distribution of 250 Mexican species according to Altitude.
~ Per cent.
( Restricted to the Tierra Caliente ............ 44
Southern or
hot-country 1H) Ascending into temperate zone ................ 16
species. |
{ Wa Ascending into cool zone ............0...000. 5
Species restricted to the temperate zone ... 6
Restricted to cool and cold zone............... 17
Northern or |
cool-country ¢ Ht Descending into temperate zone............... 8
species. |
Descending into hot zone ............0000.. 4
\
100
Further, the whole fauna is practically composed of these two
groups, whilst the species restricted to the temperate zone form a
very small minority, 6 per cent., at the utmost 10 per cent. if we
allow for the difficulty of classifying.
This shows that the original stocks were either cool or tropical,
* Probably all the numbers of species, as put down for the six groups, have been
understated, but this would not much alter the proportions. or instance, on p. 228,
the species given as occurring in cool to hot zones amount to about 24, but even
half a dozen more might be added according to the interpretation of such
records as “Amula” and ‘‘Omilteme,’” which may mean anything from 5000 to
8000 feet.
230 DR. H. GADOW ON MEXICAN [June 6,
in other words either Northerners, as natives of Old Sonovaland,
dwellers of mountains and high plateaus, or Southerners, which
were and are mostly tropical species. The temperate zone is in
the present case rather no-man’s-land than the happy medium
favourable to the majority.
The configuration of the whole country lends every support to
this result; broadly speaking, a high, mountainous plateau,
abruptly falling off into tropical lowlands.
The species which have such a considerable range of altitude
that they occur in the cool, temperate and hot zones, are of further
interest. The same kind which is bound to hibernate on the high
mountains is active throughout the year in the moist and hot
lands, and possibly there are some which also exstivate during
prolonged drought. The species can be grouped as follows :—
T. Undoubted Northerners, or originally at home in a cool
climate, as indicated by their main distribution, or by that of allied
species of the same genus. These have descended into the hot
lands.
Scaphiopus dugest. Tropidonotus melanogaster.
Rana halecina. % ordinatus.
> montezume. ss validus .
Sceloporus scalaris. Coluber triaspis.
5 microlepidotus. Crotalus horridus.
Uia bicarinata.
Gerrhonotus ceruleus.
Cinosternum pennsylvamcum.
IL. Essentially hot-country species which have ascended; and
it is remarkable that most of these are not found on the plateau
proper, although they ascend the surrounding mountains, up to an
altitude equal to or surpassing that of the plateau. This fact
seems to indicate that the respective species are still continuing
their upward spreading, or that they have conquered these
mountains comparatively recently. This fits well with the
suggestion expressed on p. 244 that the Southern or tropical
fauna of Mexico represents for the greater part the most recent
immigrants. The Sierra Madre del Sur affords a good illustration.
It is separated from the plateau by the depression of the basin of
the Rio Balsas. Tropical species coming from the south can surge
up to the Sierra, and they have ascended its higher mountains
(e. g. those of Omilteme, Amula, Cerro de S. Felipe near Oaxaca),
and the backbone itself is of no mean height; but then comes the
descent into the hot basin, then again the ascent of the plateau.
A tropical species, which has succeeded in acclimatising itself to
life on the Sierra, will have to “undo” this hardening, become
tropical again, and lastly once more ascend and accommodate itself
to a cool climate. Of course all this can be done, but it takes
time. The same applies to the fauna of the rather isolated Volcan
and Nevado de Colima. The ranges of mountains which border
1905. } AMPHIBIANS AND REPTILES. 231
the great plateau are rather abrupt and in many parts are even
higher than the plateau itself, so that to gain the latter would
imply a descent. There are, as mentioned elsewhere, p. 240,
regions which offer a gradual, easy entry, and they have facilitated
the exchange of many species, but not of all, and of course not in
other districts.
Species found in the hot country and on high mountains ; those
excluded from the plateau are marked * :—
* Hylodes rhodopis. * Leptodira albofusca.
* Anolis nebulosus. _* Xenodon rhabdocephalus (2).
* Zamenis mentovarius. | Geophis chalybea.
* Rhadinea vittata. | Trimorphodon upsiton.
* Leptophis mexicana. | Llaps fulvius.
* % diplotropis. |
III. Lastly there are some species which are difficult to group,
whether they have descended or ascended. For instance, most
kinds of Hylodes live rather high up; they want permanent
moisture, and this 1. rhodopis gets on the high mountains and
in the hot forests of the Atlantic side; only a very few returns
have been made from the truly temperate zone, and it isnot known
from the plateau.
Hyla eximia. | * Sceloporus formosus.
* Bufo intermedius. | s acanthinus.
* Hylodes palmatus. | ss spinosus (°@).
Sceloporus variabilis. | Coronella niicropholis.
The list (infra, pp. 232-233) contains 70 species, of which 8
(Diploglossus, Xenosaurus, 1 Zamenis, 3 Leptophis, 1 Drymobius,
and 1 Sceloporus) may be deducted as probably not ascending
beyond 6000 feet. The remaining 62 species, out of a probable
total of 250 for Mexico from between the Isthmus of Tehuantepec
and the line Mizantla to Mazatlan, represent about 25 per cent.
Of these, again, 30-32 (13 per cent.) seem to be restricted to levels
above 7000 feet. These have been marked with an asterisk (*).
If we add to them the following 10 species, which seem to be
restricted to the high plateau, 6000-8000 feet :—
Spelerpes morio (also from | Tropidonotus variabilis,
_ “ Jalapa”), : scaliger,
Scaphiopus multiplicatus, Homalocranium bocourti,
Bufo compactus, | Crotalus miliarius,
- Lyla miotympanum (2), | 5 | salvar,
Phrynosoma orbieulare, |
we get a total of about 42 species, equalling 17 per cent., as
restricted to the cold and cool zones (cf. p. 228).
[June 6,
DR. H. GADOW ON MEXICAN
232
* OOS8
* 0OS8
* 0008
3008
“OOILXO Tl
Ivou ‘oosnly
ap BILAIG
| *
00¢8
O0¢8-O08FE
008-0007
| 0008 ‘UR,
-yekep op BAILEIG
| 0088-0064
| 00g8
*soperyselcy
SOT ap arquing
a
|
goes
ee iia
%000°TT-0064 * 0008
ee ae
wee
*
*
Beear OOlL
0828-0469 OOTL
x
0068-0099 {| —
oot,
Gor
era Pe
x*
‘osuroued[iyg
: FO ISOM
BEAD) ‘QIPeT BITOIG
OSEAN ‘auled UC,
‘osulued iy
pus vovxtg
Teamgjeq “Ing
Top e«pey
BLIALG “BTU
0008
“BOBXVO)
qeau ‘adrpay
*g ap O10)
000‘F1-000‘0T
00¢°E1T-0088
000‘0T-0006
008°6T-0008
009°6T-0008
0006
"yodezeTI1)
ee we ee = Si afius
2 s2qugur.tna
$2.UD1D9S
SAUD
Pee sadajouagoy
: _snqopydajowoyut
* snsowm.of”
wadsp
smuayqupaD
wnoLwoh
Hercueeesescsssssis? qupaang
Tega sngpnb.woy sn.odojaag
T= DUDUAAIUULO
LL
ee DUVIOI DY DUDT
puna Diy
oad bod pnO 90D Daynuy snjphjappowoy,
2 SNUDIVLAUL $AZ0I0L0G.L0G
pond Ads TITEL sndoysihig
SSgreH Camcntien ‘ snqpujod
nuedde COGbb0 000 sedopoyt sapojvhyy
snus
smipauLsazur ofing
TE UMM IID.»
20 oan soc unuribry puUojshi quip
poe voc snqunuogyD sdasoyonuyng
eds . "79q
~ snwagdowya
snso.day
poo oop sisuaqnzis10 sadwajady
SINgDUUAd SNLLOY F
[-popnput gou st ‘seooqvorz pue e[qeng ‘oorxeyy jo AoqeA *4 -a “neozeyq ous, |
‘QU0Z 100) ay) mYynM sIUMUNndT UNnwarT moLf pap.Loo—. soLoady fo ISU]
AMPHIBIANS AND REPTILES. 233
1905.]
“eon J,
“COnOT,
*
0098 “Bonyoy,
0088
008
00g8
K
000-0099
0002
0004-0089
OOOTT
0009 ¢
0009 ¢
0008
0084-0009
0006-0088
00S8
SnyDNpUN srsayooT
aottand oon cananoda6 OG snoryittag
SNYDUASULY SNIDZONY
UNPIUDIOLID UWILUDLI0) NWO FL
= DIDIPUL DOULP DY
pomacran wojisdan Uuopoydsoweny,
ae pasnfog py vAvpopdaryT
snuafiquipbhinu snigowhiq
PET AEG nts eRe puporeau
snynaurrg
sunjsoid
povare ee sidouzojdip svydojdaTy
pecpcoees ~ vadoa snyqnubouyosT
mee yunugnd sidajoun ft
ae DULOSO.LOLYD Laqnjon
cress pagy vo
ga sss pasa svydoay
SnywawiIDM) SnovUmOLg
Heiress emanaen) DON)OT,
snspu 021910;
“sip pydasopqny. wopouay
Se aa ee SNwpaojzUaUL
pap ongpRo ees wUnynIh suaung
Bee as aupupob
Hotere granulo
messes ppasphounjaut
ge snjpoydososhya
SLLopwas snyouoprdo.wy,
= sup snr.psoua
“ 1uauyovpurags snssoj bo) dug
Heeiercssststemgomgau
os aoppb syour
Hieeeeeesssss st 99.49 80.U10049
ee ee ee eee eee eee aowhy sana
ee eee eee eee eee nee snpoyde00u
DOO Song OMICS cngaeicnn snamartquir
wee ee tee eee tee ee snauvwnsb ——
sive she viele nse velo elses velsjue saddap
sabnnyun snzouoy.t4a)
SRMND, DUWOSOUN LY T
234 DR. H. GADOW ON MEXICAN [June 6,
GENERAL CONCLUSIONS.
1. Hvolution of Middle America.
We have seen in the review of the Aimphibian and Reptilian
fauna of Mexico that it is composed of Northern and Southern
immigrants; that a considerable number of the northern group
can claim to be old, autochthonous Nearctics ; that some families,
genera, or species have also representatives in the Antilles, and
that most of these forms point unmistakably to Central America,
or even further south, as their original home; lastly, that but few
Antilleans belong to a northern stock.
The explanation lies in the geological history of this part of the
world. J restrict myself on purpose to this part, lest such an
inquiry should lead to a discussion of the whole globe since the
first dawn of Amphibian life in some Paleozoic country.
Our present task limits itself to the Tertiary period. It is
doubtful whether any of the genera in question are older than the
Eocene, but not a few can be proved to have existed in our region
in the mid-Miocene epoch; and it is surprising that they should
date so far back. Lastly, there was no Central America in the
Cretaceous period.
The building up of Mexico and neighbouring countries seems
to have taken place as follows, so far as I can gather from the
writings of A. Agassiz, Suess, Lapparent, R. T. Hill, J. W.
Spencer, J. W. Gregory, C. Sapper, and José G. Aguilera *.
The accompanying consecutive series of maps illustrate my
abstract conclusions, and only in this abstracted sense can claim
originality.
Mexico came into existence during the Lower Cretaceous epoch.
To a nucleus of land, Sierra Nevada and California, were added
the Rocky Mountains and the bulk of the Mexican Plateau.
This large complex I call the Old Sonoraland, It is important to
remember that it was separated, during the Upper Cretaceous
epoch, by a broad belt of sea from the eastern and northern parts
of North America. A third mass of land existed as Brazilialand.
In the meantime appeared Antillean lands, and, possibly in
sympathy with the east to west trending mountains of Honduras
* SuEss.—Das Antlitz der Erde. Dr LapparEent.—Traité de Géologie.
R. T. Hint.—*‘ The Geology and Physical Geography of Jamaica: Study of atype
of Antillean development.” Bull. Mus. Comp. Zool. Harvard, xxiv. (1899) pp. 1-226.
See also other papers in same Bulletin, xvi. (1895), and in Amer. Journ. Sci.
vol. xlviii. (1894).
J. W. Spencer.— Reconstruction of the Antillean Continent.” Bull. Geol. Soc.
America, vol. vi. 1895 ; and Geolog. Mag. 1894, pp. 448-451.
A. Agassiz.—Reports of the Results of Dredging ...... by the‘ Blake. Mem.
Mus. Comp. Zool. x. (1883) no. 1, p. 79.
J. W. Grecory.— Contributions to the Paleontology and Physical Geography
of the West Indies.” Quart. Journ. Geol. Soc. vol. li. (1895) pp. 255-312.
J. G. AGUILERA.—* Bosquejo Geolégico de Mexico.” Instituto Geolés. de Mexico,
pt. 4 (1895) pp. 1-270, with maps.
C. SAPPER.—“ Sobre la Geografia fisica y la geologia de la peninsulade Yucatan.”
Inst. Geol. Mexico, pt. 3 (1896).
1905. | AMPHIBIANS AND REPTILES. 235
and Guatemala, also the Mexican Sierra Madre del Sur. These
parts were in time annexed by Sonoraland.
By the late Hocene, conditions were so far consolidated that
there existed the present North American Continent, eastern and
LAND DURING
EAREY CRETACEOUS EPOCH.
It
Diagrams to illustrate the contours of Mexico at different geological ages.
western halves joined, and the latter extending southwards as the
present Mexico and part of Central America. Brazilia had grown
into South America, but the two continents were still separated,
the Atlantic and Pacific communicating across the present
Isthmus of Panama and probably further north.
236 DR. H. GADOW ON MEXICAN [June 6,
Late Eocene, or early Oligocene, times mark a period of
considerable local subsidence which drowned the Antillean land,
or islands, except their summits. Late Oligocene, or early Miocene,
mark a period of considerable elevation with most important
Text-fig. 32.
DURING MIOCENE
Diagrams to illustrate the contours of Mexico at different geological ages.
results :—Establishment of the continuity of North and Central
with South America, and a continuous mass of land from Central
America, north and eastwards, comprising the Greater Antilles
and the southern end of Florida. For this Central Land (Antilles
+ Central America proper, and adjoining parts of South
1905. | AMPHIBIANS AND REPTILES, 237
America, viz. Colombia and Venezuela) I use the name of Great
Antillia, the term Antillia having already been used by others.
The present Gulf of Mexico remained below the sea, and was
larger than it is now, covering the Atlantic Tierra Caliente of
Mexico, Yucatan, and, according to Hill, the main part of Florida.
If correct, the latter point is important.
It seems also probable that the Mexican-Central American land,
during the Miocene epoch, extended considerably further west-
wards than the present Pacific coast, taking in with almost
certainty the Revilla Gigedo Islands.
Late Miocene, or early Pliocene, comprise a time of subsidence,
resulting in the present features. Severance of the Antilles into
the present islands, which since have undergone comparatively
unimportant changes of shape and extent; separation of Florida.
Lower California became a peninsula, owing to the formation
of the Gulf of California. The Revilla Gigedo Islands, still later
the Tres Marias, are remnants of the subsiding land. Yucatan
appears at the beginning of the Pliocene epoch*. The Isthmus
of Panama is limited to its present narrow dimensions.
A few words remain to be said about the volcanic activity and
other changes affecting the configuration of the Mexican Plateau.
A tremendous dislocation, at the latest in Kocene times, produced
the Eastern Sierra Madre, composed entirely of Cretaceous lime-
stones, raised up high, forming the elevated eastern rim of the
plateau, and falling off abruptly towards the Atlantic lowlands.
In the Eocene epoch began also the enormous outburst of
volcanism, raising the Western Sierra Madre, piling up gigantic
masses of igneous rocks, mostly andesite, and lavas, which con-
tinued to spread over a vast part of the country during most of
the Miocene epoch, and, more locally, even in historic times.
Most of the plateau is now covered with the Quaternary debris,
sand, d&e., which overlie the eruptive masses and the older
calcareous or limestone formations. These accumulations of more
or less sandy soil form plains, mostly treeless. They are of great
extent, in the northern half, from Texas to Zacatecas. In the
middle, say from Guadalajara to Puebla, exist a great number
of smaller plains or “valles,” that is to say fertile plains,
interrupted or partly surrounded by the outcropping hills of
voleanic formation, and they contain a fair number of lakes. In
the south of Mexico, in the States of Oaxaca and Guerrero,
such plains are rare or absent. Trees are scarce or absent on the
plateau ; it isan idle fable that it was well-wooded in historic
times. The bordering high Sierras and their slopes are well-
wooded, densest on the moist, Atlantic side. ‘The eastern,
southern, and western Tierra Caliente is covered with luxurious
growth, either forming continuous forests or showing the features
of savannahs.
The plateau is dry, verging towards prolonged droughts,
interrupted by few, occasionally torrential, rains. The Atlantic
* See footnote to p. 242,
238 DR, H. GADOW ON MEXICAN [June 6,
hot-lands and the eastern slopes of the States of Vera Cruz and
Chiapas are very wet, with a very long and abundant rainy season,
interrupted by ashort dry time inthe winter. The Pacific side is
much drier; the actual amount of annual rainfall is considerably
less and the dry winter period is much longer.
The plateau rises from less than 1000 feet near Laredo, and
3800 at El Paso, gradually to about 6000 at Aguas Calientes and
Querétaro, and above 7000 at Mexico City and Puebla. The
highest masses of mountains, bordering the plateau, lie in the
south-east, south and west, culminating in the snow-capped peaks
of Citlaltepetl or Volean de Orizaba, Popocatepetl, Nevado de
Toluca, and Nevado de Colima,
2. Immigration and Spreading.
Obviously these physical conditions influence the fauna now ;
what they were like in bygone ages we can only surmise. Ranges
of mountains are by no means alway s barriers ; on the contrar
they help the dispersal along the lines of their long AXES. Regions
covered by the sea are of course not available. The same applies
to districts which are subject to voleanic eruptions. This is very
important for Mexico. Not only the Western Sierra Madre with
its continuations to Colima and thence towards Puebla, but also
almost the whole of the plateau became covered with eruptive
masses, and, considering the immense extent of this terrain, a long
time must have elapsed before it became available for plants and
animals. We may well ask, what remained of the country as suit-
able for life. Of course, probably, there were archaic tracts
standing out, not affected by these revolutions, but these gneisses,
schists, and granites form scattered enclaves. I think it was the
Pacifie strip—Sonora, Sinaloa, Tepic, and part of Jaliseo—which
was not affected ; m fact, the Pacific slopes, together with the land
which has since sunk below the Gulf of California. On the eastern
side, part of the plateau did not suffer from eruptions, but the
land was still narrowed; there was no Atlantic lowland, this
being during the whole Miocene epoch, and even later, still below
the sea. Consequently we have as available land the western strip
as the least altered remnant of Old Sonoraland, and the present
eastern limestone belt, beginning with a broad basis in Texas, and
extending through Coahuila and Nuevo Leon southwards, narrow-
ing down towards Oaxaca. These were the two belts of land
available for spreading southwards. Obviously the Pacific belt is
the older of the two, the north-east of Mexico, with Texas, being
late Cretaceous terrain. Once arrived in the south of the plateau,
there was the essentially granitic, gneissic, and older Cretaceous
terrain of Guerrero and Oaxaca, not so much overlaid by volcanic
masses. Thence the Great Antillia afforded easy access into the
present Antilles. But it was a long way round from the North.
The spreading from South America into this same Antillia was
easier in this respect.
Later immigrants from the North into Mexico are those of the
1905. ] AMPHIBIANS AND REPTILES, 239
plateau, which by climate and every other physical feature is a
direct continuation of the more northern countries. Hence the
imperceptible change from Arizona, New Mexico, and Texas
southwards. The political frontier between Mexico and the
United States is no boundary whatever for our purposes.
For northern animals and plants the drier climate, not so much
the annual mean temperature, of the plateau suggests this as a
natural limit, but not a few northern forms, even the same species,
have adapted themselves to life in the hot lowlands and have
extended their range far south, even into South America. With
the original natives of the latter continent, conditions are different.
They could spread easily through Central America, but arrived in
South Mexico the wedge of the plateau divides them into an
Atlantic and a Pacific mass. They can go a long way north, and
are still in Tierra Caliente, like the countries whence they came.
But a sifting takes place. The Atlantic lowlands are hot and
moist, whilst the Pacific slopes and much narrower lowlands are
hot and rather dry, the dryness increasing rapidly towards the
north. To people such divergent countries implies a severe sifting
of the immigrants, or the necessity of changing, by adaptation to,
or by, the new surroundings.
This is well illustrated by the gradual change, from species to
species, of essentially northern into slightly less northern, into
almost tropical forms of the same genus; or, since a genus is
most cases an imaginary abstract, of the same group of closely
allied creatures. Still further south that particular genus comes
in most cases to an end, ‘There may be a species or two which
form outposts, straggling on, perhaps in actual process of successful
adaptation ; however, after all the genus has found its mit. But
it is there not met by the outposts of the southerners; they in
their turn stand much further north. If it were otherwise, there
would be a real boundary line, with a kind of neutral zone between
North and South, and this neutral zone should contain compara-
tively few species and genera. Emphatically this is not the case.
Thé two faunas overlap broadly ; they commingle, except on the
plateau, which seems to be a much more effective barrier to the
southerners than is the descent from the plateau into the hot
lowlands to the northern creatures. It seems to be easier for
xerophile northern genera, and even species, to go south and to
adapt themselves to life in a more equably hot and decidedly
moister country with luxurious vegetation, than for hygrophile
southerners to do the reverse.
Be it noted, however, that this applies only to those terrestrial
northerners which can adapt themselves to arboreal life; rattle-
snakes cannot doit. Speaking broadly, xerophiles are essentially
humivagous; hygrophiles either live on the ground which is
rich in humus, grass, or herbaceous tangle and underwood, or
they are arboreal.
A favourite way of adaptation is arboreal life, whereby the
xerophiles escape inundations, accumulation of humus, debris,
240 DR. H. GADOW ON MEXICAN [June 6,
and the gloom of the underwood. In a desert or semidesert
the amount and character of the scarce and precarious vegetation
remain practically stabile; not so in the Pacificlowlands. During
the rainy season grows up a dense mass of herbaceous plants
covering the ground with a tangle of weeds, tall Salvias and
Composites, stinging herbs and spiny creepers ; all this disappears,
is burnt up, scattered during the dry season, and for months the
ground may be bare, whilst many of the trees are leafless. In
this Pacific type of Tierra Caliente we have periodical extremes,
Difterent again is the moist Atlantic Tierra Caliente, and also
the ranges of mountain forests of the Southern and South-eastern
Tierra Templada. There are no extremes; the very opposite to
arid tracts ; there is plenty of high and low vegetation all the year
round.
The important factor is not the temperature, nor the altitude
as such, but the amount, or rather the distribution, of annual
moisture. ‘Temperature: more than the northern half of the
Mexican plateau belongs to one of the hottest regions of the world,
the centre of heat being the State of Sonora. From May to July
the mean temperature for Sonora is 36° C.=96°8° F.; for the
rest of the northern plateau 30° C.=86° F., which is more than the
summer average of South Mexico and Central America. But in
the winter the North averages 16° C.=60°8° F., while the Tierra
Caliente enjoys 25° C. In short, the Hot-land temperature
averages from 25° to 28° C.=75° to 82° H.; the Northern plateau
from 60° to 96° F., with additional extremes from frost and snow
to unbearable broiling heat and drought.
The overlapping, mentioned above, is much more generic than
specific. There are, indeed, very few species which, although having
a wide geographical range, are well established in stations of de-
cidedly very different physical aspect. For instance, species on the
higher mountains, or plateaux, and also in the Tierra Caliente : see
p. 231. But of all these only very few, e.g. Hylodes rhodopis,
Sceloporus scalaris, a Rattlesnake, and Tropidonotus ordinatus,
can, in their indifference to physical conditions, be compared with
the Puma, the Armadillo, Opossum, the Raven, and Turkey-
Buzzard.
Some species, natives of the plateau, descend from it down
to the neighbouring coast (Bufo simus, Hypsiglena torquata,
Zamenis grahami); others ascend from the hot countries on
to the plateau, especially from the west by way of Guadalajara,
and thence to Guanajuato and further east, the means being the
alluvial plains spoken of before; or the ascent can be traced
through the Balsas depression towards Iguala and Cuernavaca ;
another opportunity seems to lead from the east side to Zacual-
tipan in the State of Hidalgo. Such ascending species are Bufo
marinus, B. valliceps, Hyla miotympanum, Engystoma wstwm,
Phyllodactylus tuberculosus, Uta bicarinata, Zamenis mexicana.
To another category belong those species which have a wide,
but very scattered, discontinuous distribution, especially those
1905.} AMPHIBIANS AND REPTILES. 241
which, like most Gerrhonotus, ave now restricted to the higher
mountains.
Lastly, a considerable number of Southern species ascend from
the hot lowlands high up onto mountains which rise isolated, or
which fringe the plateau.
Of course it is difficult, perhaps premature, to generalise in this
respect, and sharp lines cannot be drawn between these categories.
Not the least cause is the vagueness or doubtful nature of many
of the reported localities. For instance, Cope had various corre-
spondents in Mexico, and some of the alleged localities are quite
impossible. Peters had a good correspondent resident in Puebla
City, but the specimens which now figure as ‘“‘ Puebla” came
from anywhere in that State, which has the most perplexing,
intricate boundaries, and contains altitudes from 3500 to less
than 100 metres! “ Vera Cruz” is another snare to the unwary.
Others have bought specimens, even collections, in Mexico City.
I myself found in a shop at Orizaba several large glass vessels full
of well-preserved snakes for sale, but I left them alone since
nobody knew where they came from. Sumichrast lived for many
years in Tehuantepec and he travelled widely, all over the
Isthmus and beyond. The town is situated on a plain, about
100 feet above the not distant sea; within a few hours’ ride are
mountains, covered with pines, well above the Tierra Caliente, as
typical of which every specimen labelled “Tehuantepec” is put
down.
I shall not, at least in this paper, go into the detail of the
generic overlapping, a very important question. Suflice it to say,
that Im many cases the species of a genus are so distributed that
some are decidedly northern, living on the plateau, typical
inhabitants of the Tierra Fria; another species lives in the ad-
joining Tierra Templada, more often on the western than on the
eastern slopes and descending more or less far into the lowlands ;
while a third kind is confined to the typical tropical Tierra Caliente.
Such cases are clearly illustrative of the evolution of species due
to the prevailing physical conditions, especially when none of
these species has a wide geographical range.
Are we justified in calling a certain species ancient because it
has a wide continuous range? For instance, Zropidonotus ordi-
natus, Crotalus terrificus. It is rather doubtful, because these
creatures are so indifferent to climatic conditions. With more
right we consider those as ancient which have to be very par-
ticular about their terrain, and which are now scattered, without
the least chance of communication—as, for instance, Thorius,
Chirotes, Heloderma, and other slow, or digging, creatures.
3. Northern and Southern Immigration.
In the following table the Mexican Amphibia and Reptiles are
divided into a Northern or Nearctic and a Southern or Neotropical
mass, according to their presumable ancestral home or cerrttre of
Proc. Zoot. Soc.—1905, Vor. Il. No. XVI. 16
242 DR. H. GADOW ON MEXICAN [June 6,
Nearctic, extending into: NEOTROPICAL.
Not beyond Mexico. Central America. Antilles.
Pelobatidze
Desmognathinee
Amblystomatine
Plethodontinze % ee
Heloderma__ _
Xenosaurus__ _
Xantusiide : a. Sonoran
6. Southern 56
Anguidee
x >
Amphisbheenidee 8 fe
Tguanidee: a. Xerophile
b. Hygrophile
Glauconiidee
Boidee
Crotalinee
Colubrine Aglypha
_ | Colubrinee
| Opisthoglypha.
__Hlapine.
———_——— SS SS es ee
es HY
ee Tejidee.
=
ow“
es | ee ee ae ene Ov suicomating ces
¥ Hylide.
x“ Bufonide.
Chelonia: Testudinidee BAG YB.
Cinosternidee a mi ae
Dermatemydidee__ fn ta0d
Typhlopidee.
a Geckonide.
pees AOL Sea Beno ystomentce:
dispersal so far as America is concerned. Those which have sent
forms into the Greater Antilles are also indicated.
The Greater Antilles have received their fauna* from Nearctic
%* Gregory thinks it is “almost certain” that Yucatan was connected with Cuba.
Other zoogeographers have likewise assumed this connection, and it looks very
plausible on the map. If it ever existed, it must have been very transitory. Amphibia
1905. | AMPHIBIANS AND REPTILES. 243
and from Neotropical groups, of both Amphibia and Reptilia, but
no northern group has contributed, unless it had spread well into
Central or even into South America (witness the Plethodonta,
Anguide, Amphisbenide, Scincide, Xantusiide, Aglyphous
Colubri ine, Iguanidee).
All these Nearctic, or Old-Sonoran, groups must have been there
in Miocene times. The same age must be assigned to the
outhern immigrants—the Cystignathide, Hylide, Bufonide,
Tejidee, Typhlopide.
On the other hand, the following must be considered as
decidedly post-Miocene so far as their existence in the present
Central America is concerned: from the North the Pelobatide,
Desmognathinee, and Amblystomatins, none of which extend,
southwards, beyond Mexico proper; from the South the Engy-
stomatinee, Opisthoglypha, KElapinee, none or few of which go
beyond Mexico into the United States. Lastly, the latest arriv: als
in South America are the Crotalins, of which only Lachesis
lanceolatus has entered the Lesser Antilles.
Ancient Sonorans are //eloderma and Chirotes.
The Testudinidee are also Old Sonorans. Still with fair
numbers in Mexico, but ever decreasing southwards through
Central into South America, Testudo has arrived in Central and
South America too late for the Antilles, but in time for the
Galapagos. This indicates that the Caribbean Sea and Gulf of
Mexico connection was established before the disappearance of
the western extent of Central American land. It is another hint
that the Isthmus of Panama is but the last vestige of a former
much broader land-connection between the two Continents.
Concerning the Colubrine Snakes, they remind us in their
dispersal southwards of the Iguanide, Anguide, and Boide.
They have gone in detachments. The earliest migrants, when
arrived in South America, have developed there, and since, into
Opisthoglypha and the Aglypha part 3; and these are now
surging back, northwards, post-Antillean. A second lot are the
Aglypha part 2, many of which have entered the Antilles.
Lastly, the last detachment of northerners passing through
Mexico and Central America, too late for the Antilles, but
still continuing their southward migration.
If I am right in the conclusion that American Colubrinze
gave vise to Opisthoglypha in South America, it follows that
Opisthoglypha are not a natural group, those of the Old World,
chiefly paleotropical, being an instance of collateral development,
convergent, spreads, or whatever term Aer be ean. ‘ed.
and mace do not support it; on the Pecan their present distribution is
opposed to it.
About 70 species are known from Yucatan. Its fauna is essentially that of the
Atlantic Tierra Caliente; it differs from that of the Antilles apparently by the
-absence of Xantusiide, Glauconiide, and Anguide. On the other hand, it is incon-
ceivable why Tortoises, Pit-vipers, Opisthoglypha, and Cnemidophorus, all of which
are plentiful in Yucatan, should not have crossed over into Cuba if a direct land-
bridge had been ay ailable.
16*
244 ON MEXICAN AMPHIBIANS AND REPTILES. [June 6,
Unless this conclusion be accepted, we have to resort to violent
interpretations. Hither complete extinction all over North
America, a measure which receives no support from actual
distribution; or we must be prepared to assign to the
Opisthoglypha a Cretaceous age, as a family not descended from
North-American Colubrine ; or, lastly, if we should insist upon
the Opisthoglypha as a natural group, the only explanation
would be a land-connection across the Equatorial Atlantic, which
with shifting modifications is supposed to have existed from
Lower or Mid-Cretaceous into at least the Oligocene epoch.
This bridging of the Atlantic is somewhat problematic. For
our purposes we can discard the Cretaceous Brazil—Africa con-
nection. Of more concern to periaretic distribution is the Europe—
Greenland—North America continuity, which is supposed to have
persisted well into the Tertiary period. But there was a third, more
direct. bridge, although one of a curious and mysterious structure,
which by its several advocates is dimly described as composed of
a shallow sea interspersed with many islands; or as a solid land-
belt; or, lastly, as a long archipelago with a continuous coast.
This mysterious structure is supposed to account for the
unmistakable similarity between the now extinct Antillean and
Mediterranean coral-fauna, Old- World and Antillean land-mollusea,
de. Obviously the corals require sea, the mollusca land. The
apparent contradiction may be solved by the suggestion that
there existed between Central America and the Mediterranean
a sea (part of the Tethys of Suess and Ortmann, later their “ Great
Mediterranean”), shallow during the Oligocene epoch, studded
with islands, bordered by continuous land in the South (Brazilia
to West Africa, or later between N. South America and West
Africa, part of the Mesozonia of Ortmann) and in the North
(Western Europe to Appalachia). Subsequently the Tethys
increased to a big “bay” in Mid-Atlantic, this bay extending,
spreading south and north, drowning first the southern land-belt,
driving the northern land farther and farther north, with the
ultimate result of a junction of the South with the North
Atlantic; in other words, establishment of the whole Atlantic,
Now these land-bridges, provided they existed long enough and
at the right time and place, the Southern until at least the
beginning of the Eocene, the Northern at least through the Oligocene
epoch, would explain many a puzzle in geographical distribution ;
for instance, that of the Aglossa, Boas, Podoenemis, Amphis-
benide, Solenodon. The Northern bridge would throw light
upon the Anguide and upon Spelerpes, a large American genus
with a solitary species in Sardinia and Italy.
But this is at present a land of dreams. With more claim to
reality, we can conclude that Central America, although genetically
part of the North-American continent, has received vis dominant, most
characteristic fauna from South America, and this southern fauna
has surged northwards chiefly to the east and west of the
Mexican plateau.
(HELLS WOOT SIPEOIND se IIUNOKGIAS) TSIENGUND YZ TL
eo T rats) EMME TE AG SUASL WITT 39 ep Weezy f
ra
Meee eoers wa
Bale & Danielsson ‘4 tmp
lL SCE LOLORUS GADOVMIAD 2) LEP RODIRA ec Ullah
J.Green delet hith.
1905. | ON NEW MEXICAN REPTILES. 245
3. Descriptions of new Reptiles discovered in Mexico by
Dr. H. Gadow, F.R.S. By G. A. Boutencer, F.R.S.,
WaleeVaerse
| Received May 17, 1908. |
(Plates VI. & VII.*)
ANOLIS GADOvII. (Plate VI. fig. 1.)
Head once and two-thirds as long as broad, slightly longer than
the tibia; forehead concave; frontal ridges distinct, divergent;
upper head-scales rugose, not keeled ; scales on frontal ridges and
supraorbital semicircles large, the latter in contact on the inter-
orbital region; three large supracculars, forming together a disk
separated from the supraorbital semicircle by two series of small
scales; occipital large, a little larger than the ear-opening,
separated from the supraorbital semicircles by two series of small
scales; canthal scales four, loreal rows six; six or seven upper
labials to below centre of eye; ear-opening large, vertically oval.
Gular appendage very large, extending far back on the breast ;
gular scales smooth. Body compressed; no dorso-nuchal fold.
Dorsal scales small, smooth or faintly keeled, irregular, juxtaposed ;
lateral scales minute, granular; ventral scales larger than dorsals,
smooth, juxtaposed. The adpressed hind limb reaches the eye;
tibia as long as the distance between the end of the snout and
the ear; digits moderately dilated; 20 lamelle under phalanges
TI and III of the fourth toe. Tail feebly compressed, not crested,
once and three-fourths length of head and body. No enlarged
postanal scales. Greyish above, with black wavy and vermicular
lines; two parallel black lines on each side from shoulder to hip ;
belly white; gular appendage bright red.
Total length ...... 225 millim. Fore limb...... 37 millim.
IEICE %GL Weare ee ZO ie% 5 ind linmiby ea) 63 iar,
Whidthcot head). p512.' ., Dans, cos eseets 145_,,
ISOON ee nde nea nee eee GO.
This very distinct and handsomely marked Anolis is represented
by a single male specimen, from Tierra Colorada, South Guerrero,
ANOLIS LIOGASTER. (Plate VI. fig. 2.)
Head once and a half as long as broad, longer than the tibia ;
forehead deeply concave ; frontal ridges strong, short, divergent ,
upper head-scales smooth or feebly keeled; scales of the frontal
ridges and supraorbital semicircles large, the latter in contact on the
interorbital region or separated by one series of small scales ; three
large, smooth or faintly keeled, transverse supraocular scales
forming a single longitudinal series, in contact with the supraorbitals
ov separated from them by one series of small scales; occipital
larger than the ear-opening, separated from the supraorbitals by
one or two series of scales; canthus rostralis sharp; canthal scales
* For explanation of the Plates, see p 247.
246 MR. G. A. BOULENGER ON [June 6,
three; loreal rows five; six upper labials te below the centre of
the eye; ear-opening rather small, vertically oval. Gular appendage
very large, extending far back on the breast, in the male, absent
inthefemale; gular scales feebly keeled. Body feebly compressed ;
no dorso-nuchal fold. Dorsal scales subrhomboidal, subimbricate,
strongly keeled, passing gradually into the minute, granular
scales of the sides; ventrals much larger than dorsals, rounded,
imbricate, smooth. The adpressed hind limb reaches the eye
or a litte beyond; digits moderately dilated; 16 lamelle under
phalanges IJ and ITI of the fourth toe. Tail scarcely compressed,
twice as long as head and body. Male with enlarged postanal
scales. Reddish brown above, with a paler broad vertebral
stripe, widening on the nape; this stripe edged with dark brown
in the female; lower parts golden, the gular appendage bright red.
e
Total length ...... 150 millim. Fore limb....:. 23 millim.
IE IGANG Raltan sar eaadieae TOMAS Jalgael ITM) gg By se
Width of head... 10 ,, Hain Resse errs TOOT
BOC N bosondeoaponn POETS
Two specimens, male and female, from Omilteme, Guerrero,
7600 ft.
The male is remarkable in the absence of the inner digit on the
four limbs.
Allied to A. nebulosus Wiegm. Distinguished principally by
the smooth ventral scales.
SCELOPORUS GADovI#. (Plate VII. fig. 1.)
Head-shields smooth; frontal transversely divided, separated
from the interparietal by a pair of frontoparietals; interparietal
as long as broad ; parietals small, one pair on each side ; two canthal
scales; five or six large transverse supraoculars, bordered inwards
by one series of scales, outwards by one or two; five long pointed
scales form a strong denticulation in front of the ear. Dorsal
scales larger than ventrais, strongly keeled, pointed or shortly
mucronate, forming oblique series converging towards the median
line, passing gradually into the smaller scales of the sides; 73 to
77 scales between the interparietal shield and the base of the tail ;
19 or 20 scales, taken in the middle of the back, correspond to the
length of the shielded part of the head. Ventral scales small,
smooth, bicuspid. 75 to 80 scales round the middle of the body.
The adpressed hind limb reaches the ear; tibia as long as the
distance between the end of the snout and the ear; the distance
between the base of the fifth toe and the extremity of the fourth
exceeds the distance between the end of the snout and the posterior
border of the ear. 28 to 33 femoral pores on each side, the two
series narrowly separated on the preanalregion. Tail compressed;
caudal scales a little larger than dorsals, strongly keeled, the two
median upper series more strongly mucronate and forming a pair
of serrated ridges. Male with slightly enlarged postanal scales.
Greyish olive above, reddish on the sides, dotted with bluish
1905. | NEW MEXICAN REPTILES. 247
green ; limbs with rather indistinct dark bars; throat and belly
dark blue; a narrow whitish median ventral streak.
Total length ...... 147 millim. Fore limb...... 32 millim.
iFleade hs. Sass DS” Bs Hindlimb ... 45 ,,
Wadthvotheadit. sills ATMs cee see cect ae SO.
BO. saris Snetsiteieee Deis
Two male specimens from a ravine near Mesquititlan, north of
Chilpancingo, Guerrero.
This very remarkable species, which I take the liberty of naming
after Mrs. Gadow, agrees with S. pyrrhocephalus Cope, in its
distinctly compressed tail, but differs from it in having much
smaller scales and more numerous femoral pores. No species of
Sceloporus was hitherto known to have more than 25 femoral pores
on each side.
LEPTODIRA GUILLENI. (Plate VII. fig. 2.)
Rostral twice and a half as broad as deep, scarcely visible from
above; internasals a little longer than broad, little shorter than
the preefrontals; frontal once and two-thirds as long as broad, a
little longer than its distance from the end of the snout, a little
shorter than the parietals; loreal as long as deep; one preocular,
well separated from the frontal; two postoculars; a subocular
below the preocular and another below the postoculars ; temporals
142; eight upper labials, fourth and fifth entering the eye; five
lower labials in contact with the anterior chin-shields, which are
much shorter than the posterior. Scales in 23 rows. Ventrals
189; anal divided; subcaudals 71. Above with eleven dark
brown areas separated by narrow greyish-white bands; snout,
interocular region, and temples brown, back of head and nape
bright red with a dark brown median line; a light, dark-edged
streak along the upper lip; lower parts white, the ventrals with
a brown spot on each side; subeaudals brown, edged with whitish.
Total length 530 millim.; tail 110.
A single female specimen from the Rio Balsas, Guerrero.
This species which, on the whole, is intermediate between
L. nigrofasciata Gthr. and L. personata Cope, is named after
Senor Don Manuel Guillen, Governer of the State of Guerrero, in
recognition of valuable assistance rendered to Dr. Gadow.
EXPLANATION OF THE PLATES.
Prats VI.
Fig. 1. Anolis gadovii, sp. n., p. 245.
Vides, As ‘5 Upper view of head, x2.
2. » liogaster, sp. n., p. 245.
Gs op 55 Upper view of head, x25.
Puate VII.
Fig.1. Scecloporus gadovie, sp. n., p. 246. Upper and lower views.
la. 5 5s Upper view of head, x 25.
16. 5 a Side view of head, x 23.
2. Leptodira guilleni, sp. n., p. 247. Upper and side views of head and
anterior part of body.
248 MR. G. A. BOULENGER ON SOUTH-AFRICAN [June 6,
4, On a Collection of Batrachians and Reptiles made in
South Africa by Mr. C. H. B. Grant, and presented to
the British Museum by Mr. C. D. Rudd. By G. A.
BounEnGceER, F.R.S., V.P.Z.S.
[Received May 29, 1905. ]
The collections made within the last two years in South Africa
by Mr. C. H. B. Grant and presented to the British Museum by
Mr. C. D. Rudd, the Mammals of which have already afforded
matter for two papers by Messrs. O. Thomas and H. Schwann,
published in these ‘ Proceedings,’ included a good series of
Batrachians and Reptiles, a list of which is here given. No new
species were discovered, but the series is interesting for the sake
of the localities, our knowledge of the exact distribution of these
animals in South Africa being still very imperfect.
A list of the localities is here given :—
I, Cape.
Durban Road, near Cape Town. This ‘‘ Durban” is a town
about 15 miles N.E. of Cape Town.
It. British Namaqualand.
Port Nolloth, at mouth of Orange River.
Klipfontein, a station on the railway between Port Nolloth
and O’okiep, 54 miles from Port Nolloth. Altitude
3104 ft.
Til. Zululand.
Hluhluwe Stream, flows west into False Bay. or
Umfolosi Station, on the railway, about 5 miles north of
Umfolosi River.
Eshowe, about 30 miles inland from Coast and Umbhalazi
River. Altitude 1800 ft.
Ngoye Hills, 15 miles E. of Eshowe, and 8 miles inland from
Coast. Altitude 600-1000 ft.
Sibudeni, about 60 miles inland from coast, at source of
Umblatuzi River. Altitude 3500-5500 ft.
Jususie River, close to Sibudeni.
IV. Transvaal.
Wakkerstroom, on the Natal border and at southern end of
Drakenberg Range.
Zuurbron, 20 miles East of Wakkerstroom.
BATRACHIA.
AGLOSSA.
1. Xenopus L&vis Daud.
Durban Road, Umfolosi Station, Wakkerstroom,
The largest specimen (2) measures 100 millim. from snout to
vent.
1905. ] BATRACHIANS AND REPTILES. 249
In the present uncertainty as to the distinction of species in
this genus, the distribution of _Y. levis is difficult to trace. This
species appears to be found all over South Africa where there is
water, and it extends as far north as Angola to the West and
Abyssinia to the East, the British Museum possessing specimens,
which I cannot separate from the typical form, from Lake Mweru,
Uganda, and Senafe.
Angola specimens (XY. petersii Bocage), which have been referred
either to Y. levis or to Y. muelleri by Giinther, by Peters, and
by myself, cannot be separated, by any character that I can
detect, from XY. levis. I have examined eight specimens, one
from Benguella, received from Prof. Barboza du Bocage himself,
five from Pongo Andongo, obtained by Dr. Ansorge, and two from
Dr. Welwitsch’s Angola collection. Bocage gives the length of
the Angola specimens as not exceeding 65 millim. from snout to
vent, but one of Welwitsch’s specimens measures 80.
In the typical Y. levis from South Africa the subocular
tentacle measures less than one-third the diameter of the eye, and
is sometimes reduced to a mere tubercle, the inner metatarsal
tubercle is very blunt and feebly prominent, never conical, and
vomerine teeth are constantly absent.
The true X. muelleri, as described and figured by Peters in his
‘ Reise nach Mossambique,’ vol. i11. (1882), has the tentacle more
than half as long as the eye, the metatarsal tubercle more
prominent, more conical than in YX. /e@vis, and vomerine teeth,
first noticed by Tornier, are often present. In addition to
Mozambique, whence it was first described, this species is found
in Nyasaland and on Zanzibar and the opposite coast.
To distinguish between Y. muellert and XY. levis is, however,
not so easy as one might at first think, for the British Museum
has received from Mr. C. 8. Betton three specimens from hot
springs near Lake Nakuro, British East Africa, which agree with
the former in the prominent, conical metatarsal tubercle, and
with the latter in the short tentacle and the absence of vomerine
teeth.
AX. elivit described from Erythreea by Peracca, and obtained in
numerous examples at Addis Ababa and Ashoofi, Abyssinia,
by Mr. E. Degen, agrees with -Y. levis in the proportions, in the
short tentacle, and in the absence of vomerine teeth, but is easily
distinguished by the inner metatarsal tubercle being armed with
a black claw, as in YX. calearatus, which inhabits Liberia, Lagos,
Nigeria, Cameroon, the Gaboon, and the Congo. In the males of
X. clivii the brown nuptial asperities, instead of being restricted
to the inner side of the fore limbs, as in _Y. levis, extend as
a large patch on each side of the breast.
Two specimens from ‘“‘ West Africa,” collected by Mr. Fraser,
therefore probably from Nigeria or Fernando Po, which have been
referred by Dr. Giinther and by myself to Y. mwelleri in the
British Museum Catalogue, agree with that species in the size of
the eye, the length of the tentacle, and the presence of vomerine
250 MR. G. A. BOULENGER ON SOUTH-AFRICAN [ June 6,
teeth (five in number)*, with X. eliwi and X. calearatus in the
presence of a metatarsal “claw.” These specimens, the larger of
which measures only 39 millim., no doubt indicate a distinct
species, for which I propose the name XY. fraserv.
PHANEROGLOSSA.
2. BuroO REGULARIS Reuss.
Umfolosi Station, Hluhluwe Stream, Ngoye Hills, Wakker-
stroom. :
3. Buro Granti Bler.
Durban Road, Klipfontein.
Since this species was described, in 1903, from numerous
specimens obtained by Mr. Grant at Deelfontein, it has been
rediscovered at Matjesfontein by Dr. W. F. Purcell, of the South
African Museum. The male specimen which the British Museum
has received from that institution measures 60 millim. from snout
to vent and strikingly resembles a Bufo viridis. The interorbital
space is as broad as the upper eyelid, the tympanum measures
three-fifths the diameter of the eye, the first finger extends a little
beyond the second, the tibio-tarsal articulation reaches the
tympanum, and the subarticular tubercles under the toes are all
single. The single male specimen found by Mr. Grant in a
garden on Durban Road, near Cape Town, agrees very closely with
the Matjesfontein Toad, but some of the subarticular tubercles
under the toes are double. Another male, from Klipfontein, also
has double subarticular tubercles.
4, Buro anausticers A. Smith.
Durban Road.
Several specimens, the largest measuring 46 millim. from snout
to vent. The first finger never extends beyond the second, the
fold along the inner side of the tarsus is more or less distinct, and
the subarticular tubercles of the toes are usually single, although
there are occasionally two between the last phalanges of the
fourth toe.
Bufo dombensis, from Dombe, Benguella, described by Barboza
du Bocage in 1895 as a close ally of B. angusticeps, is more nearly
related to Smith’s Bufo vertebralis, which, following Gunther, I
have erroneously regarded as the young of B. carens. The
examination of a small Toad found at Vredefort Road, Orange
River Colony, by Major Barrett-Hamilton, and of which four
specimens have been presented by him to the British Museum,
has convinced me of my error. The breeding male, with large
gular vocal sac, measures only 27 millim. from snout to vent, the
female 35. In these specimens, the tympanum is close to the eye,
* The vomer is single in X. levis, muelleri, and clivii, absent m X. calearatus,
Hymenochirus, and Pipa.
1905. ] BATRACHIANS AND REPTILES. 251
and may measure three-fourths its diameter; the parotoids are
flat and very indistinct, broken up into several glands; the
subarticular tubercles are double, and there is no trace of a tarsal
fold. The limbs are shorter than in B. carens and the white
rhomboidal spot on the vertebral line, which does not exist in
B. carens, appears to be constant; black spots are always present
on the belly.
5. Rana DELALANDIT D. & B.
Durban Road.
6. Rana Fuscicuuta D. & B.
Klipfontein.
7. RANA ANGOLENSIS Bocage.
Eshowe, Sibudeni, Wakkerstroom.
The vocal sacs of the males form longitudinal folds on the sides
of the throat.
8. RANA MASCARENIENSIS D, & B.
Sibudeni.
This species had not previously been recorded from South Africa.
In the five specimens from Sibudeni the tibio-tarsal articulation
reaches beyond the tip of the snout; a light vertebral stripe and
a light line along the tibia are present.
9. Rana Grayi A. Smith.
Durban Road, Klipfontein, Sibudeni, Ngoye Hills.
10. Rana rascrava Tsch.
Sibudeni.
The longitudinal folds and the dark stripes on the back are
absent in the single specimen.
11. PHRYNOBATRACHUS NATALENSIS A. Smith.
Sibudent.
12. ARTHROLEPTIS WAHLBERGII A. Smith.
Sibudeni and Hluhluwe Stream. ‘The British Museum has
also received a specimen from Pietermaritzburg, through Mr.
Quekett.
REPTILIA.
CHELONIA.,
1. STERNOTHARUS sInUATUS A. Smith.
Umfulosi Station.
A single half-grown specimen, the shell measuring 110 millim.
As pointed out by me in 1896 *, this species is very variable and
* Aun, Mus. Genova, (2) xvii. p. 15.
252 MR. G. A. BOULENGER ON SOUTH-AFRICAN [June 6,
to distinguish it from S. nigricans is not without difficulties. In
this specimen the cusps in the upper jaw are absent, the posterior
border of the carapace is very distinctly serrated, the intergular
shield is twice as long as broad, the length of the outer border of
the pectoral shield slightly exceeds that of the humeral, and the
suture between the abdominal shields is shorter than the front
lobe of the plastron. Head pale brown above, with black
vermiculations, white beneath, with blackish spots; plastron
yellowish brown, bordered with black.
2, CINIXYS BELLIANA Gray.
Umfolosi Station.
This species had not previously been recorded from South Africa.
In the specimens collected by Mr. Grant the shields of the
carapace are marked with black radiating streaks.
3. Homopus sianatus Walb.
Klipfontein.
LACERTILIA.
4. LYGODACTYLUS CAPENSIS A Smith.
Ngoye Hills.
5. PACHYDACTYLUS BIBRONIZ A. Smith.
Klipfontein.
6. PACHYDACTYLUS MARIQUENSIS A. Smith.
Klipfontein.
7, AGAMA BRACHYURA Bler.
Klipfontein and Port Nolloth.
This species was established on a single female specimen
labelled ‘‘Cape of Good Hope,” from Si A. Smith’s collection.
I have since examined four specimens collected at Deelfontein by
Mr. Seimund,and presented to the British Museum by Col. Sloggett,
and these, together with the six collected by Mr. Grant in British
Namaqualand, enable me to give a revised description of this
near ally of Agama hispida.
Head convex, subcordiform, as long as broad. Nostril not
tubular, lateral, pierced just below the canthus rostralis in a
convex nasal. Scales on anterior part of head smooth or rugose,
sometimes feebly keeled, often trihedral on middle of snout, on
nack of head more or less strongly keeled, some erect and spinose ;
occipital enlarged; head about the ears and neck with short
erect spines. Body strongly depressed, covered with irregular,
imbricate, strongly keeled scales intermixed with strongly
enlarged, trihedral, spinose ones; a small nuchal crest, sometimes
continued along the body ; ventral scales smooth or very feebly
1905. | BATRACHIANS AND REPTILES. 253
keeled. Limbs moderate, with scales very unequal in size; hind
limb reaching between the shoulder and the ear; tibia as
long as the skull to occiput; fingers short, third longest ;
third and fourth toes equal, or fourth very slightly the longer,
fifth not extending as far as first. Tail shorter or a little longer
than head and body, cylindrical or slightly compressed, covered
with strongly keeled scales. Male without gular pouch, with a
single row of anal pores. Olive-brown or reddish brown above,
with dark brown or blackish spots, the principal of which form a
double series along the back, each pair separated on the vertebral
line by a square or QC-shaped or f)}-shaped yellowish marking ;
lower parts whitish or greyish, with a wide-marked grey or
blackish network, which may disappear in adult males; the latter
always have a bluish throat.
sie millim,
Motalllenethie way ssteee eset vote 235 160
Tes [era le eee Oe hee iat tee ook Ce 29 22.
Wandin @it IN@ACl sccoccocecosanaoacccs 28 2)
BOO iy tivciccweccatepiont «Pr suepeatings 81 63
1 ove’syil biivall orate in Gaerne uaa aaa aaa aes 53 40
iEEeaval linonoy) Oe Wahessennbesaeeecsadoncs 02 54
1] De ii bs eat estar RS UN CL A See BO a 125 75
A. brachyura differs from A. hispida principally in the fourth
toe not being shorter than the third and in the absence of strong
keels on the ventral scales.
8. AGAMA ARMATA Peters.
Hluhluwe Stream.
9, AGAMA ATRA Daud.
Klipfontein.
Both A. micropholis Matschie (Zool. Jahrb., Syst. v. 1890,
p- 607), and A. microterolepis Blgr. (Ann, & Mag. N. H. [6] xvii.
1896, p. 22), from the Transvaal, must be added to the synonymy
of this species.
10. Zonurus potyzonus A. Smith.
Port Nolloth, Klipfontein.
11. PsEuUDOCORDYLUS MICROLEPIDOTUS Cuv.
Wakkerstroom.
12. CHAM@SAURA ANGUINA L.
Umfolosi Station.
13. VARANUS ALBIGULARIS Daud.
Umfolosi Station.
254 MR. @. A. BOULENGER ON SOUTH-AFRICAN [June 6,
14, Varanus nitoricus L.
Ngoye Hills, Sibudeni, Jususie Valley.
15. NucRAS TESSELLATA A. Smith.
Klipfontein.
16. Nucras DELALANDID M.-Edw.
Sibudent.
17. IcHNoTROPIS CAPENSIS A, Smith.
Umfolosi Station.
The parietal shields sometimes form a short suture separating
the interparietal from the occipital. The scales on the preanal
region are much smaller in females than in males.
18. Scaprira KNoxit M.-Edw.
Port Nolloth.
19. Scaprrra crenopactyLA A. Smith.
Port Nolloth.
‘The femoral pores may number as many as 36 on each side.
90. MABUIA TRIVITTATA Cuv.
Wakkerstroom.
21. Masur varia Peters.
Klipfontein, Umfolosi Station.
99. MABUIA STRIATA Peters.
Hluhluwe Stream, Umfolosi Station, Sibudeni, Ngoye Hills,
Zuurbron, Wakkerstroom.
23. MABUIA SULCATA Peters.
Klipfontein.
94, ScELoTES BEPES L.
Durban Road.
95, ACONTIAS LINEATUS Peters.
Port Nolloth, Klipfontein.
RHIPTOGLOSSA.
96, CHAMELEON QUILENSIS Bocage.
Jususie Valley.
27. CHAMALEON VENTRALIS Gray.
Port Nolloth.
1995. j BATRACHIANS AND REPTILES. 255
OPHIDIA.
28. PyrHon sEBz Gin.
Umfolosi Station.
29, ABLABOPHIS RUFULUS Licht.
Sibudeni.
30. PSEUDASPIS CANA L.
Wakkerstroom.
31, DASYPELTIS SCABRA L.
Negoye Hills.
Uniform brown (var. palmarum Leach). 23 scales across the
body, Ventrals 218; caudals 75.
32. AMPLORHINUS MULTIMACULATUS A, Smith.
Wakkerstioom.
Uniform green, without spots, as in the specimens presented
by Dr. Quain and mentioned in the British Museum Catalogue
(ii. p. 125). Ventrals 138; caudals 76.
33. 'TRIMERORHINUS RHOMBEATUS L.
Durban Road, Wakkerstroom, Klipfontein.
34. PSAMMOPHIS SIBILANS L.
Umfolosi Station.
The single specimen falls under Division F of the British
Museum Catalogue (ili. p. 163). Ventrals 165; caudals 97.
35. DIsPHOLIDUS TYPUS A. Smith.
Sibudeni.
Green, the scales edged with black (Division D of British
Museum Catalogue, 11. p. 189). Scales in 19 rows. Ventvrals
174; caudals 119,
36. ASPIDELAPS LUBRICUS Laur.
Klipfontein.
37. DENDRASPIS ANGUSrICcEPS A. Smith.
Negoye Hills.
38. Brivis ARIETANS Merr.
Umfolosi Station, Hluhluwe Stream.
39. Brtts cornnutTaA Daud.
Port Nolloth, Klipfontein.
40. Brris GAUDALIS A. Smith.
Port Nolloth,
256 MR. F. E. BEDDARD ON tHE ANATOMY [June 6,
5. Some Notes upon the Anatomy of the Yellow-throated
Lizard, Gerrhosaurus flavigularis. By F. EH. Bepparp,
F.R.S., Prosector to the Society.
[Received May 17, 1905.]
(Text-figures 33-38.)
Apart from osteology * and a few scattered notes, which will
be veferred to in the course of the present communication, there
does not appear to be a great deal known about the internal
structure of Gerrhosaurus. Inasmuch as this Lizard is regarded,
from the point of view of external characters and osteology, as
being exactly intermediate between the Lacertidz and Scincide ‘7,
it seemed to me interesting to attempt a criticism or confirmation
of this view, while recording any new facts which an investigation
of Gerrhosaurus flavigularis might bring to light.
Jugal Ligament.
Many, but not all, of the Lacertilia possess, as is well known,
a jugal ligament, which Huxley compared to the bony lower
temporal arcade of Hatteria. The exact relationships of this
ligament have not, I believe, been described in some of the
Lizards in which I shall now proceed to detail the arrangement.
Tt is possible to recognise several stages in the conditions of the
jugal ligament, which may represent evolutionary stages, though
it is, of course, not implied that the genera to be mentioned are
genetically connected in the order named.
In Jguana tuberculata the ligament as a distinct structure 1s
totally absent. On cutting through the skin covering the “ cheek,”
the muscles and bones of this region of the skull are at once
arrived at. It appeared to me, however, that the subcutaneous
connective tissue, which is dense and white in most parts of the
body, was rather denser and whiter in the region where the jugal
ligament would be were it present. It is possible, in fact, that in
this lizard an early stage is met with—that the ligament is not
yet differentiated from the general connective tissue of the skin.
On the other hand, it cannot be denied that the same fact may be
explained on the theory that the ligament has disappeared. In
any case, Gerrhosaurus offers an intermediate condition. In this
reptile the ligament in question is anchored firmly to the quadrate
behind, but in front it is not attached to the jugal bone but to
one of the bony scales which cover the face in this region. That
is to say, the ligament has not as yet completely detached itself
from the skin. So, at any rate, the facts seem to indicate. It is
important to notice in connection with the main object of the
present communication, viz., to attempt to fix the systematic
* Siebenrock, Ann. k. nat. Hofmus. Wien, vii. 1892.
+ Boulenger, Cat. of Lizards.
1905. ] OF THE YELLOW-THROATED LIZARD. 257
position of Gerrhosaurus, that this lizard agrees absolutely and in
every detail, so far as the jugal ligament is concerned, with the
skink Humeces.
The final stage in the arrangement of the jugal ligament is
shown in Physignathus. In this lizard the ligament is attached.
firmly to the bones at either extremity, and has entirely lost
its presumably original connection with the skin. Moreover, in
the last-named lizard, the ligament is divisible into two regions.
There is, first of all, a stronger narrow ligament which occupies
exactly the position of the bony quadrato-jugal bar in Hatteria,
and above this and in part overlapped by it is a thinner but still
stout sheet of ligament which entirely fills up the temporal vacuity.
This state of affairs does not exist at all in Gerrhosaurus and
Humeces. It is distinctly suggestive of the complete obliteration
of the lower temporal vacuity in certain Vertebrates.
In view of the fact that bones in some cases can be shown to
degenerate into ligaments, it is not certain that the stages sketched
out above may not be read in the inverse order. For example,
the lower part of the fibula is ligamentous in Birds; but it is not
to be assumed that here there is anything but a degeneration of
the bone into ligament. The facts which have been detailed above
coneerning certain Lizards do not, however, appear to me to point
to a reduction from a state of affairs such as is found in Hatteria.
If we were only acquainted with the condition observable in
Physignathus and Iguana, such a view might indeed be held.
The bone, it would be urged, has degenerated into ligament in the
one case, and has finally disappeared in the other. But the
conditions to be seen in Gerrhosaurus and in Hwmeces would seem
to negative such a supposition.
Peritoneal Folds and Celom.
Although the suspension of the alimentary tract and the other
viscera contained in the ccelom is broadly like that of many other
Lacertilia, there are some differences of detail which require
attention.
In the female example the line of attachment of the oviducal
membrane, which diverges laterally on each side, marks off
sharply the posterior pigmented area of the coelomic membrane
from the anterior non-pigmented or less pigmentedarea. This is
quite a common and well-known arrangement among the Lacertilia.
The reason why I bring the matter forward here, is that Gerrho-
saurus differs from Humeces, where there is no such differentiation
of pigmented and non-pigmented areas*, and because the pig-
* This is not, however, a distinctive mark of difference from the Scincide and of
likeness to Lacerta. Lacerta shows this sharp demarcation; but there are varying
degrees among the Scincide. In Hwmeces there is hardly any pigmentation ; in
Tiliqua scincoides there is a moderate amount, but evenly spread through the body-
cavity (in a male). In Macroscineus cocteaui (female), however, the oviducal
membrane marks off two areas; but the posterior area is not so deeply pigmented as
in Gerrhosaurus.
Proc. Zoou. Soc.—1905, Vou. II. No. XVII. 17
258 MR. F. E. BEDDARD ON THE ANATOMY [June 6,
mented area in the male Gerrhosaurus is distinctly greater than
in the female example of that lizard, and there is no conspicuous
fold of membrane continued forward from the gonad duct to serve
as a demarcation between the two areas in the latter.
The suspensory ligaments of the liver offer, as is well known,
characteristic differences of arrangement in various Lacertilia.
In both examples of Gerrhosawrus the falciform ligament of the
liver is double posteriorly for about the last } of the total length of
theliver. This double region of the umbilical or falciform ligament
is a tent-like structure; that is, the two separate membranes
converge ventrally to be inserted in common on to the ventral
median line of the parietes. A partial duplication of the
umbilical ligament of this kind is not uncommon in the Lacertilia.
It occurs, for example, in Lacerta ocellata. The double condition
of the umbilical ligament in the Scincide, originally discovered by
John Hunter* and subsequently more fully dealt with by myself 7
and Prof. Cope t, seems to be merely an exaggeration of this, the
union of the two, posteriorly separate, umbilical ligaments being
deferred until at or near the anterior extremity of the liver.
Furthermore, all of the members of the family Scincide are not
thus characterised ; for in Macroscinus cocteawi the arrangement
of the umbilical ligament is much like that of Gerrhosaurus. In
the question of affinity, therefore, the disposition of these mesen-
teries is not decisive. There are, however, one or two other points
to be noted, In the first place, in Humeces algeriensis both the
umbilical ligaments are thickly invaded by muscular tissue,
especially the left-hand ligament. This is also noticeable in
Macroscincus, though to a much less extent; and it will be
remembered that Macroscincus cocteawi is a much larger lizard
than is Humeces algeriensis, so that size in this case has nothing
to do with the development of thickness and muscularity in the
umbilical ligaments. It is plainly therefore of importance to note
that in Gerrhosaurus these ligaments are not obviously muscular
at all.
In the accompanying figures (text-figs. 33, 34) of the ventral
surface of the liver in Gerrhosaurus two other facts may be
pointed out, In the first place, there are traces of a membrane
which runs obliquely forward and ends in a notch in the left
border of the liver. As this white seam (6 in text-figs. 33, 34)
is much better developed in one example than in the other, I take
it to represent a rudimentary structure, and it may represent the
original course of the umbilical vein and thus correspond to a
similar trace which Hochstetter has lately described § inj the
Blind Worm (Anguis fragilis).
%* Hssays and Observations, revised by Richard Owen, London, 1861, vol. 11. p. 369.
“The liver [of Tiliqua] is attached forwards by two membranes, one to each lobe,
which unite at top.”
+ P. Z.S. 1888, p. 98.
{ Proc. Acad. Sci. Philadelphia, 1896, p. 308.
§ Morph. Jahrb. xix. Taf. xvi. fig. 185 but the course of the seam is different m
the two cases.
1905. ] OF THE YELLOW-THROATED LIZARD. 259
The second point concerns the relationship of the two umbilical
ligaments to veins entering the liver. A dissection of both
specimens of Gerrhosaurus shows that the anterior abdominal
vein enters the liver in the region of the left umbilical ligament
(c in text-figs. 33, 34), and that the epigastric vein is similarly
connected with the right umbilical ligament. Precisely the same
relationship holds for MJacroscincus cocteaui. Inasmuch as the
anterior abdominal vein joins the portal vein, the latter might
Text-fig. 33. Text-fig. 34.
Ne
WOE Ata,
. Text-fig. 33.—Liver of Gerrhosaurus flavigularis, ventral aspect.
a. Attachment of umbilical ligament; 6. Seam indicating course of embryonic
umbilical vein (?); ce. Left half of umbilical ligament; Ant. Abd. Anterior
abdominal vein; Hp. Epigastric vein; g.b. Gall-bladder.
Text-fic. 34.—Liver of a second example of Gerrhosaurus flavigularis, ventral
aspect. Lettering as in text-fig. 33.
be regarded as fixing this point were it not for the conditions
observable in Macroscincus cocteaui. In that lizard the portal vein,
immediately in front of the region where it has, as have the portal
yeins of other lizards, a spiral twist, divides into two branches,
which enter the liver ina line with each part of the divided
umbilical ligament. As to the relationship between the divided
as
260 MR. F. E. BEDDARD ON THE ANATOMY [June 6,
umbilical ligaments and blood-vessels, it is noteworthy that in
Eumeces algeriensis two hepatic arteries are associated each with
one of the two umbilical ligaments of that lizard.
Gastrosplenic Omentum.—This mesentery is very conspicuous in
Gerrhosaurus. It stands out asa free fold with the following
relations :—It arises from the stomach close to the pylorus and
passes obliquely downwards supporting the posterior extremity of
the spleen, the rest of which lies upon the mesogastrium ; it is
finally attached to the median dorsal line of the body-wall on a
level with the left ovary.
This arrangement is practically repeated in Macroscincus, where,
however, owing to the position of the viscera, the omentum is
shorter, but very strong and fibrous. Moreover the spleen does
not even reach, let alone hang over, the edge, as is the case with
Gerrhosaurus. In Humeces, however, the gastrosplenic omentum
is identical in its relations with that of Gerrhosaurus, save that it
is a little less pronounced as a free fold. I am not describing
here a state of affairs which is merely Lacertilian; for in T’upi-
nambis the course and relations of the apparently homologous
fold are different and do not involve the spleen.
Hepato-pulmonary Ligaments.—Gerrhosaurus agrees with the
majority of Lizards in that the right lung is suspended by two
mesenteries, viz., the hepato-pulmonary and dorsal pulmonary.
Tt is noteworthy that the latter mesentery in the case of both
lungs extends to the very tip of the organ; whereas in Hwmeces
the mesenteries in question do not reach the extremity of the
lungs. This is not, however, a characteristic of the Skinks as
opposed to Gerrhosaurus, for in Tiligua the membrane is co-
extensive with each lung as in Gerrhosaurus. Mr. Butler *
observes that “certain Scincoid lizards are as to the relations of
their right lungs and liver intermediate between the Teiide and
other Lizards.” My own knowledge of the family Scincide
enables me to confirm Mr. Butler; but his accurate statement
requires expansion’. In Hwmeces, Macroscincus, and Tiliqua
there is, in fact, attached to the right lung a pulmo-hepatic liga-
ment which is not so extensive as in, e. g., Gerrhosaurus.
In Macroscincus cocteawi this membrane extends rather more
than halfway down the lung and ends off upon the dorsal pul-
monary ligament, necessarily running in this region in a direction
nearly at right angles to the longitudinal axis of the lung.
Whereas in Gerrhosaurus flavigularis the two pulmonary mem-
branes join behind the right lung, in both specimens which I
examined.
The fact that there is no ligamentous interval between the
* “On the Subdivision of the Body-cavity in Snakes,” P. Z.S. 1892, p. 481.
+ And has also been expanded by Hochstetter quoted below.
{ Hochstetter (Morph. Jahrb. xxvii. p. 292) figures the same membranes in some
other Skinks, where they appear to agree with those of the forms studied by myself.
He says, however, of Gerrhosaurus madagascariensis that the “caudal end of the
right lung commences to be isolated from the ligamentum hepato-cavo-pulmonale.”
It is not soin G. flavigularis.
1905. ] OF THE YELLOW-THROATED LIZARD. 261
prolonged right lobe of the liver and the gonad, both male and
female, does not bear upon the question of the affinities of Gerrho-
saurus. For among the Skinks these organs may be in contact or
separated by a ligamentous interval.
Muscular fibres in Mesenteries—As is the case with other
Saurians, Gerrhosaurus has bands of unstriped muscle in several
of the mesenteries. The most important of these is a bundle of
muscular fibres which accompanies the anterior abdominal vein
(text-fig. 835, m) and runs into the gastro-hepatic ligament. It
is a thick bundle of fibres, but after traversing the gastro-hepatic
ligament for about half its extent it fans out into a fine bundle, -
the individual fibres of which hardly reach the stomach. This
bundle is represented in many lizards. But the conditions
observable in Gerrhosaurus throw no light upon the affinities of
Text fig. 35.
Gastro-hepatic ligament of Gerrhosauwrus flavigularis, showing course of
muscular bundle.
A, Gastro-hepatic ligament ; Ant.Abd. Anterior abdominal vein; Gt. Stomach ;
LZ. Left lobe of liver; m. Muscular band.
that lizard. For though it differs from the arrangement found
in the Scincide, it shows no likeness to what is found in Lacerta
ocellata. In KHumeces, Macroscineus, and Lacerta ocellata the
bundle of fibres is continued without fanning out to the stomach,
where it forms a close investment of that organ for the greater
part of its extent in MZacroscincus. Inasmuch as both specimens
of Gerrhosaurus were identical in the characters of this muscle,
it may, I think, be assumed that its condition is typical of the
species.
Pancreas.—The pancreas of Gerrhosaurus (text-fig. 36, p. 262)
differs from that of Lacerta ocellata in the comparative stoutness
of the branch which goes tothe spleen. It is, in fact, like Leydig’s
figure of the pancreas of Lacerta agilis, expanding when it reaches
the spleen. The pancreas of Gerrhosawrus furthermore differs:
from that of Lacerta (at any rate ocellata) in that there is a
262 MR. F, E, BEDDARD ON THE ANATOMY [June 6,
patch of the gland on the dorsal side of the pyloric angle from
which the splenic limb arises, and which is continuous beneath
the end of the stomach with the main body of the pancreas.
In Lacerta ocellata the splenic limb arises from the main lobe of
the pancreas further towards the gall-bladder. In these points the
Text-fig. 36.
Pancreas of Lacerta ocellata (left-hand figure) and of Gerrhosaurus
flavigularis (right-hand figure).
P. Pancreas ; py. Commencement of intestine; spl. Spleen; S¢. Stomach.
pancreas of Gerrhosaurus agrees with that of the Skinks, in which,
however, there is a tendency towards an enlargement of the dorsal
lobe of the pancreas and a disappearance of the splenic lobe. I
could not detect the latter in MJacroscincus, and it was very thin
in Tiliqua.
Arterial System.
As one of the two specimens of Gerrhosawrus flavigularis which
T have dissected was successfully injected, I am able to give some
account of the arterial system, dealing particularly with those
points which vary among the families of Lacertilia. The heart
has the usual, but not universal, tag tying the apex of the ventricle
to the pericardium. The pericardium extends forward beyond the
trifurcation of the arteria innominata.
A pair of arteries exist of very fair size, running one on each
side of the trachea in the position occupied by the carotids in
many Vertebrates, and they are like them quite close to the
trachea. These arteries have, however, nothing whatever to do
with the carotids, They are branches of the pulmonary arteries
(P, text-fig. 37), and the existence of these arteries in what
appears to be an unexpected place is possibly indicative of a
former forward extension of lung-tissue.
The branches of the carotid arch differ slightly from those of
1905. | OF THE YELLOW-THROATED LIZARD. 263
some other Lizards, though they agree, as might be expected, in
their main features. The first branch given off is a hyoid (hy,
text-fig. 37), which supplies the hyoid region generally; I have
not followed its branches minutely. In this region the carotid
is in close contact with the systemic arch. Further dorsally they
part company, and, shortly after this separation has occurred, the
Text-fig, 37.
Aortic arches and first part of dorsal aorta of Gerrhosawrus flavigularis.
Ca. Carotid; g. Gastric; I.c. Vertebral artery; hy. Hyoid artery ; 1. Muscular
twig; os. @sophageal branches; P. Pulmonary arch; Se/. Subclavian.
main trunk of the carotid arises. The trunks are here so twisted
that the carotid stem is given off posteriorly and dives under
the carotid arch to reappear on its anterior face. The rest of
the carotid arch is to be regarded as ductus Botalli, From this
section arise two arteries: the first is a small muscular twig; the
264 MR. F. E. BEDDARD ON THE ANATOMY [June 6,
second is an important trunk which divides into two branches.
One of these supplies the muscles of the shoulder-region (JZ); the
Text-fig. 38.
Ln
Abdominal region of aorta of Gerrhosaurus flavigularis.
g', g°. Gastric arteries; I.c. Intercostals; L.In¢. Artery of large intestine ;
cs. Hisophageal artery ; Si. Artery of small intestine.
other has a recurrent course and dives through the ring formed
by the carotid and systemic arches to supply the cesophagus (@s).
1905. | OF THE YELLOW-THROATED LIZARD. 265
The left systemic arch gives off no branches at all that I could
discover.
From the right systemic arch (which joins the left at about
the commencement of the lung) the two swbclavians (text-
fig. 37, Sel., p. 263) are given off, nearly, if not exactly, opposite
to each other. In front of this arises the vertebral artery (J.c.),
which gives off an cesophageal branch before plunging into the
thickness of the parietes. Behind the vertebral artery commences
the series of intercostals. The first zntercostal artery arises just
before the junction of the two aorte. It gives off a branch to the
cesophagus. The next two intercostals have also cesophageal
branches ; but it is to be noted that in all these the right inter-
costal alone has this cesophageal branch. The left has none. The
remaining intercostals have no cesophageal or gastric branches.
Their arrangement is peculiar and agrees with that of the Skinks ;
it differs from that of some other Lizards.
In Tropidurus hispidus, for example, the regularly paired
intercostals emerge from the dorsal aorta close to the articulation
of successive vertebre, and plunge at once into the thickness of
the parietes.
In Gerrhosaurus the intercostal arteries emerge from the
aorta at about the middle of each vertebra. In many cases,
and the arrangement is roughly alternating, the intercostal of
one or both sides divides at once into two branches; one of these
plunges at once into the thickness of the parietes. The other
passes obliquely forwards and runs superficially in close relation
toarib. This, however, only occurs in the thoracic region, not in
the lumbar.
Precisely the same disposition of vessels is found in Huwmeces
and some other Skinks, and the fact isa bond of union between
the Gerrhosauride and Scincide.
The next artery to arise from the aorta is a gastro-cesophageal
(text-fig. 37, ws, g, p. 263, and text-fig. 38, ws, g', p. 264), which
divides at once into a thin forwardly directed cesophageal, and a
stout backwardly directed gastric. Between this and the large
gastric artery (text-fig. 38, g°) are 6 pairs of intercostals. Two pairs
intervene between this artery and that of the large intestine, and
one pair between the latter and the artery of the small intestine.
The ovarian and oviducal arteries present some features which
are worthy of note. There are three pairs of oviducal arteries
which are not symmetrical. The first of these is really mainly an
ovarian artery, which gives off a thin and slender oviducal branch
running along the anterior section of the oviduct. The two
remaining oviducal arteries arise in common with an intercostal.
They lie in front of the rectal artery.
Venous System.
Although the venous system of neither of the examples at my
disposal was injected, most of the veins were beautifully displayed
by their own turgescence.
266 ON THE ANATOMY OF THE YELLOW-THROATED LIZARD. [June 6,
There are many differences in detail between the venous system
of this lizard and that of other genera.
Vena cava posterior.—It is interesting to note that Gerrhosaurus
agrees with Zuliqgua in that the left vena cava posterior is very
much thinner than the stout right vein. This is another of those
numerous though individually perhaps small points of likeness
between the genus whose anatomy is dealt with in the present
communication and the Scincide. As in Z%liqua also *, the left
cava or vena renalis revehens lies to the left side of the mesorectum
and the right vein to the right side of that mesentery. The left
vena revehens is large where it receives the three or four veins
arranged in a fan-like fashion from the left ovary ; behind this
point it dwindles immediately but can be easily traced to the
kidney, where it becomes enlarged at its jnnction with the right
vena renalis revehens.
The left vena renalis revehens receives two intercostal veins
before the ovarian veins join it, and on the right side also I
observed two intercostals. I could only observe one, and that a
slender, oviducal vein joining the left vena renalis revehens. J
feel convinced, however, that no veins from the oviducts join the
afferent renal veins, as is often the case in Lizards. The reason
for this in the present species may be that the kidneys are
unusually far back.
Afferent Renal Veins.—'The caudal vein reaches the kidneys as
an undivided vein. It runs between them and receives a cloacal
vein before dividing. Immediately after division each half receives
another cloacal vein. The cloacal artery runs exactly at the
point of division between the two afferent renals. At about the
end of the first third of the kidney each renal afferent vein turns
at right angles and runs superficially over the kidney, giving off
a large branch to the kidney itself at about the middle of the
transverse diameter of that organ. There is no sign of any
forward continuation of the renal afferent vein beyond the
anterior border of the kidney such as occurs in Chameleon and
Pygopus *.
Where the renal afferent vein reaches the border of the hind leg
it receives three veins, two from the hind limb and one from the
median dorsal parietes. It there runs directly forwards parallel
with the kidney, and ona level with the anterior end of that gland
receives the femoral vein, and a small parietal on the opposite side
which crosses the epigastric artery. The vein then continues its
straight course forward,and before bending inwards and downwards
to follow closely the inner margin of the fat-body gives off a short
forwardly directed branch, which appears to me to be the
equivalent of the lateral abdominal vein of other Lizards. Its
shortness in Gerrhosaurus contrasts with its length in Tiliqua.
Hepatic Portal Veins——The mode of entrance of the conjoined
intestinal portal and anterior abdominal and of the epigastric vein
* See Beddard, P. Z.S. 1904, vol. i. p. 445, fig. 93.
+ See P. Z.S. 1904, vol. ii. p. 15, fig. 4.
1905. ] ON THE BRAIN OF LIZARDS. 267
has already been noted. The epigastric springs from the anterior
abdominal some way behind the liver (text-fig. 34, Hp., p. 259), and
running along the umbilical ligament disappears in the substance
of the liver some way behind the anterior end. It is reinforced
by the usual branches from the median ventral parietes. These
vary in number in what appears to me to be a remarkable way.
In one specimen repeated examination has only enabled me
to ascertain the presence of a single ventral parieto-hepatic
vessel, which joins the epigastric at about the middle of the liver.
In a second specimen, on the other hand, there were four of
these ventral parieto-hepatic vessels (cf. text-figs. 33 and 34,
p. 259). I am disposed to think that the fluctuation in number
of these blood-vessels is related to fluctuation in the number and
size of the dorsal parieto-hepatic veins. These differed in the two
specimens which IJ have dissected, though not quite to so great an
extent as the ventral parieto-hepatic veins. In the specimen with
but one ventral parieto-hepatic vein, the dorsal parieto-hepatic
veins were as follows :—a large vein accompanies the anterior edge
of a fold of membrane which in this, as in many lizards, runs
obliquely and binds the end of the right lobe of the liver to the
parietes. This vein runs superficially for a short distance
anteriorly alongside the aorta on the right side, and is clearly a
fragment of the right posterior cardinal. It reaches the parietes
on a level with and outside of one intercostal artery and disappears
from view to the inside of the next intercostal artery in front; it
resembles a large superficially running intercostal vein. Besides
this there are three other dorsal parieto-hepatic veins lying
behind it. In the second specimen, with numerous ventral
pavieto-hepatic veins, I could find only three dorsal ones ; and the
first of these was by no means so large as in the first described
individual,
I could find only one gastro-hepatiec portal, which was anterior
in position.
6. On two Points in the Anatomy of the Lacertilian Brain.
By F. E. Bepparp, F.R.S., Prosector to the Society.
[Received May 17, 1905. ]
(Text-figures 39 & 40.)
(1) Note on the Cerebellum in Varanus exanthematicus.
In the account of the Lacertilia in Bronn’s ‘Thierreichs’ * the
following statement is made concerning the cerebellum of
Varanus :— Das Cerebellum oder das Hinterhirn ist gewohnlich
ein unpaarer, diner, steil und hoch aufsteigender Korper, der
seitlich mit der Medulla oblongata fest zusammenhaingt. Bei
* Bd. vi. p. 714.
268 MR. F. E, BEDDARD ON THE [June 6,
manchen Gattungen, z. B., bei Varanus, Iguana, ist es nach den
Angaben von Stannius zwar diinn, aber schildformig, vorne
concav, hinten convex und zeigt Andeutungen einer Sonderung
in eine mittlere und zwei seitliche Erhabenheiten, durch sehr
schwache Vorragungen, zwischen denen Spuren von Furchen
legen.”
It seems plain from the above account that the cerebellum of
Varanus is considered to be like that of Zgwana, and, presumably,
of other Lacertilia.
In one of the most recent works dealing with the brain of the
Sauropsida, the Catalogue of the Museum of the College of
Surgeons *, there is a description of the brain of Varanus and
some incidental references to the brain in the Lacertilia. Of the
brain of Varanus it is remarked that ‘the cerebellum is of
moderate dimensions and has the plate-like form usual among
Reptiles.” Elsewhere (p. 110) it is said that “the reptilian brain
is narrow... , and, except in swimming forms, with insignificant
cerebellum.” I have examined this specimen myself and agree
with the description. None of these statements, as I think, does
justice to the cerebellum of Varanus exanthematicus, which is not
at all like that of Zguana, has not a plate-like form, and is not
insignificant—comparatively speaking, at any rate.
The accompanying figure shows the characteristics of the
Text-fig. 39. Text-fig. 40.
Chis
eae
Text-fig. 39.—Lateral view of brain of Varanus exanthematicus (upper figure)
and of Tupinombis nigropunctatus (lower figure).
Text-fig. 40.—Dorsal view of brain of Varanus exanthematicus.
ce. Cerebrum ; ce. Cerebellum ; op. Optic lobes.
cerebellum of the Teguexin Lizard (text-fig. 39), which appears
to me to be quite typical of the Lacertilia and to bear out the
above quoted statements. It isa plate-like disc convex posteriorly,
which as it were lies up against the optic lobes and is propped up
* Descriptive and Illustrated Catalogue of the Physiological Series contained in
the Museum of the Royal College of Sur zeons of England, vol. ii. p. 113 (2nd ed.).
1905. ] BRAIN OF LIZARDS. 269
by them. It is faintly grooved in the middle line and laterally
on each side is a flattened process extending backward rather
beyond the rest of the cerebellum. Its insignificant proportions
are shown by the fact that the transverse (antero-posterior)
diameter of this thin plate is 2 mm., while the corresponding
measurement of the optic lobe is 8 mm.
As will be seen from text-figs. 39, 40 (p. 268), the cerebellum
of Varanus exanthematicus is a much more important structure.
Not only the actual but the relative size of the cerebellum is
greater. The corresponding measurements to those given above
for Tupinambis are for Varanus—diameter of cerebellum 4:5 mm.,
diameter of optic lobes 45 mm. They are thus equal.
The difference in dimensions between the cerebella of the two
Lacertilia is due to the exaggeration in Varanus of the boss-like
eminence upon the cerebellum of Zupinambis and Iguana. Not
only is the cerebellum of Varanus exanthematicus much greater
in bulk than that of Tupinambis or Iguana, but it is more
complicated in structure owing to furrows.
The dorsal furrow, continuous with that dividing from each other
the corpora bigemina, is more deeply marked in Varanws and more
definitely circumscribed than in Zupinambis ; in Iguana I did not
find any traces of it. Im the second place, the cerebellum of
Varanus exanthematicus has an equally deeply marked lateral
furrow, which runs obliquely upwards and forwards. Thirdly, the
lateral process of the cerebellum is much more sharply marked
off from the cerebellum itself than in Zupinambis, and runs
downwards rather than backwards, thus distinctly suggesting
the flocculus in the cerebellum of the higher forms. It is, indeed,
not at all unlike the cerebellar flocculus in Alligator.
It is plain therefore that the cerebellum of this Lizard is not
‘‘a mere transverse plate,” but an organ of some dimensions, and,
indeed, not very far, in point of relative size, from that of the
Crocodilia.
A large cerebellum has been associated in reptiles with the
swimming habit. And it is true that the Monitor Lizards are
often largely aquatic in habit. Curiously enough, however,
the present species, with its large cerebellum, is stated by
Dr. Giinther* not to take to the water.
More likely, as it appears to me, is this advance in structural
complexity of the brain to be associated with the not only isolated
but high position which the Monitors occupy among the
Lacertilia.
(2) On the Cerebral Hemispheres in Tropidurus hispidus.
T imagine that I am right in believing that the brain of this
TIguanoid Lizard has not up to the present been submitted to
anatomical examination. I am able, therefore, to add a fact of
* “On the Anatomy of Regenia ocellata,” P. Z.S. 1861, p. 60.
270 ON THE BRAIN OF LIZARDS, [June 6,
some little interest to what isalready known about the Lacertilian
brain, as a result of the examination of two brains of this Lizard.
In the Lacertilian brain generally, so far as my own knowledge
and the inspection of published figures* enable me to state, the
optic lobes lie behind the cerebral hemispheres, the furrow between.
them being practically vertical; there is, in fact, no trace of an
overlap of the corpora bigemina by the hemispheres. In the
Chelonia, on the other hand, it has been recognised that some
forms show an overlap of the corpora bigemina by the cerebral
hemispheres,
IT have found this lobe very obvious in a brain of the large
Testudo vicina, the vascular system of which I have recently
described. The overlap, however, is lateral and not dorsal. It
is quite different with Zropidurus. There isa very distinct overlap
of the corpora bigemina by the hemispheres dorsally. The
corpora bigemina are thus partly hidden when the entire brain
is viewed on the dorsal aspect.
A comparison of the measurements of the brain in this species
and in Jguana tuberculata seems to throw some light upon the
causation of this overgrowth of the cerebral hemispheres over the
corpora bigemina, dorsally.
The following are the measurements to which I desire to
refer :
Iguana. Tropidurus.
mm. mm.
Length of brain to end of cerebellum ... 16 11
Length of cerebral hemispheres ......... i) 6
Breadth of cerebral hemispheres ......... 115 6:5
It will be observed, from a comparison of these figures, that the
proportions between the total length of the brain in the two
Lizards, and both the breadth and length of the cerebral hemi-
spheres, are about equal. It therefore results that the overlap of
the hemispheres in Z'ropidwrus is rendered necessary by the skull
formation and consequent lack of room for increased lateral
growth of the hemispheres. By growing over the corpora
bigemina, the hemispheres have been able to attain to the
proper size necessary to the equilibrium of their possessor.
These considerations may be regarded, perhaps, as discounting
the morphological importance of the partial covering over of the
corpora bigemina by an extension backwards of the cerebral
hemispheres.
Nevertheless, it is impossible to overlook the fact that there is
an approximation in the brain of this Lizard, to whatever cause
it may be due, to those of higher Vertebrates.
* See Bronn’s Klassen u. Ordnungen des Thierreichs, Bd. vi., and Meyer, Zeitschr.
wiss. Zool., Bd. lv. (1898).
+ Supra, p. 67.
1905. | ON SOUTH-AFRICAN COLEOPTERA. 271
7. On new Coleoptera from South Africa collected by
Dr. H. Brauns and others—Serricornia, Endomyclide,
Erotylide. By H. 8. Gornam, F.Z.8.
[ Received May 19, 1905. ]
This paper is a sequel to those published by me in the ‘ Annals
and Magazine of Natural History ’ for 1900-1901. The material
dealt with is similar in character to that contained in the col-
lections sent to me by Mr. G. A. K. Marshall, but is without
Coccinellidee or Languriide. The publication of the paper has
unfortunately been much delayed, owing to domestic reasons.
The Cleride are particularly well represented and indicate a
very rich fauna in this subfamily as well as in the Melyride.
Hedybius represents the European J/alachiws, and is evidently
(with its allied genera) as rich in species.
TELEPHORIDSE.
TELEPHORUS VIRIDESCENS Fab,
Telephorus viridescens Fab, Syst. Kleuth. i. p. 295 (Cantharis).
Hab. Willowmore, Uitenhage, Cape Colony (Srawns).
In the Munich Catalogue this species is given as a synonym of
Cantharis smaragdulus Fab. Spec. Ins. p. 259, a Brazilian insect ;
but Fabr. loc. cit. gives “Cap bon. spei” as the locality of the
Cantharis viridescens, with which my specimens agree very well.*
TELEPHORUS INcIsus Wied. Zool. Mag. ii. p. 71.
Hab. Algoa Bay, Cape Colony (Lrauns). 2 examples.
Smaller than 7’. viridescens, with a thoracic vitta from the
front to the hind margin and without spots on the sides or at the
base ; elytra less green, of a dull grey-black.
TELEPHORUS zZoNATUS Gemm. Cat. Col. p. 1674.
Telephorus vitticollis Bohem. Ins. Caffr. 1. 2, p. 453, nec Meénetr.
Cat. Rais. p. 162.
Hab. Algoa Bay, Cape Colony (brawns), 1 example.
Described by Bohem. Joc. cit. from “ Limpopo” R., Caffraria.
TELEPHORUS BIVITTATUS Fab.
Nee 7. bivittatus Mars.
Hab. Algoa Bay, Cape Colony (Brawns). 1 example.
TELEPHORUS NiGRINUS Bohem. Ins. Caffr. i. 2, p. 457 (Cantharis) ?
Hab. Algoa Bay, Cape Colony (Srauns). 2 examples,
In one of the two examples sent the thorax is nearly twice as
wide as long, in the other example (which, from the length of its
antenne, appears to be a male) itisquadrate. This seems to me to
agree with the insect described by me (Ann. & Mag. N. H. 1901,
272 REY. H. 8. GORHAM ON [June 6,
vil. p. 351) as 7’. teter from Natal. From so few examples it is im-
possible to say whether these two pertain to one or two species ;
or what is the sex of the specimen with transverse thorax, which
is also more shining and has shorter antenne. I incline to the
belief that they represent two species, the latter being referable to
C. nigrina Bohem.
CLERID &.
EucyMaroperA Schenkling.
EucymatoderaSchenkling, Ann. Mus. Civ. Genova, 1899, p. 333;
Genera Ins. fase. xiii. p. 19 (1903).
EUCYMATODERA CINGULATA Klug, Cler. p. 273 (Zllus cingulatus).
Hab. Algoa Bay.
EUCYMATODERA HOTTENTOTA Knw. Ann. Soc. Ent. Belg. p. 463
(1893) ; Schenk. /. ¢. p. 20.
Hab. Willowmore, Cape Colony (Lrauns).
Cyxiprus Lat.
Cylidrus Schenk. Genera Ins. fase. xiii. p. 5
CYLIDRUS BALTEATUS Klug, Cler, p. 263.
Hab. Bothaville, Orange R. State (Lrauns).
I had not seen this from 8. Africa before.
Gyponyx Gorham.
Gyponyz Gorham, Ann. Mus. Civ. Gen. 1883, p. 604; Schenk.
lic. p. 45.
GYPONYX CHINENSIS Fab.
Gyponyx marmoratus Klug, Cler. p. 308 (Clerus), nota p. 379.
Hab. Bothaville, Orange R. State (Brawis).
GyPoNyX RETROCINCTUS Chevr. Rev. Mag. Zool. p. 283 (1874).
Hab, Sunday River, Cape Colony (Lrauns).
GYPONYX ALGOENSIS, sp. n.
Oblongus, subparallelus, piceo-brunneus, nitidus; elytris basi
dilutioribus, ultra medium fascia undulata et apice albis.
Capite crebre prothorace parce punctatis, hoc pernitido, antice
tenwiter constricto, postice coarctato; antennis et. palpis rufo-
piceis ; elytris usque ad fasciam grosse seriatim punctatis, inde
ad apicem fere levibus ; pedibus piceis, tarsis dilutioribus,
metasterno punctato. Long. 11-14 millim.
Hab. Algoa Bay (1. Brawns).
The general colour of this species is dark pitchy brown, the
antenne, palpi, tarsi, and the base of the elytra nearly as far as
the white fascia are rufo- piceous, the elytra are blackish in an
1905. | SOUTH-AFRICAN COLEOPTERA. 273
indefinite way just before the very definite white fascia; this is
narrowly interrupted at the suture; the apex is white, but with
a fine blackish margin; the space between the fascia and the
apex is very obsoletely punctured, as is the fascia, almost smooth
externally. The eyes, head, legs, and body generally are clothed
with long but fine hairs.
One example of this insect received long ago from Dr. Baden is
in my collection, but bad, unfortunately, no precise locality. It
is the larger specimen.
GYPONYX BRAUNSI, sp. 0.
Hlongatus, nigro-piceus; ore, antennis palpisque, thoracis
margine antico, corpore subtus, pedibus (geniculis tibiisque
exceptis) dilutioribus, rufo-piceis. LHlytris basi indeterminate,
fascia mediana (in marginem latissima postice bidentata)
maculaque apicali obliqua testaceis. Thorace elongato, antice
tenuiter, ad basin fortius constricto ; elytris ad basin punctato-
lineatis, seriebus vin ad medium vectis, externe deficientibus.
Long. 13 millim.
Hab. Willowmore, Cape Colony (Brauwns).
This species differs from any other known to me by its elongate
thorax and its comparatively smooth and shining appearance, and
also by the clear and distinct coloration and pattern of the elytra.
The colour of the body, with the exception of the head and thorax,
of the tips of the femora, and bases of the tibie, is a bright rusty
red. The elytra have an oblique broad fascia, much indented,
running backwards from below the callus to the suture, of a pitchy
colour ; a much broader patch before the apex of a lighter pitchy
brown, deeply indented twice on its upper edge, and once on its
lower edge, so that it is narrowest in the middle. The lines of
punctures scarcely pass the first brown fascia, only four or five
punctures being on the yellow median wide patch. The thorax
is nearly twice as long as wide, its front margin is rufous, the sides
very little widened, not deeply constricted in front, the base
coarctate and margined, the punctuation close and fine, the disk a
little flat. I have at present only seen the example described,
which I have pleasure in naming after its captor, Dr. H. Brauns.
GRAPTOCLERUS Gorh.
Graptoclerus Gorh. Ann. & Mag. N. Hist. ser. 7, vii. p. 351
(1901); Schenk. /. c. p. 48, nota.
GRAPTOCLERUS QUADRIPUNCTATUS Gorh. J. c. p. 353.
Hab. Grahamstown, Cape Colony (Dunkerbosh, Dr. Penther).
Described by me from Natal. 1 example.
TARSOSTENUS Spinola.
TARSOSTENUS UNIVITTATUS Rossi.
Hab. Willowmore (Brauns).
Proc. Zoo, Soc.—1905, Vou, II. No. XVIII. 18
bo
x
ns
REV. H. 8. GORHAM ON [June 6,
DozocouLetus Chevy.
Dozocolletus Schenk. J. ¢. p. 38.
Pezoporus Klug, Clerii, p. 311.
DozocoLLETUS BRUNNEUS Hintz, Deuts. ent. Zeit. 1902, p. 397 2
Hab, Willowmore, Algoa Bay (Brauwns). Bothaville, Orange
R. Colony.
T have not seen Hintz’s description, but I have little doubt that
the insect taken in some numbers by Dr. Brauns is to be referred
to it. This species has a large head, the thorax as wide in front as
the head, the head and thorax deep pitchy brown, the elytra, legs,
and body light brown, the punctuation and striz are obsolete.
DozocoLLetus SORDIDUS, Sp. 0.
Saturate brunneus ; antennis palpisque rufo-brunneis, lis quam
caput et thorax brevioribus, articulis quarto ad octavum quad-
ratis, tribus ultimis transversis, apice compresso; capite
prothoraceque creberrime confluenter, elytris fortiter striato-
punctatis, femoribus clavatis. Long. 5 millim.
Hab. Algoa Bay (Brauns).
Smaller than the species which I have assumed to be
D. brunneus Hintz, and especially to be distinguished from
it by the shorter antenne, which have much shorter joints;
the second and third joints are a little longer than wide; the
fourth to the eighth are about as long as wide, while the last
three joints form a compact club and are transverse. The eyes
are more prominent than in D. brunneus, the femora are
strongly clavate. The thorax is as wide as the head in front,
much narrowed to its base, obconic; the elytra small in proportion,
elongate-ovate.
TuHRIocERA Gorham.
Thriocera Gorham, Trans. Ent. Soc. Lond. 1878, p. 156;
Schenk. l.c. p. 117.
THRIOCERA PECTORALIS Klug, Clerii, p. 348.
a. Elytris unicoloribus fascia mediana plicata.
Hab. Algoa Bay, Port Elizabeth (Lrauns).
6. Elytris bast rujis.
Hab. Algoa Bay, Port Elizabeth (Brauwns).
THRIOCERA BICINCTELLA, sp. 1.
Nigra, nitida, tenwiter pubescens ; antennis, palpis pedibusque
rufo-brunneis, illis basi dilutioribus ; prothorace brevi, antice
tenuiter constricto, postice coarctato, lateribus rotundatis, disco
ineequali impresso ; elytris sublevibus, fasciis duabus elevatis,
eburatis, ad suturam interruptis, anteriore (juxta callum) intus
abbreviatis. Long. 5 millim.
Hab. Algoa Bay (Brawns).
1905. | SOUTH-AFRICAN COLEOPTERA. 275
Var., capite, antennis, palpis, elytris usque ad fasciam postervorem,
corpore subtus cum pedibus rufo-ferrugineis.
Hab. Port Elizabeth, Cape Colony (brauns).
Antenne as in 7’. pectoralis, but less robust, the two basal joints
stout, the intermediate joints longer than wide, the three apical
forming a lax club. The thorax is notably shorter than in
T. pectoralis and of a different form, being much more narrowed
towards the base; its disk is also roughly punctured and uneven,
finely pubescent with long hairs, but neither it nor the elytra are
so thickly pubescent as in 7’. pectoralis. The elytra are black, or,
as in the variety, red to the second fascia. The fasciz are raised
and ivory-white, not clothed with silky-white hairs (as they are
in 7. pectoralis), but clear shining white; the anterior one is
shortened, so as to leave a space at the suture equal to its own
length, nor does it reach the margin.
There are two examples of the type form and two of the variety.
NorostEnus Spinola.
Notostenus Schenk. t.c. p. 114.
Norosrenus viripis Thun. Nov. Ins. vol. i. p. 9 (1784).
Hab, Algoa Bay (rawis).
MELYRID2.
ANTHOCOMUS Hrichs.
ANTHOCOMUS CORTACEUS, Sp. Nn.
Breviter oblongus, niger, obscure subviridescens, longe pubescens ;
capite prothoraceque nitidis, hoc profunde parce punctatus ;
elytris coriaceis; antenwis (apice exceptis), tibiis tarsisque
ferrugineis. Long. 4 millim.
Hab. Bothaville, Orange R. Colony (Lrauns).
Black, densely clothed with long black pubescence. Head and
thorax shining, the former very closely and finely, the latter very
sparsely punctured. Clothed all over with long fine hairs. The
mouth, palpi, antennz (excepting the extreme tip), the tibie, and
tarsi are ferruginous red. The elytra are little shining, coriaceous,
tubercles obscurely in rows and but little elevated, being rather
uniform all over their surface. There is a slight greenish, but
hardly perceptible, tint over the whole upper surface ; the body
beneath is quite black. As there are only two specimens, and I
cannot distinguish the sexes, it is impossible to say if thisis a true
Anthocomus. "The lamellze of the tarsi are about as long as the claws.
Hepystius Erichson.
HEDYBIUS SCULPTICEPS, Sp. n.
Nigro-subceruleus ; capite (basi excepta), antennis (articulis extus
et apicem versus nigro notatis), prothoracis margine, pedibus
Tigi
276 REV. H. 8. GORHAM ON [June 6,
anticis et intermediis (eaterne nigris) testaccis ; elytris cewruleis,
purpureo vel violaceo micantibus. Long. 55-65 millim. 3°.
Mas, capitis basi profuwnde excavato-eroso, erosione ima tota
nigra ; fronte elevata, in medio profunde sulcata. <Antennis
acute serratis, articulo quinto triangulari apice nigro.
Femina, antennis brevioribus, leviter serratis.
Hab. Willowmore, Cape Colony (Lrauns).
The head in the male is deeply excavated ; the surrounding parts
are yellow and elevated, but very differently from either of the
Hedybii described by me in the ‘Annals and Mag.’ for Jan.
1900*. The deep notch in the front part of this elevated edge
of the crater is of itself sufficient to prevent its being confused
with them. he base of the crater in the male and the base of
the head in the female are black. ‘The antenne are more acutely
serrate than in any other species I have seen. ‘They vary in the
degree to which they are marked with black. Their second joint
is very short, the third as long as the basal, the fourth and fifth
triangular, the last in the male always black in its apical half
and more acutely produced inwards; the following joints are
longer, acutely serrate, and more or less dark, in the females I
have seen always dark.
The thorax is of the same shape asin H. amenus, HT. anceps, Xc.,
but the disk is nearly all suffused with blue-black, two dark points
project on the base, and it is sometimes indented on each side in
front.
The scutellum is black; the elytra are blue and often have a
beautiful metallic-violet reflection, they are finely coriaceous.
The legs are yellow but tinged with black, and the hind pair are
altogether dark, in which respect this insect also differs from any
of the Hedybii of this group described.
Three males and two females of this species were sent me by
Dr. H. Brauns.
HEDYBIUS QUADRICORNIS, Sp. Nn.
Oblongus, nigro-ceruleus ; capite, prothorace pedibusque san-
guineis ; scutello et elytris viridibus, sericeo-pubescentibus ;
antennis rufis, articulis singulis (maris) nigro-notatis, femince
articulis basi tribus rufis usque ad apicem infuscatis. Long.
4-4-5 millim. 3 @.
Mas, capite excavato-eroso, erosionis margine basali im cornu
duplict quasi elevato, cornu anteriore apice ciliato, posteriore
hamato apice nigro, supra oculos tuberculato.
Femina, fronte deplanata, basin versus migrescente.
Hab. Willowmore, Cape Colony (Lrauns).
Head, thorax, base of the antennez, margins and apex of the
andlonnen yellow; the scutellum and elytra are bluish green. The
upper side is finely clothed with a pruinose silky pubescence,
long hairs are absent.
The head in the female and the front of the thorax in the male
* Ann. & Mag. N. H. ser. 7, v. p. 81 (1900).
1905. | SOUTH-AFRICAN COLEOPTERA. 200
are sometimes faintly suffused, and the hind tarsi are blackish.
The body beneath is bluish. The extraordinary structure of the
head in the male is alone sufficient to distinguish this insect from
any species described ; it resembles in colour and size an insect
sent by Mr. G. A. K. Marshall from Salisbury, and which I
doubtfully referred to H. variicornis Bohem., but as the latter
Specimen was a male I am certain that it does not belong to the
species I now describe.
Obs.—Boheman does not in describing H. superciliosus give the
diagnosis of the male head, but I have no doubt from his remarks
it is a male he describes. His express assertion, repeated, that
the scutellum is yellow precludes any of the specimens I have yet
received from being referred to this species. A considerable series
of this insect has been obtained by Dr. Brauns; four males and
four females are before me.
Hepvpius ama@nvus Gorh. Distant’s Nat. in Transvaal, p. 197;
Ann. & Mag. N. H. ser. 7, v. p. 80 (1900).
Hab. Bothaville, Orange R. Colony (Lrawis).
One male and three females, in all respects agreeing with the
types. They are interesting as corroborating the differences
pointed out before and as being found in quite a new locality.
PuiLHEDONUS Gorham.
Phithedonus Gorham, Ann. & Mag. N. H. ser. 7, v. p. 82 (1900).
PHILHEDONUS SERICEUS, Sp. n.
Vigro-ceruleus, pube brevi sericea vestitus ; prothorace rufo, fere
glabro, macula nigra in margine antico haud bene discreta ;
elytris creberrime subtiliter punctatis, pube brevi pruinosis ;
scutello, pedibus et corpore infra nigro-ceruleis. Long.
5 millim. 9 2
Hab. Bothaville, Orange R. Colony (Lrauns).
This Philhedonus differs from the insect described by me as
P. coronatus by its smaller size, by the wholly black antenne,
and by the labrum not being red; the thorax is also differently
marked, the single black spot is placed upon the front margin, and
is wedge-shaped, pointing backwards. The head is blue-black and
shining, not punctured, very sparingly golden pubescent; antenne,
mouth, and palpi black, the former short and feebly serrate. The
thorax is wider than long, the sides and base finely margined,
the anterior margin raised, but only very finely so.
The elytra are wide, and are widest a little before the apex,
deep blue with a silky and shining pubescence ; the punctuation
is fine, close, and confluent. They do not cover the apex of the
abdomen. ‘The body and legs are entirely blue-black ; the vesicles,
which can be protruded from the sides (and are so in the
specimens sent), are blood-red. The pygidial segments beyond
the elytra show a green tinge. The examples, two in number, are
both, I think, females.
278 REY. H. 8. GORHAM ON [June 6,
PHILHEDONUS RUGULOSUS, sp. 1.
Niger, nitidus, pube erecta nigra vestitus ; prothorace rufo, plaga
magna discoidali marginem basalem haud attingente nigra,
parcius irregulariter punctato,; elytris saturate ceruleis,
ruguloso-coriaceis ; scutello nigro ; corpore Unive cum pedibus
nigris; antennis nigris, acute serratis. Long.5'5millim. @.
Mas, antennis longionibus: acute serratis, capite intra oculos
inequaliter impresso.
Femina, antennis brevioribus, minus acute serratis, fronte plana.
Hab. Willowmore, Cape Colony (Brauwns).
Rather like P. sericeus. Head, mouth, antenne, palpi, legs, and
body beneath black. The head is uneven and impressed between
the eyes, the base is nearly smooth and shining; the antenne have
the first three joints testaceous beneath, from the fourth to the
tenth the joints are longer than wide, acutely produced at
their inner apices. The thorax has a large black and square
patch on the disk and front margin; this is somewhat produced
behind, but does not reach the hind margin; the disk is smooth
in front, but punctured and rugose at the sides. The form is
like that of P. sericeus, transverse, rounded at the sides and base,
without angles ; finely margined, and a little elevated in front.
The disk and the elytra are ‘clothed with long upright black hairs.
The elytra are of a deep violaceous or indigo-blue, uniformly
rugulose ; the rugosities are tuberculous. They are widest a little
before their apices, the apex broadly rounded. In addition to
the black erect hairs there is a white, shining, pruinose
pubescence, arranged in fascize (but not very evidently so).
The legs and underside are wholly jet-black.
The male has the head unevenly impressed between the eyes,
the antennze more acutely serrate, and of course the front tarsi
four-jointed. The elytra cover the abdomen in all of the four
specimens before me; in the female the segments of the abdomen
when distended appear narrowly margined with red.
HEDONISTES, gen. nov.
Labrum cornewn.
Tarsi antici quinque-articulati; caput maris eroso-excisum,
Semine fronte plana; antenne maris articulo basali quinto
et sexto ampliatis, septimo ad undecimum simplicibus ; femince
articulis ommibus simplicibus.
Hab, Africam meridionalem.
A genus recalling by the curious sexual characters of the
antennee in the male the genera Zaius from Australia and Collops
from the New World, and by its excavated and cornuted head
in the male the genus Hedybius, with which it might have
been associated; but I think although the enlarged fifth and
sixth joints of the antenne are only a sexual character, it is one
so similar to what is found in Laiws and Collops that it will be
well to keep insects of this family possessing it in a separate
1905. ] SOUTH-AFRICAN COLEOPTERA. 279
genus. M. Fairmaire has described some species as to be
attributed to Zaius, from Madagascar, Nossi Bé. J have not seen
them, but I suspect it will be found that there are such radical
differences as to preclude such an association; and he does not
mention enlarged joints. Zaius, it may be observed, was founded
upon a female example from Australia, and ought strictly to be
suppressed for Westwood’s name MJegadeuterus, which at least
expresses the fact that the second joint of the antenne is enlarged
in the male sex. That he cluded other insects in his genus is no-
reason for suppressing the name, but only for confining it to the
type, and to such as can be associated with it.
H&DONISTES LATUS, Sp. Nn.
Brevis, niger, pube brevi cinerea erecta vestitus, valde punctatus ;
elytris subquadratis, grosse et confluenter punctatis, fascia lata,
ad marginem latissima, apiceque lete sanguineis ; epistomate,
labro ad apicem et antennaruwm basi rufis. Long. 4°5—-5
millim. 3 Q.
Mas, capite eroso-excavato, ad antennarum basin utrinque
carinato elevato, basi triangulariter elevato, elevatione in medio
sulcata, antice ciliata, bicirrosa ; antennarum articulis basal
quinto et sexto wmpliatis.
Femina, jfronte plana, antennis simplicibus.
Hab. Willowmore, Cape Colony (Lrauis).
Head and thorax black, thickly and the latter rather coarsely
punctured; the antennz have four joints at the base red, the rest
black, the apical joint is elongate, the intermediate joints in the
male are longer than wide, in the female about as long as wide,
not serrate but rather triangular. The thorax is shining, not
wider than the head, and much narrower than the elytra at the
base, somewhat cordate, with the margins a little reflexed. The
elytra are blue-black, with a fascia which is interrupted at the
suture, but very broad on the margin, of a fine blood-red, and
their apex is rather broadly margined with the same colour; the
basal side of the fascia is produced along the margin so as to
surround the shoulder; their surface is uniformly, coarsely, and
in places confluently punctured, honeycombed. The legs are
black.
Hight examples, consisting equally of each sex, were sent me
by Dr. H. Brauns, by whom they were obtained at Willowmore
in Cape Colony.
HROTYLIDS.
AMBLYSCELIS H#MORRHOUS Gorh. Ann. Soc. Ent. Belg. 1885,
p. 326; Ann. & Mag. N. EL ser. 7, v. p. 90 (1900).
Hab. Bothaville, Orange R. Colony.
Excepting that the brownish-yellow colour is more diffused in
two examples from Bothaville, so that one is wholly brown with
darker striz, and the other has a not very well-defined yellow
vitta, formed by the humeral spot extending to meet the apical
280 MR. R. ASSHETON ON THE F@TUS AND [June 6,
yellow, there is no difference in these examples and those from
Natal.
ENDOMYCHIDA.
CEDIARTHRUS Gerst.
“Hdiarthrus Gerst. Mon. Endom. p. 344.
CHDIARTHRUS ALGOENSIS, Sp. i.
CH. natalensi similis et affinis. Lerrugineus, antennis, palpis
pedibusque nigris, tibtis rectis. Long. 4:5 millim. 6.
Mas, antennarum articulo nono ampliato.
Hab. Algoa Bay (Brawns). 1 example.
Rather ise ger than @. natalensis, and diftering from it in having
the antennze “wholly black, with all the joints rather longer and
more stoutly built; the ninth joint is triangularly enlarged, as in
other species of this genus, in the males; the two terminal joints
are formed quite as in @. natalensis, but are larger.
The legs are black and have their tibie straight, which alone is
sufficient to distinguish this species from (@. natalensis. For
some general remarks on the genus I must refer to Ann. & Mag.
N. H. ser. 7, vii. p. 402 (1901).
LycoPERDINA SERICEA Gerst. Mon. Endom. p. 218 ¢
Hab. Algoa Bay, Cape Colony (Lrauns).
There is a single specimen of a very small Lycoperdina in
Dr. Brauns’ collection which JT refer to this species with some
little doubt.
8. On the Foetus and Placenta of the Spiny Mouse (Acomys
cahirinus). By RicHarp AssHeTon, M.A., F.ZS.,
Lecturer in Biology in the Medical Sahel a Gun
Hospital, University of London.
[Received May 28, 1905. ]
(Text-figures 41-45.)
I received from Mr. F. E. Beddard, F.R.S., Prosector to the
Zoological Gardens, London, a bottle containing the foetus and
uterus from an individual of the Spiny Mouse (Acomys cahirinus).
The exact age of the feetus was not known, but the figure (text-
fig. 41) given here shows that it was well advanced.
In the bottle were three objects—namely, the fetus and
placenta (as shown in text-fig. 41), the uterus with Fallopian
tubes and ovaries, and a third object which was a_ partially
absorbed feetus and placenta.
The uterus is bicornuate; each horn measures about 18-20 mm.,
and passes gradually into the Fallopian tube, a short, coiled tube
lying alongside the ovary (4 mm. x 2 mm.).
1905. | PLACENTA OF THE SPINY MOUSE. 281
Each horn had been opened. Opposite the sht on the meso-
metric side a swelling marked the place of attachment of the
fully formed placenta and fetus in the one case, and of the
absorbed specimen in the other.
The feetus appeared devoid of amnion and was chiefly remarkable
for the long hairs or spines which rise from the dorsal walls of
the nostrils and point backwards over the head. The pits from
which these hairs arise are plainly visible (text-fig. 41).
Text-fig. 41.
The foetus of Acomys cahirinus, together with the placenta separated from the walls
of the uterus. The sac-like folds attached to the discoid placenta are the
yolk-sac and amnion membranes. An epitrichium is seen closely applied to
the body of the fetus. X 3.
A thin membrane could be seen covering certain parts of the
embryo, the face, neck, and wrist, and it could be detected by
careful search over other parts. This membrane covered the
finer hairs, but was perforated by the stout bristles, and 1s
probably of the nature of an epitrichium.
The foetus was attached by a long cord to the placenta, which
had been separated from the uterus.
The placenta was discoidal in shape, but with a longer diameter
of 12 mm. and a shorter of 9°5 mm. In thickness it was about
3 mm. The embryonic surface was concave, the ab-embryonic
surface convex (text-fig. 42).
Attached to the proximal (feetal) surface of the placenta was
a wide sac through which the cord passed to the centre of the
placenta.
At the point where the cord appears to penetrate the sac there
282 MR. R. ASSHETON ON THE F@TUS AND | June 6,
was a crumpled mass of membranes, consisting of the yolk-sac
and amnion, which had been detached from the foetus during the
act of preservation.
Description of the Placenta.
The proximal wall of the yolk-sac, which les up against the
face of the placenta, is extremely vascular and covered with an
epithelium of large columnar cells. Moreover, this epithelium
is much folded; and the blood-vessels lie in the folds, and so
approach closely the surface of the placenta (text-fig. 42).
The yolk-sac wall is firmly attached to the placenta over the
peripheral area.
Text-fig. 42.
The placenta of Acomys with the proximal wall of the yolk-sac attached showing
the radiating vessels of yolk-sac circulation which are covered with a thick
epithelium. X 3.
This attachment of the yolk-sac to the placenta is not so
intimate as it is in the common rat, in which animal the yolk-sac
forms villi or at least folds which become embedded in the tissues
of the allantoic placenta, but remain quite easily distinguishable
therefrom (cf. Robinson, A., “The Nutritive Importance of the
Yolk-sac,” Journ. Anat. & Phys. vol. xxvi. p. 308 (1892);
Duval, M., ‘Le placenta des Rongeurs,” Journ. Anat. et Phys.
1889-1892). In dAcomys the yolk-sac is much folded, but the
folds do not become involved in the placental tissues (text-
fig. 45, HH).
The placenta itself, which we may regard as being nearly full
term, shows only a small area of actual vascular attachment to
the wall of the uterus (text-figs. 41, 42). Here it is rough, and
marked by open blood-sinuses and shreds of tissue. Passing
outwards and extending nearly to the rim, there is a layer of
rather darkly staining material showing no particular structure
MOO aa| a PLACENTA OF THE SPINY MOUSE. 283
and containing dead nuclei, which [ must regard as cell-detritus.
This layer probably lay against, and was no doubt more or less
attached to, the uterine wall (text-fig. 45, D).
Text-fig. 45.
A section of a portion of the placenta of Acomys taken vertically near the centre of
the organ, where the foetal capillaries are forming a network round about the
channels containing maternal blood.
F.BV. Feetal capillary. LE. Maternal leucocyte. MCH. Maternal blood in
channels excavated in the trophoblast of the fetus. T. Trophoblast
nuclei. > 480.
From this point and passing over the edge of the placenta, and
covering the free surface of the feetal side of the placenta, a flat-
tened attenuated epithelium can be distinguished (text-fig. 45, H,
p. 285). This becomes thicker and more cubical as it nears the
point at which the yolk-sac wall is connected with the placenta,
and here it passes into the decidedly cubical or columnar epithelium
of the yolk-sac. This layer continued in the other direction
would pass at some period into the distal wall of the yolk-sac,
though whether this distal wall exists at the period under
examination I cannot say.
The rough surface of vascular attachment, so far as I can
judge from the general character of the cells, is composed entirely
of maternal tissue. This tissue is of that kind so frequently
found where trophoblastic ingrowth is about to take place, and
had been named by Hubrecht trophospongia (text-fig. 44, p. 284).
Text-fig. 45 is a diagrammatic representation of a section
passing through the centre of the placenta. The placenta, as
284 MR. R. ASSHETON ON THE F@TUS AND [June 6,
stated above, had been separated from the wall of the uterus, so
although shown im sié#w in the figure it must be understood that
the two parts were not together in my specimen. The line 8
marks the boundary between the two.
On the outside I have drawn in outline the muscle coats
(M) of the wall of the uterus.
Within this, and seen only near the centre, is the trophospongial
tissue alluded to above (TS), while towards the peripheral parts
the thin layer of detritus can be seen at D, composed probably of
both maternal and foetal tissues.
Text-fig. 44.
A section through the junction between trophoblast and trophospongia of Acomys.
T. Trophoblast. Ts. Trophospongia. EP. Pseudoepithelium of trophoblast.
EP’. Pseudoepithelium of trophospongia. MCH. Maternal blood.
Everything within this line formed by the detritus layer on
the outside and the trophospongial layer at the centre is probably
foetal in origin, except the maternal blood, which is extravasated
and flowing in channels excavated in the ‘foetal trophoblast. It
must of course be remembered that this description is an interpre-
tation of a single stage based upon the known facts in closely
allied forms (ref. Duval, Robinson, Jenkinson), and not upon the
study of the actual development in this genus.
1905. ] PLACENTA OF THE SPINY MOUSE. 285
The advancing edge of the trophoblast is sharply defined from
the maternal tissue (text-fig. 44, T). The trophoblast is composed
of a compact mass of cells with large nuclei and generally fairly
well-marked cell-boundaries. It has, in fact, the character more
of a cytotrophoblast than a plasmodi-trophoblast (text-fig. 44).
The nuclei tend to arrange themselves in pairs.
Text-fig. 45.
MA
A diagram of a section taken through the centre of the placenta of Acomys. The
maternal channels are not much exaggerated in size, but the fcetal capillaries
are considerably magnified. The trophoblast laver in the region of the foetal
capillaries is not nearly so much attenuated as it should be.
The foetal vessels are dotted, the channels containing maternal blood are white.
The deep black is trophoblast.
AA. Allantoic artery. AV. Allantoic vein. D. Layer of cell-detritus probably
foetal as well as maternal. FC. Fetal capillary. H. Hypoblast of the parietal
wall of the yolk-sac. HH. Hypoblast of the proximal wall of the yolk-sac,
very much folded. L. Lacune in trophoblast containing maternal blood.
M. Muscle-coat of uterus. MA. Maternal artery. MES. Mesoblast of fcetus.
MV. Maternal vem. S. Line along which the placenta had been detached
from the uterus. SP. Splanchnopleur layer of mesoblast. ‘IT. Trophoblast.
TS. Trophospongia. WV. Approximate portion of the main vitelline vessels.
Y. Cavity of the yolk-sac. YC. Blood-vessels of the yolk-sac circulation.
This trophoblastic tissue, which in the figure (text-fig. 45) is
shown as a thick black mass (T), 1s honeycombed by channels
containing maternal blood (LL), which channels become more
broken and more numerous nearer to the fetal surface,
and the trophoblast consequently more attenuated. I think
there are possibly other cavities in the trophoblast-cells which
are not blood-spaces.
This mass of tissue formed entirely of trophoblast and maternal
286 MR. R. ASSHETON ON THE F@TUS AND [June 6,
blood makes up nearly half the thickness of the placenta, and
contains no foetal mesoblast or blood.
The half of the placenta towards the feetal surface is made up
of trophoblast (much attenuated) forming channels filled with
maternal blood, which take a more or less sinuous course, and a
network of fine fatal capillaries, with also the larger vessels and
larger main maternal channels. This is shown diagrammatically
in text- fig. 45, FC, p. 285).
Text- fig. 43 (p. 283) is a drawing of an actual section of a piece
of this region near the maternal surface. The great bulk is made
up of the ‘channels (MCH) excavated in the trophoblast containing
maternal blood. There are many leucocytes (LE), The walls of
these channels are thin, though the large trophoblastic nuclei (T)
are very conspicuous. The feetal capillaries are seen at F.BY.
Nearer to the feetal surface the maternal channels become
finer and the feetal capillaries perhaps rather more numerous.
At places where the main feetal arteries penetrate the tissues of
the placenta, a considerable quantity of foetal mesoblast tissue
accompanies them.
There are a few spherical masses of tissue within this region,
which are not vascular, nor do they seem to be trophoblastic.
They resemble in some respects Duval’s “ilots vésiculeux,” which,
according to him, are pieces of the maternal sub-mucosa which
have become enveloped by the advancing trophoblast layer.
The main features of the vascular systems are fairly easily
determinable.
In this specimen the whole of the maternal arterial blood-
supply arises from a single artery in the centre (MA), which
opens into the large afferent channel which lies partly in the
trophospongial tissue and partly in the trophoblast.
This, like the other main channels, is lined by a flattened
epithelium-like layer, which is probably a pseudo-epithelium of
trophoblastic origin where the wall is trophoblast, and tropho-
spongial origin where the wall is trophospongia.
Duval has described the growth inwards along the maternal
vessels of trophoblast cells to form a pseudo-epithelium. This is
denied by Jenkinson*, who derives the pseudo-epithelium from the
simple flattening of the adjacent cells. This is not a question
which can be decided by reference to a single stage; but I may
say that there is nothing in this specimen which supports in any
way Duval’s account in the mouse.
The afferent channel divides into two main branches, which
diverge and then penetrate straight to the fcetal surface of the
placenta. Here they break up into channels, which take a rather
more sinuous course back again to the middle of the thickness of
the placenta, where they collect into a number of efferent channels
lying near the surface of the trophoblast and ultimately into two
* Jenkinson, J. W., “ Observations on the Histology and Physiology of the Placenta
of the Mouse,” Tijdschr. d. Ned. Dierk. Vereen. DI. vn. 1902.
1905. ] PLACENTA OF THE SPINY MOUSE. 287
large efferent vessels which presumably debouch into two maternal
veins (MV).
These large efferent maternal vessels are more peripheral in
position than the afferent courses.
The fcetal blood-supply is less easily followed. The allantoic
arteries, on reaching the surface of the placenta, radiate and
subdivide and give off branches which pass into the placenta at
intervals over the more central part of the surface. These pass
(as regards the main stream) straight through the fetal half of
the placenta, but give off at frequent intervals small capillaries,
which take a more sinuous and radial course, anastomosing, forming
network, and collecting together again into veins, which I believe
to run parallel with the arteries of the villus.
A considerable amount of connective tissue accompanies these
villi for the first part of their ingress into the placenta.
Comparison with other Placentas.
The placenta is clearly of the type which I have described
elsewhere as cumulate as contrasted with the plicate type
characteristic of such groups as the Ungulates.
The general shape, the arrangement of the membranes and
their character, resemble, according to the interpretation placed
upon them above, the condition that pertains in J/us musculus,
and, rather less closely, that of J/ws decumanus.
Jenkinson has recently given an account of the development of
the placenta of the Mouse, which differs in several important
particulars from that of Duval, which, until that time, had been
generally accepted.
Jenkinson agrees with Duval as regards the general arrangement
of membranes and in the main features of the development.
He differs, however, in respect to the vascular system, and my
account given above is in complete agreement with Jenkinson.
I see also nothing to suggest the appearance of an ingrowth of
the trophoblast into the maternal blood-vessels, and growth along
the inside as described by Duval (“‘ plasmode endovasculaire ”).
Another point of disagreement is with reference to the
glycogenous tissue. Duval takes but little notice of this and does
not seem to have found the maternal glycogenous mass, which,
according to Jenkinson, degenerates, and the space occupied by it
becomes subsequently filled with a second glycogenous tissue
which is of foetal (trophoblastic) origin.
This is a matter of very considerable interest. It is not to be
expected that an isolated case in an allied genus can afford any
conclusive evidence.
Unfortunately the method of preservation (corrosive sublimate)
is not suitable to the study of glycogen.
Tested with iodine I find no trace of glycogen, but there are
certain spaces in the trophoblast cells alluded to in the foregoing
288 ON THE FG@TUS AND PLACENTA OF THE SPINY MOUSE. [June 6,
which may possibly have contained glycogen—so my evidence on
this point is negative.
Along the line which marks the internal limit of the fcetal
mesoblast (that is to say, the limit of the capillary system of the
foetal villi) a deposit of brown pigment occurs. This appears to
be deposited in the walls of the capillaries, by the endothelium.
It occurs nowhere else. Treated with the ferrocyanide test, it
shows no trace of blue colour.
In the detritus in the layer D (text-fig. 45, p. 285) there are
indications of the presence of free iron.
Summary.
To recapitulate my interpretation of the single specimen I
possess. The placenta of Acomys cahirinus is a compound
structure of maternal and feetal tissues in which, excepting the
blood, the feetal tissue largely preponderates.
On the maternal side is a central area of attachment through
which the maternal blood gains access to the placenta. Here
a thin layer of maternal connective tissue surrounds the main
afferent and efferent maternal blood-channels.
Within this region comes a thick layer of tissue probably of
feetal origin (the trophoblast, the cells of which are large, stain
deeply, and have large nuclei), containing intercellular spaces,
which are continuous with the expanded maternal vessels just
named. These spaces are lined by an endothelium, as to the
origin of which I can give noaccount. There is no feetal blood in
this part of the placenta.
These two regions, of which the latter is by far the larger,
make up nearly one half of the whole placenta.
The rest (that is, all towards the foetus) is composed of channels
probably excavated in the trophoblast of the foetus and containing
maternal blood interlacing with much branched tufts of feetal
capillaries containing fcetal blood. These foetal capillaries are
in parts thickly covered with fcetal mesoblastic tissue, but more
often are separated from the maternal blood by their own
endothelium and a single layer of trophoblast only.
The maternal afferent channels penetrate to the feetal surface
before undergoing much subdivision and are more central in
position.
The fcotal afferent vessels tend to penetrate the deeper layers,
but begin to break up nearer to the surface of approach than is
the case with the maternal afferent vessels.
There is no such intimate connection between the yolk-sac and
allantoic placenta as there is in the Rat,
1905. ] ON THE SUPPOSED CLAVICLE OF DIPLODOCUS. 289
9. Remarks on the supposed Clavicle of the Sauropodous
Dinosaur Diplodocus. By Francis, Baron Nopcsa,
EheD
[Received June 6, 1905. ]
(Text-figures 46-49.)
It is still uncertain whether the extinct Dinosauria possessed
clavicles.
Considering the close relationship existing between these
reptiles, the Rhynchocephalians, Parasuchians, and Birds—this
last relationship being shown by the continuous tendency of
Dinosaurs to specialize on most different occasions in bird-like
manner—one is at first naturally imduced to believe that in
Dinosaurs clavicles were present; but, as a matter of fact, bone
after bone supposed to represent this element has had to be
removed from this position.
Hitherto only the family Ornithopodide is known to possess,
in addition to scapula and coracoid, a curious further element in
the shoulder-girdle, which was called clavicula, but may quite as
well form only a part of the sternum (this double element being
in one case united in the middle by bony matter). No other
Saurischian or Orthopodous Dinosaur shows a clavicular ossi-
fication. It is true that in the Sauropoda, besides scapula and
coracoid, one or two flat bones are always present in the scapular
region of the body: these, however, do not represent clavicule,
but may with certainty be determined as ossifications of the
sternum. ‘The discovery, therefore, of what may be called a
supernumerary bone besides the sternal plates in two of the several
Diplodocus skeletons known to science proves to be of quite
exceptional interest.
Hatcher, in his important Monographs of the Diplodocus
skeletons Nos. 84 and 662 of the Carnegie Museum, describes
this element as follows :—“ Throughout the greater portion of its
length it is circular in cross-section, it is bifid at one extremity
and slightly expanded at the other. It is strongly curved,
especially toward the bifid extremity. It is asymmetrical.” In
a more complete specimen (No. 662) than the former (84) it is
‘“‘somewhat expanded and spatulate; the flattened extremity
presents a slightly rugose surface, as though it had been imbedded
in cartilaginous or muscular tissue, and this together with the
bifid nature of the other extremity has suggested the possibility
that the bone might be an os penis.” After the description of
this bone, however, its asymmetry is regarded by this eminent
paleontologist as a weighty argument against its being an os
penis, and therefore its identification with the clavicula is
advocated.
* Communicated by Dr. A. Smita Woopwarp, F.R.S., F.Z.8.
Proc. Zoou. Soc.—1905, Vou. II. No. XIX. ig)
290 - BARON NOPCSA ON THE SUPPOSED [June 6,
According to the figures given by Hatcher and reproduced here
(text-figs. 46 & 47) the bone in question seems to present a great
deal of what might be termed individual variation.
Text-fig. 46.
b
SMUG
Supposed clavicula of Diplodocus, No. 84.
Text-fig. 47.
Same bone of Diplodocus, No. 662.
It seems_to fit fairly well into the shoulder-girdle, but still
1905. | CLAVICLE OF DIPLODOCUS. 291
there are several points to be brought forward against the theory
of its clavicular nature.
Firstly, it must be remembered that in one case this problematical
bone, like the greater part of the skeleton, was displaced and that
in the second skeleton, as pomted out by Dr. Holland, the femur
In consequence of
bears tooth- marks of carnivorous Dinosaurs.
this the relative position of the bone cannot prove anything for
or against its being an os penis; for the penis would be one of the
first parts of the body to become displaced by decomposition and
the first part that would be torn away if carnivorous animals
were gnawing at the dead body.
Text-fig, 48.
"Ny, ca
NUM
COMM ag
Hutte
Wi]
Diagram of penis of Struthio.
Explanation of letters :—c.c., corpus cavernosuin; ¢.f., corpus fibrosum ; c.sk., coarse
skin; g., gutter; gl., glans-like part; im., muscles.
comprised this bone, only one example was present, and this one
In other
appeared to belong to the same side of the body.
Secondly, in each of the two pretty complete skeletons that
specimens of Diplodocus the element was altogether wanting,
292 BARON NOPCSA ON THE SUPPOSED [June 6,
This highly remarkable coincidence suggests the probability that
the bone in question represents an asymmetrical but nevertheless
unpaired organ.
So far as I am aware there is no known reptile, living or
extinct, in which the clavicle is bifurcated at one end. Moreover,
in most terrestrial and aquatic reptiles, when clavicles are present
there is also an interclavicle, which has never been found in
Sauropoda. It must also be remembered that these large
herbivorous Dinosaurs were probably descended from the carni-
vorous Theropoda, which are always destitute of a clavicular
arch,
Text-fig. 49.
Os penis of European Otter.
[ am therefore of opinion that the problematical bone of
Diplodocus in question cannot be a clavicle, and it is necessary
to consider Hatcher’s alternative suggestion that it is an os
penis.
The fact that existing birds and reptiles are destitute of an os
penis does not necessarily imply that gigantic reptiles like
Diplodocus similarly lacked the bone. Among Mammalia it is
well known that the element occurs only sporadically, being
present, for instance, in the Anthropoid Apes and absent in Man.
Among the living reptiles we know two types of genital organs.
The Squamata show what may be called a bifid penis, while the
Crocodilia and Chelonia have the penis simple exteriorly, with a
corpus fibrosum and frequently even a glans penis well developed.
1905. | CLAVICLE OF DIPLODOCUS, 293
In Chelonia the penis sometimes exhibits internally a partially
bifid structure.
For the purpose of this paper the penis of birds is of quite
exceptional interest. In its origin it is not only traceable to the
Crocodilian type, but shows a very great amount of asymmetry, and
besides in the Ratite a distal bifurcation of the corpus fibrosum
(text-fig. 48, p. 291). In Séruthio the distal part of the penis is
changed into a glans-like organ, while in Rhea the corpus fibrosum
consists of an exceedingly hard and nearly cartilaginous substance.
A bifurcation like that observable in the problematical bone of
Diplodocus is also frequently to be met with at the distal end of
the mammalian os penis, which is often asymmetrical. The os penis
of mammals always shows quite remarkable variability. For
comparison with the bone of Diplodocus, side and hind views of
the os penis of the European Otter (Zuéra lutra) are given (in
text-fig. 49, p. 292), and one can see at a glance the well-rounded,
smooth, condyle-like, distal ends, the proximal rugosities, and the
lateral impressions for the attachment of the corpus fibrosum. In
other mammals the corpus fibrosum is not attached laterally to the
ossified element, but ends in a deep pit situated at the proximal
end of the latter.
We have therefore to consider the following propositions :—
(1) That among the Mammalia it is the corpus fibrosum with
which the os penis comes in close contact, forming the anterior
prolongation into the glans penis, that the os penis ossifies from
fibrous matter; that a corpus fibrosum is algo present among
Reptilia, and that therefore an os penis in Dinosaurs can only
have originated from the corpus fibrosum.
(2) That in hea the corpus fibrosum is quite as hard as cartilage,
and differs from this only by not possessing cartilage-cells.
(3) That in Sauropsida a glans is frequently present.
(4) That it is quite a common thing to find bird-like characters
in various parts of the Dinosaurian skeleton.
5) That among the birds the Ratites show the most primitive
and still the best-developed male genital organ.
(6) That the shape and variation of the problematical bone in
Diplodocus are well in accord with its being an os penis, while
they militate against its determination as clavicular.
(7) Lastly, that this so-called clavicula when present is always
found only as an unpaired organ showing the same direction of
curvature.
Hence I am of opinion that it is at present advisable to remove
the subject of this paper from the shoulder-girdle and determine
it as the ossified axis of the penis.
Further evidence and, especially, further discoveries are naturally
necessary before so delicate a question can be regarded as definitely
settled; but since Hatcher's single argument against the bone in
question being an os penis (namely, its asymmetry) breaks down
on reference to Struthio or even to Lwtra, the balance of the
argument is at present in favour of this newer interpretation.
Proc. Zoou. Soc.—1905, Vou. II. No, XX. 20
294 ON THE SUPPOSED CLAVICLE OF DiPLoDocus. [June 6,
~The existence of clavicles in Dinosauria must therefore still be
considered doubtful.
In conclusion, I wish to express my thanks to Mr. Boulenger,
Dr. Forsyth Major, Mr. Pycraft, and Dr. A. 8. Woodward at the
British Museum, and to Professor Stewart and Mr. R. H. Burne
at the Royal College of Surgeons, for their kind help in studying
so intricate a question.
Literatwre.
Gapow & SELENKA.—Birds: Bronn’s Klassen und Ordnungen d.
Thierreiches, vol. vi. part iv.
Gitper.—‘‘ Das Os priapi der Siiugethiere.” | Gegenbauer’s
Morphologisches Jahrbuch, 1891.
Harcupr. — “‘ Diplodocus carnegii.’ Memoirs of Carnegie
Museum, Pittsburg, vol. 1.
——. ‘“Osteology of MHaplocanthosaurus, with Appendix on
Diplodocus.” Loc. cit. vol. 1.
[ Norcsa. |—Critical Review of Hatcher’s Paper on Haplocantho-
saurus. Keilhack’s Geologisches Centralblatt, 1904.
Weser.— Die Saugethiere. Leipzig, 1903.
Wrepersuemm.—-Lehrbuch der vergleichenden Anatomie d.
Wirbelthiere. Leipzig, 1902.
5, On the Anatonry of Limicoline Birds; with special Reference to the Correlation of
6.
Contents (continued).
May 16, 1905 (continued).
: Pave
Modifications. By P. Caaumers Mircnent, M.A., D.Sc. (Oxon.), Secretary to the
Society: «15... BRED STDS Hinrtho > mcde orem Ele SiSis here owe PSIG Geico Welvlelsinrcisisiate cot Lae
Observations upon a Female Specimen of the Hainan Gibbon (Hylobates hainanus),
now living in the Society's Gardens. By R.I. Pocock, ¥.L.S., F.Z.8., Superintendent
PPPOE IoeN eur Biter CEM MLE SVEN (iia wceia say cus ly «ty opealn dialet sy noe Sane SL ha _ 160
June 6, 1905.
The Secretary. Report on the Additions to the Society’s Menagerie during the month of
yi p Y 5 g
Mr.
Mr.
Mr.
Dr.
bo
Ng MISE Se ce es Oe apa gan Eins eee Bea et oe sake g0
Oldfield Thomas, F.R.8. Description of a new Bush-buck (Trag i haywoodt)
RNsmAilarmaR MM MaSt ATTICA a 5:5 6 Alycia e stoselely arse el sua cl eg oS ainke Co eae Se gen tage 180
Oldfield Thomas, F.R.S. -Exhibition of specimens of Mammals and Birds from
Japan and description of a new Marten (Mustela melampus bedfordt) ............ 182
R. I. Pocock, ¥.L.8. Exhibition of a Jamaican Scorpion (Centrurus insulanus)
CAN GevOUmeTOnvItS: Hacky nt vskelseiaie atehc seine «\sta\isha’a a lalallategerate my alcarat evs al obais tebe eels 183
P. Chalmers Mitchell. Notice of a memoir entitled ‘‘On the Intestinal Tract of
JWI aaa ES Spe ie ie tee Re a CR ALG RE ETM ee iD IND SNe mn US 184
. Rough Notes on the Natural History of the Country West of the Victoria Nyanza.
By Lt.-Col. C, Duumn-Rapoutern, M.V.O., B.Z.8. 02... see ieee cree eee eee 184
. The Distribution of Mexican Amphibians and Reptiles. By Hans Gapow, E.R.S.,
. Descriptions of new Reptiles discovered in Mexico by Dr. H. Gadow, F.R.S. By G. A.
IBOUUANGHR EE URuS Eva Asis (babes! Vie dor Vali. )ie se. store anal amereteneierayacnaieiscate tale 245
. On a Collection of Batrachians and Reptiles made in South Africa by Mr. C. H. B.
Grant, and presented to the British Museum by Mr. C.D. Rudd. By G. A.
SCR LONGI SE STU Sts Ver ZS anosaie aoc eu Biena ra aiaccPaca vat’. MyalWaay as onenlaip ft ea stata ue Zao ee a 248
. Some Notes upon the Anatomy of the Yellow-throated Lizard, Gerrhosaurus llavigularis.
Byes Hy Banparp, WR,S:, Prosector to the Society? i... <.haee | iowa te same aoe 256
. On two Points in the Anatomy of the Lacertilian Brain. By F. E. Bepparp, F.RB.S.,
RHOSECEOT LOVGME SOCICL My «leit ake ciliaicial ta aieiaarsnctai Tous tesesiac ch soe payee eee ee SON Mott 267
. On new Coleoptera from South Africa collected by Dr. H. Brauns and others—
Serricornia, Endomychide, Krotylide. By H.8..Gorwam, F.Z8. ........-....0 06 271
. On the Foetus and Placenta of the Spiny Mouse (Acomys cahirinus). By Ricwarp
Assurton, M.A., F.Z.S., Lecturer in Biology in the Medical School of Guy’s ee)
University of London ........ ans als REBUN Ornate le erda eS OG Reno p oe pote 280
. Remarks on the supposed Clavicle of the Sauropodous Dinosaur Déiplodocus. By
RAR OLS, ARON: NOTOSA:)EIRSED Ste cuuss clase aincew ciety nce retire Gt” a) Siaioa aes MRE see. 289
LIST OF PLATES,
1905.—_VOL. II.
PART
' Plate Page
DN OLA TR PIL COMLOILL Was «c/erorutslc le eeioy ele teiattia cia sicher =e (eles eit eae iaie taeets 3
TI. Osteology of the Hurylemide ..........-. 20... cere cece ene 30
TIL.) skulle of Rhinolophi ...00+.0+0e0eceren Pry 825 75
V. Hylobates hainanus .........+ ‘el caches gencaen. aie 4 a(t ear 169
VI. 1. Anolis gadovii. 2. Anolis ogaster 1.0.0. sere cece ss caes \ 2455
VII. 1. Sceloporus gadovie. 2. Leptodira guillent .......+++..+.06
NOTICE.
‘The ‘ Proceedings’ for the year are issued in fowr parts, forming two volumes,
as follows:—
VOD.
Part I. containing papers read in January and February, in June.
ia i & », March and April, in August.
VOL. II. 7
Part I. containing papers read in May and June, in October.
10 RS “Ns »» | November and December, in April.
‘ Proceedings,’ 1905, Vol. I. Part II. was published on August 10th, 1905.
The Abstracts of the papers read at the Scientific Meetings in
May and June are contained in this Part.
PROCEEDINGS
OF THE
GENERAL MEETINGS FOR SCIENTIFIC BUSINESS
OF THE
ZOOLOGICAL SOCIETY
OF LONDON.
1905, vol. II.
PARL IT;
CONTAINING PAPERS READ IN
NOVEMBER ann DECEMBER.
APRIL 1906.
PRINTED FOR THE SOCIETY,:
SOLD AT THEIR HOUSE IN HANOVER SQUARE.
LONDON :
MESSRS. LONGMANS, GREEN, AND ae
PATERNOSTER-ROW. Aa
{Price Twelve Shillings.) 4
seme
LIST OF CONTENTS
1905 Noe ae
Part II. sv hae i
November 14, 1905. :
Page
- The Seer ae Repcrt on the Additions to the Society’s Menagerie Ae the months of
Jane, July, August, September, andi@ctober 90D 2.0 il citi slm ate taveee sllergnenstens » ) 2o8
Col. W. H. Broun. Exhibition of mounted heads of a White Woterbnck and two
HUMGOCETOSAS > cosicvis cle = niv.oceia.a = 00: sicvminpdm caval Blete/e.a\oceein a a'o nelle telel nus a tae lel at 296
The Hon. Walter Rothschild, F.Z.S. Exhibition of specimens of a rare Marsupial
CDG CLULOP SIG PAUPALOT) wc, viola nine o:0\e'nin sinlale/'s e's sient) « e'oie'hr)s cain ale els oct eae OG
The Hon. Walter Rothschild, F.Z.S. Exhibition of two tusks from Abyssinia ......-... 297
Mr. A. 8. Hirst, F.Z.8. Exhibition of microscopic preparations of a new H:emosporidian
(Hallieridiune Crumeniti) rau 2cccjeice eimlals «0 m+ ota savin genes + baie ene ele See 297
_ Dr. Walter Kidd, F.Z.8S. Exhibition of lantern-slides illustrating the Papillary Ridges
iniMfammals .... see seSc 2 Sn de, Sule nth Ot. Aah cng aie 297
Dr. P. L. Sclater, F.R.S. Letter from Mr. W. Rodier on the Rabbit-pest in Australia .. 298
Mr, Henry Scherren, F.Z.8. Exhibition of lantern-slides of, and remarks upon, old pictures
of Anthropoid Apes a Sle aa lejnise vousteyers ese teiblcatatenose eave sce s) ale .evensy tees te eter eafeic lle cee ee 295
. On a Collection of Mammals brought home by the Tibet Frontier Commissian: By
J. imwis Bonnors, MyA., FLL.S.{cB.Z.8. sich eg cieels\aielehals o melinte ai inate ae 2 802
i
2. Notes on the Geographical Distribution of the Okapi. By Dr. ae Léxnsera, C.M.Z.8. 309
8 Notes on the Goral found in Burma. By Major G. H. Evans wer ois lofhoe aerate eta 811
4. On the Mammals of Orete. By Dorotnua M. A. Bate ... 2.02... -2 eee e eee eee ee olo
November 28, 1905.
Mr. J. T. Cunningham, M.A., F.2Z.S. Exhibition of photographs of, and rematle upon, a°
horse bearing horn-like structures .. 1... 2: ee esse ees erect eeees Prana hos duis 323
Mr. Frank Slade, F.Z.8. Exhibition of photographs of a Sea-Anemone in the process of .
PLAT STO Tbe ey oaks LARS ok Gatitne ra Toduyie iotevocelearel aib Ua eiale (tekele Cleeecs ol tye lelescjele: ofeicas ene aetna » 894
Mr. Douglas English. Exhibition of an albino Field-Vole ...--...s+..e+-s sees eeeeee 324
Mr. G. A. Boulenger, F.R.S. Exhibition of, and remarks upon, a melanistic specimen of
the Wall-Lizard........-- Oa HE hehe beet eee eee rere cece reser ene eeeeceee 324
Capt. Albert Pam, F.ZS. Remarks upon a living specimen of the Violet-cheeked
Humming-bird 2.0.2.5. cece ce cece ee eee te ect e cet e ene sid areteenteeer a) ‘signe aoe
Mr. W. RB. Ogilvie-Grant, F.Z.8. Exhibition of a series of bird-skins from ee . 824
1. Colour Evolution in Guereza Monkeys. By R. Lypekker ..........++..--.. kate atte - 220
2 The White-maned Serow.. By R. Lyprxxer. (Plate VELL) its, eam “829
3. The Duke of Bedford’s Zoological Exploration in Eastern Asia.—I. List of Mammo
obtained by Mr. M. P. Anderson in Japan. By Ouprizup Tuomas, F.R.S. (Plate IX.) 331
4. A Revision of the Fishes of the sn! Galaxtide. By ©. TatE Rzean, B. A., E.Z.S.
(Plates X.~XTIL.) 2... 000. cee ee ee reece eee ee eee eee ee ee erect eee ee cc aa ee 363 ©
5. The Mammalian Fauna of China.—Part I. Murine. By J. Lewis Bonnorn, M.A.,F.L.8. 384
6. Descriptions of new Species of Phytophagous Coleoptera of the Genera Homopheta,
Asphera, and Oedionychis. By Martin Jacosy, F.E.S. (Plates XIV. & XV.) .. 398, 591
. Some Additions to the Knowledge of the Anatomy, principally of the Vascular System,
of Hatteria, Crocodilus, and certain Jacertilia. By Frank a Bepparp, M.A,, F.R.S.,
Prosector to the Society -..-..-++-+sscsens POO OD OO oa Samia ene ol We ceauE SG 461 |
Contents continued on page 3 of Wrapper.
S
1905. | THE SECRETARY ON ADDITIONS TO THER MENAGERIE. 295
November 14, 1905.
G. A. BouLenGceEr, Esq., F.R.S., Vice-President,
im the Chair.
The Secretary read the following reports on the additions that
had been made to the Society’s Menagerie during the months of
June, July, August, September, and Ogistban. 1905 :—
The number of registered additions to the Society’s Menagerie
during the month of June was 321. Of these 57 were acquired
by presentation, 53 by birth, 14 by purchase, 195 were received on
deposit and 2 in exchange. The number of departures during
the same period, by death and removals, was 178.
Among the additions special attention may be called to :—
1. An Orang-utan (Sima satyrus) from Deli, Sumatra, presented
by Dr. J. C. Graham on June 25th.
2. A Wolt’s Monkey (Cercopithecus wwolfi) from the Congo,
deposited on June 26th.
3. Eleven Kiwis (Apterya mantelli) from the North Island,
New Zealand, seven being presented by the Government of New
Zealand and Mr. H. C. Wilkie, F.Z.S8., on June 26th, and four
by the Earl of Ranfurly, H.M.Z.S., on the same date. The
Society is specially indebted to Mr. H. C. Wilkie, in whose care
these Kiwis were successfully brought from New Zealand.
The number of registered additions to the Society's Menagerie
during the month of July was 274. Of these 96 were acquired by
presentation and 17 by purchase, 92 were received on deposit,
1 by exchange, and 68 were bred in the Menagerie. The number
of departures during the same period, by death and removals,
was 184.
nee the additions special attention may be called to :—
nN enna Leopard (Felis purdus) from near Hong Kong,
pr ee, by My. J. A. Bullin on July 26th.
2. Three Californian Sea-Lions (Otari wa gulespu) from Santa
Barbara, purchased on July 11th.
3. A White-tailed Gnu (Connochetes gw) born in the Menagerie
on July 25th.
4, A male Somali Ostrich (Struthio molybdophanes) from
Se aaa purchased on July 14th.
A Collection of Birds from British Guiana, including examples
of ie species new to the Collection, presented by Mr. K. W.
Harper, F.Z.8., on July 31st.
The number of registered additions to the Society's Menagerie
during the month of ‘Aug ust was 348. Of these 108 were acquired
by presentation and 37 by purchase, 66 were born in the Gardens,
103 were received on deposit and 34 by exchange. The number
of departures durmg the same period, by sleet and removals,
was 255.
Proc. Zoou. Soc.—1905, Vou. Il. No. XX. 21
296 A WHITE WATERBUCK AND HEADS OF RHINOCEROS. [ Noy. 14,
Among the additions special attention may be called to :—
1, ASilky Marmoset (//apale chrysoleucos) from Brazil, deposited
on Aug. 30th.
2. A pair of West-African Marsh-Bucks (Limnotragus gratus)
from the Congo, purchased on Aug. 31st.
3. A Spot-billed Toucanet (Selenidera maculirostris) from Santos,
purchased on Aug. 19th.
4. A Black-and-White Cobra (Vata melanolewca) from West
Africa, deposited on Aug. 31st.
The number of registered additions to the Society’s Menagerie
during the month of September was 313. Of these 106 were acquired
by presentation, 26 by purchase, 124 were received on deposit,
15 by exchange, and 42 were bred in the Gardens. The number
of departures during the same period, by death and removals,
was 245,
Among the additions special attention may be called to :—
1. A male Orang-utan (Simia satyrus) from Sumatra, presented
by Mr. H. N. Ridley on Sept. 7th.
2. Five Talapoin Guenons (Cercopithecus talapoin) trom Ubanghi,
Upper Congo, deposited on Sept. 19th & 21st.
3. A Jaguarondi (felis jaguarondt) from 8. America, purchased
on Sept. 11th.
4, A Binturong (Aretictis binturong) from Singapore, presented
by Mr. H. N. Ridley on Sept. 7th.
5. A White-tailed Sea-Hagle (/aliaétus albicilia) from the
Arctic, presented by the Duke of Orleans, F.Z.8., on Sept. 30th.
6. A Knob-nosed Lizard (Lyriocephalus scutatus) from Ceylon,
presented by Mi. E. Ernest Green, F.E.S., on Sept. 26th.
The registered additions to the Society's Menagerie during the
month of October were 232 in number. Of these 74 were
acquired by presentation and 79 by purchase, 3 were born in the
Gardens, 53 were received on deposit and 23 in exchange. The
total number of departures during the same period, by death and
removals, was 216.
Among the additions special attention may be called to :—
1. A White Oryx (Oryx leucoryx) frem Arabia, presented by
Col. R. J. Seallon, C.B., D.S.O., on Oct. 30th.
2. A Cave-Rat (ZThryonomys swinderianus), a Bouvier’s Owl
(Scotopelia bowvieri) (new to the Collection), and a Beautiful Wood-
Hawk (Dryotriorchis spectabilis), from Lagos, presented by Dr. W.
F. Macfarlane, F.Z.S., on Oct. 13th.
3. Three Antillean Boas (Boa diviniloqua) from St. Lucia,
West Indies, presented by the Hon. KE. G. Bennett, K.C., on
Oct. 28th.
Col. W. H. Broun exhibited a mounted head and skin of a
White Waterbuck (Aobus ellipsiprymnus) and two mounted heads
1905. | DR. WALTER KIDD ON PAPILLARY RIDGES IN MAMMALS. 297
of Rhinoceros (/thinoceros bicornis), and made the following
remarks :—
“The White Waterbuck was shot in July 1904 on the right
bank of the Guaso Nyiro river, about 20 miles west of the en ian
Swamp, British Hast Africa, lat. 1° N., alt. above sea 1000 feet.
A white doe was alone with the buck. The ordinary Waterbuck
seen there were all examples of Kobus ellipsiprymnus. The eyes
of this buck were of the normal colour, not pink.
“Of the two Rhinoceroses, one was a female and earried two
normal and two rudimentary horns. She was shot in August
1904, in dense covert, west of the Jambeni Mountains north-east
of Mount Kenia, at an elevation of 4150 feet above the sea. It
was not seen till after death what an imteresting animal she was.
One of the rudimentary horns was between the ears and the other
about 4 inches further back.
“The other individual was a male, and was shot in September
1904 north of Aberdare range, British East Africa; height above
sea 9600 feet. The anterior horn showed abnormal growth due
either to an old injury or excessive wearing away of the outer
surface from the tip downwards.”
The Hon. Walter Rothschild, F.Z.S., exhibited specimens of a
very rare and interesting Marsupial, hitherto unique, in the Paris
Museum, viz. Dactylopsila palpator Miulne-Edw., which differed
from D. trivirgata in possessing an extremely thin, prolonged,
second finger.
Mr. Rothschild also exhibited two tusks which had been
obtained by Baron Maurice de Rothschild during his recent
expedition to Abyssinia. ‘They were so unlike the normal tusks
of any known animal, that Mi. Rothschild was of opinion that
they might belong to some new form.
Mr. A. S, Hirst, F.Z.8., exhibited microscopic preparations of
anew Hemosporidian from the blood of an African Stork (Lepto-
ptilus crumeniferus). He poimted out that this parasite belonged
to the genus Halteridium, but differed from H. danilewskyi in its
ereater size (Stade moyen 7—10,;), and also in its method of
sporulation, in which the merozoites were more numerous,
smaller, and arranged in a ball-like rounded mass. The name
Halteridium crumenium was proposed for the new species.
Dr. Walter Kidd, F.Z.8., read a paper, illustrated by lantern-
slides, ‘On the Papillary Ridges in Mammals, chiefly Primates.”
The arrangements of the ridges on the hand and foot of 24
species were shown and described, and their functions discussed.
Arguments were brought forward to show that their primary
function was to increase the delicacy of the sense of touch.
21%
298 MR. H. SCHERREN ON OLD | Nov. 14,
Dr. P. L. Sclater, F.R.S., read a letter addressed to him by
Mr. Wilham Rodier, dated Tambua Station, Cobar, New South
Wales, June 29th, 1905, in which it was stated that Mr. Rodier’s
plan for combating the Rabbit-pest (‘ Nature,’ March 21st, 1889)
was still proving a ‘wonderful success.” As there had been
some good rains in the district the feed at Tambua was “ splendid,
right up to the boundary netting-fence,” but on the other side
there was “absolute starvation,” owing to the great numbers of
rabbits. This summer, in Mr. Rodier’s opinion, would see the
surrounding district quite ‘“‘eaten out” by the rabbits, which
were there in millions, but were easily kept down at Tambua by
his plan.
Mr. Rodier’s plan, which was very simple, might be shortly
described as follows :—Ferrets and nets are employed to catch the
vabbits alive in the usual way, but while all the females captured
are destroyed, the males are turned out uninjured. The results
are that the male rabbits, so soon as they begin to predominate in
numbers, persecute the females with their attentions and prevent
them from breeding. They also kill the young rabbits, and, as
Mr. Rodier declares, “ worry the remaining does to death.”
My. Henry Scherven, F.Z.8., exhibited two lantern-slides of old
pictures of Anthropoid Apes, and made the following remarks on
the Satyrus indicus of Tulpius (text-fig. 50) :—
There appeared to be in Dapper (‘ Beschreibung von Afrika,’
Amsterdam, 1670, p. 393) an early reference to a Gorilla. No
figure was given, but the description, though of course inexact,
seemed to fit the Gorilla better than the Chimpanzee, especially
with regard to erect progression *, the folk-story of carrying off
and ravishing women, and the supposed human origin. The
passage 1s as follows :—
“Hier [Quoja, north of Fernando Po] wird auch ein Tier
gefunden, welches die Einwohner Quojas-Morrow oder Worow
und die Portugallier Salvage dass ist ein Waldmann nennen.
Es hat emen grossen Kopf, dicken Leib, fleischichte Arme, damit
es in Ringen sehr starck ist, aber gantz keen Schwantz; und
gehet zuweilen mit ausgerecktem gerade Leibe auf den Hinter-
fiissen allen wie die Affen zuweilen auf allen vieren langst der
Erde. Die Schwartzen sagen dass es von Menschen entsprossen ;
aber durch das wilde Leben im Busche zum halben unverniinft-
igen Tiere sei worden. Diese Tiere leben vom wilde Honige
und die Friichten in den Biischen : auch fechten sie fort und fort
nuit emander. Ja, sie diirfen nicht allein die Frauen ergreifen
und nohtziichtigen, sondern auch die gewafnete Minner selbsten
anfallen.”
In December 1904 the Hon. Walter Rothschild, M.P., laid
hefore the Society a valuable paper, entitled ‘ Notes on Anthiyo-
poid Apes”, and exhibited what was undoubtedly the finest
* R. I. Pocock, P. Z.S. 1905, vol. ii. p. 178.
7 P. ZS. 1904, vol. i. pp. 413-440.
1905. ] PICTURES OF ANTHROPOID APES. 299
collection of mounted specimens, skeletons, and skulls ever
brought together. In his paper Mr. Rothschild spoke of the
Satyrus indicus Tulp., and identified it with Simia satyrus Linn.,
claiming that the latter name must now be applied to a Chim-
panzee—to quote his exact words, “the famous ‘Tschego’ proves
to be the veritable Simia satyrus.”
Text-fig. 50.
The Satyrus indicus of Tulpius.
Mr. Scherren then quoted the following description by Tulpius
300 MR. H. SCHERREN ON OLD [| Nov. 14,
of the anthropoid presented at the end of the seventeenth century
.to Prince Frederick Henry of Orange :—
“ Quamvis extra forum anecHiean, attexam tamen huic tele
Satyrum Indicum; nostra memoria ex Angola delatum: et
Frederico Henrico Arausionensium Principi, dono datum. Erat
autem hic Satyrus quadrupes: sed ab humana specie, quam prez
se fert, vocatur Indis orang-outang: sive homo sylvestris, uti
Africanis quoias morrou. Exprimens longitudine puerum trimum,
ut crassitie sexennem.
‘““Corpore erat nec obeso nec gracili, sed quadrato habilissimo
tamen, ac pernicissimo. Artubus verd tam strictis et musculisaded
vastis: ut quidvis & auderet et posset. Anterius undique glaber :
at pone hirsutus, ac nigris crinibus obsitus. Facies mentiebatur
hominem: sed nares sime, & adunce, rugosam, et edentulam
anum.
“ Aures vero nihil discrepare, ab humana forma. Uti neque
pectus; ornatum utrimque mamma. pretumida (erat enim sexus
foamini) venter habebat umbilicum profundiorem ; et artus, cum
superiores, tum inferiores tam exactam cum homine similitudi-
nem, ut vix ovum ovo videris similius.
“Nec cubito defuit requisita commissura: nec manibus digi-
torum ordo: neque pollici figura. humana: vel cruribus sure, v vel
pedi ealcis fulerum. Que concinna, ac decens membrorum fomine
in caussa fuit, quod multoties incederet erectus : neque attolleret
minus gravate quam transferret facile, qualecunque gravissimi
oneris pondus.
“ Bibiturus prehendebat canthari ansam, manu altera ; alteram
vero vasis fundo supponens, abstergebat deide madorem labiis
relictum, non minus adposite ac si delicatissimum vidisses
aulicum. Quam eandem dexteritatem observabat utique eubitum
iturus. Tbaclitieame quippe caput in pulvinar, & corpus stragulis
convenienter operiens, velabat se haud aliter, ac si vel mollissimus
illic decubuisset homo.
“ Quin imo narravit aliquando affini nostro, Samueli Blomartio,
Rex Sambacensis, Satyros hosce, preesertim mares, in Insula
Borneo, tantam habere animi confidentiam, & tam validam
musculorum compagem: ut non semel impetum fecerint, in viros
armatos, nedum in imbellem, foeminarem, puellarumve sexum.
“Quarum interdum tam ardenti flagrant desiderio : ut raptas
non semel constuprarint. Summeé quippe in Venerem sunt pro-
clives (quod ipsis, cum libidinosis veterum Satyris commune)
immo interdum adeo pr otervi ac salaces: ut mulieres Indice
propterea vitent cane pejus et angue saltus ac lustra, in quibus
delitescunt impucica heee animalia.”
Mr. Scherren called attention to the discrepancy between the
Linnean diagnosis of Simia satyrus and the description of Tulpius
with respect to form and size. Linneus wrote: “ Magnitudine
puerl sexennis,” which differed widely from the words of Tulpius :
“ Exprimens longitudine puerum trimum, ut crassitie sexennem.”
It was also suggested that the expression ‘“‘ corpore quadrato ”
suited a Gorilla rather than a Chimpanzee, and confirmation was
1905. } PICTURES OF ANTHROPOID APES. 301
sought in the pictures by Wolf of Wombwell’s Gorilla (from a
daguerreotype) and a Chimpanzee from life which hung in the
meeting-room. Sir Harry Johnston * had seen a reproduction of
Tulpius’s figure in Tyson’s work on the Chimpanzee (London,
Text-fig. 51.
TM TTS
SS SSSESS=
Karly figure of Chimpanzee, from Astley’s ‘ Travels.’
1699), and was struck by its resemblance to a Gorilla. Another
picture (text-fig. 51) (with label, of which the following is a
translation :—“ Chimpanzee, 21 months old, brought from Angola,
* P. Z.S. 1905, vol. i. p. 72.
302 MR. J. L, BONHOTE ON MAMMALS FROM TIBET, [| Noy. 14,
in 1738, 2 ft. 4 in. high”) was thrown on the screen to prove that
as early. as 1746 the Satyr us mdicus was recognised as differing
from the Chimpanzee. This picture was said £0 have been taken
from life.
It was usually said that the existence of an African anthropoid
other than the Chimpanzee was not known till about the middle
of the last century. This was not the opinion of J. E. Gray ; for
ata scientific meeting of this Society *, in calling attention to
Wombwell’s Gorilla, he alluded, but without quotation, to
Bowdich’s ‘ Mission to Ashantee’” (London, 1819), where the
“ African Orang (Pithecus Troglodites)” was compared with the
Ingena.
The following papers were read :—
On a Collection of Mammals brought home by the Tibet
Frontier Commission. By J. Lewis Bonnorr, M.A.,
abuses I /AgSi
[ Received August 9, 1905. |
(Text-figures 52 & 53.)
The collection: of mammals brought home by the Tibet
Mission, and collected by Capt. H. J. Walton of the Indian Medical
Service, although not large in numbers contains several specimens
of great interest, and there can be no doubt but that the region
is full of mammalian treasures, only waiting time and opportunity
for their discovery.
Of the eight species of which examples were brought back, two,
Microtus waltoni and Cricetulus lama, ave new to science, while
the large red Fox of the country is sufficiently distinct to be
entitled to subspecifie rank. In addition to these, I have been
enabled for the first time to examine the skull of another Fox,
Vulpes ferrilatus, described 63 years ago, but of which the skull-
characters have hitherto remained entirely unknown, This skull
shows features of great peculiarity, and proves the validity of
Jerrilatus as a species, a matter hitherto considered doubtful by
some writers.
In addition to the specimens collected by Capt. Walton, the
British Museum is indebted to Col. Waddell for two or three skins,
an account of which has also been incorporated in this paper.
FELIs MANUL Pall.
Felis manul, Pall. Reise Russ. Reichs, ii p. 692 (1776);
Blanf. Faun. Br. Ind., Mamm. p. 83 (1891).
* P.Z.S. 1861, p. 278.
+ [The complete account of the new forms described in this communication appears
here; but since the names and preliminary diagnoses were published in the
‘ Abstract,’ the former are distinguished by being underlined.—Hp1Tor. |
TA sketch- -map giving all the localities j in which this collection was procured is
published j in ‘The Ibis’ (1905, p. 57, pl. u.).
1905. | MR, J. L, BONHOVTE ON MAMMALS FROM TIBET. 303
a. 6. Yamdok Lake, alt. 15,000’, 28th Sept., 1904.
This specimen, the only one procured, was brought home by
Col. Waddell.
VV ULPES VULPES WADDELLI.
Vulpes vulpes waddelli Bonhote, Abstr. P.Z.S. No. 22, p. 14,
Novy. 21, 1905.
a. Khamba Jong, alt. 16,400’, 8th Oct., 1903
6b. Phari Jong, Upper Chumhi Valley, 11th Jam., 1904 (coll.
Waddell).
General colour above reddish fulvous, the median dorsal area
from the occiput to the root of the tail being bright red, shading
to pale buff on the flanks and hindquarters. The head rufous :
the ears moderately large and pointed, bemg clothed with long
white hairs on the inside and short black ones externally. Feet
rufous along their margins and white or grey in the centre.
Tail long, woolly, and very bushy, tipped w ith white; each hair
being pale fulvous at its base, ath a long, bing terminal
portion. Underparts pure white.
The skill does not show any special characters by which it may
be distinguished from that of the typical form. It is stout and
well built, being short and broad in the muzzle and rather swollen
in front of the orbits, but otherwise it shows no features of note.
Dimensions of type (in flesh). Head and body 25 in. ; tail 16 in.;
hind foot 6in. Height at shoulder 14°75 in. Weight 8 lbs.
Skull. Greatest length 145 mm.; zygomatic breadth 72; width
in line with ant. root of pm. 4, 37-5. (Further skull-dimensions
are given under the next species.)
Habitat. Khamba Jong, Tibet, alt. 16,400".
Type. B.M. 5.4.6.1. Collected 8th October, 1903, by Capt.
Walton.
This race may be readily distinguished from V. v. flavescens by
its much brighter coloration throughout, and especially by the
deep red median dorsal area. In the true flavescens the back is
much more uniform in colour, the median dorsal area being but
very slightly darker than the surrounding parts and of a more
brownish yellow, the red tint being entirely lacking.
The local name is ‘“* Wamo.”
VULPES FERRILATUS (Hodgs.).
Vulpes ferrilatus Hodgs. J. A.S. B. xi. p. 278, pl.; Blanford,
Fauna Br. Ind., Mamm. p. 155 (1891); Mivart, Mon. Can. p: 121
(1890).
a. Karo-La Pass, alt. 16,600’, 30 miles E. of Gyangtse.
The only specimen procured is a typical example of V. ferrilatus,
but in very bad fur. This species may always be recognised by
the underfur, which, besides being close and woolly, is fulvous to
the base. The peculiar and woolly character of the fur through-
out is quite sufficient to distinguish it from all other species.
304 MR. J. L, BONHOTE ON MAMMALS FROM 11BET. [| Nov. 14,
Capt. Walton writes :—‘‘The small fox does not, I feel pretty
sure, occur near Khamba Jong, all the foxes seen there being of
the large species (V. v. waddelli, ante). I saw other foxes almost
certainly of this species between Karo-La and the neighbourhood
of the Yam Dok Cho (Lake Palti).”
Accompanying the skin is a very fine adult skull (text-fig. 52),
which, so far as I am aware, has never before been described.
This skull is quite unlike that of any other species of Fox, and is
characterised by the extreme slenderness and elongation of the
muzzle and the great length of the upper canines. The brain-case
Text-fig. 52.
Rows
é coher
AUS (he orld
ae AGS
A, lateral, and B, upper view of the skull of Vulpes ferrilatus. % nat. size.
and zygomata, on the other hand, do not show any signs of lateral
compression or elongation, but are fairly normal in their dimen-
sions and breadth. The supraorbital processes are stout and well
developed, and the brain-case gradually widens out from imme-
diately behind these processes and reaches its greatest breadth in
line with the posterior roots of the zygomata. On the under side
we may note the narrowness of the soft palate and the tendency of
the pterygoids to approach each other posteriorly. The bull are
more elongated and less rounded than usual. The dentition, which
1905. | MR. J. L. BONHOTE ON MAMMALS FROM TIBET. 305
is normal, except for the great length of the canines already noted,
alls for but little comment. The spaces between the pr eniolars
are large in correlation with the length of the muzzle, and the
first upper molar is relatively small.
Dimensions :—
V. fervilatus. V.v. waddelli.
mm. mim.
Cueasest lemel teco-ccs fe sede c cers 155 145
Basalblen cular yan tas. 2 ate eee eee eet 138 130
JeeN eral) lieimead Bes Hoe eeanspacorsnddsovoec 78 al
Length from post. end of palate to
bastocenpitall Were ee eencats.s-eaueecseee 60 59
Length from last incisor to ant. root
of Ist premolar (alveoli) ............ iS) 16
Length of premolar series ............ 48 39
Br eadth of brain-case immediately
behind supraorbitals.................. 26 23
Greatest breadth of brain-case......... 5O°D AO
Ax comeasicy Wr endl eye ses-ceeeen tes 84 12
Breadth of muzzle at ant. root of
ai NOW OVRELTOO) EW, | NAGAR eek ABA Recs de saene 19 23
Length of upper canine along its
AVMTeTNOIe TaN ACAD snanedabAnasounees 29 20
This comparison of dimensions will show more clearly than any
description the main features in which this skull differs from that
of the more typical “ Volpes”; and in spite of the doubt of
Mivart * there can be no question that ferrilatus not only Is a
good species, but is more differentiated than any other species in
the region.
The only other skull of ferrilatus known is a very young one
collected by Mi. Hodgson ; it is, however, too young to show any
of the specific characters enumerated above.
Purortrus ALPINUS (Gebler).
Mustela alpina Gebler, Mém. Soc. Lnp. Nat. Moscou, vi. p. 213
(1823).
Putorius alpinus Blantord, Faun. Br. Ind., Mamm. p. 168
(1891),
a. 6 ad. (in spirit). Gyangtse, alt. 12,900’, 1904.
6. 3. Khamba Jong, alt. 15,500, 11th Sept., 1904.
CRICETULUS LAMA.
Cricetulus lama Bonhote, Abstr. P. Z.8. No. 22, p. 14, Nov. 21,
1905.
a. gad. Lhasa (skinned from spirit).
6. g ad. Lhasa (in spirit).
The Cricetulus referred tor as ‘the little white mouse” is
* Loe. eit. ante. + Percival Landon: Tibet,’ App. by H. J. Walton (1905).
306 MR. J. L. BONHOTE ON MAMMALS FROM TIBET. | Nov. 14,
represented in the collection by two spirit-specimens, one of
which has since been skinned. It appears, although closely
related to Cricetulus pheeus, to have been hitherto undescribed.
Size about that of C. pheus. General colour above pale fulvous
erey, greyer than in C. pheus.
Kach hair is slate-grey at its base, fulvous for about 3 of its
distal end and with a black tip. Over the head and fore part of
the body the fulvous portion of each hair is the more conspicuous,
but on the hinder part of the back the dark tips predominate and
a faint dark median dorsal line may be traced. The underparts
are pure white, the hairs being slate-grey at their base. The line
of demarcation between the upper and under parts, although
abrupt, is very uneven in outline. The feet are but scantily
clothed with hair and are white. The tail is moderately long
and stout, well clothed with dark brown hairs above and white
haus below ; the tip is white.
The whiskers are for the most part black with a white tip,
some shorter ones, however, being entirely white.
The skull resembles somewhat “closely that of O. pheus, but is
slightly larger and the brain-case more inflated and rounder.
The chief points of difference, when viewed from below, are the
ereater width of the basioceipital and the much flatter and smaller
bullae in the new species. Above there is a slight, although very
constant, difference in the hinder margin of the parietals, which
are practically straight in outline; whereas in C. pheews there is a
sharp turn backwards when about two-thirds of their length from
the middle line.
Dimensions (of type when in spirit). Head and body 87 mm. ;
tail 40; hind foot 17; ear 16.
Skull. Greatest length 28°5 mm.; basal length 24; palatal
leneth from henselion 12; interorbital breadth 5; greatest
breadth of brain-case 12°5; width of basioccipital at anterior end
of auditory bull 3.
Habitat. Lhasa, Tibet.
Type. B.M. 5.4.6.4. Collected at Lhasa, Tibet, by Capt. H.
J. Walton, I.M.S.
The darker colour of the hinder part of the back combined
with the general much greyer coloration, and in addition the
somewhat longer and stouter tail, form characters by which this
species may be distinguished from C. pheus. The animal, ac-
cording to Capt. Walton, was extremely common, and was
swarming in one of the shrines of the Jo Khang Cathedral at
Lhasa.
Microtus (PHAIOMYS) WALTON.
Microtus (Phaiomys) waltoni Bonhote, Abstr. P.Z.S. No. 22,
p. 14, Nov. 21, 1905.
a. 2 ad. Lhasa, Tibet.
Slightly smaller in size than Ph, blythi, to which it is by skull-
1905. | MR. J. L. BONHOTE ON MAMMALS FROM TIBET. 307
characters closely allied, though widely differmg in colour.
General appearance above fulvous grey, slightly greyer over the
anterior part of the body; below very pale buff. Each hair is
slate-grey from its base and for the greater part of its length,
with a fulvous subterminal portion and dark tip. On either side,
between the limbs, the dark tips are absent, leaving a clear fulvous
patch. Interspersed in the fur are a few thin black bristles.
The feet ave whitish, both palms and soles are 5-tuberculate. The
tail is bicolor. The ears small and sparsely covered with hairs
similar in colour to those on the rest of the body. Mamie eight
in number, four pectoral and four inguinal.
Skull. The dental characters are practically identical with those
of Ph, blythi. The skull itself is very similar in general outline,
but slightly smaller; this is especially noticeable in the bulle,
Text-fig. 53.
A, upper, and B, lower right molar series of Microtus waltoni.
which do not stand out so prominently from the rest of the
cranium.
Dimensions of type (fvom spirit), Head and body 98 imm. ;
tail 30; hind foot 17; ear 10:5.
Skull. Greatest length 28 mm.; basilar length 24:5; zygomatic
breadth 16°5; interorbital breadth 4; length of nasals 7; dia-
stema 8°2; palatal length 15; length of molar series (text-fig. 53)
(alveolt) 7.
Habitat. Lhasa, Tibet.
Type. B.M. 5.4.6.5. 2 ad. Collected by Capt. H. J. Walton,
1. M.S.
This interesting species cannot well be confused with any other,
308 MR. J. L. BONHOTE ON MAMMALS FROM TIBET. | Noy. 14,
as the skull-characters clearly prove it to belong to the subgenus
Phaiomys, and its colour is quite unlike any of the other species
of that group.
Lepus orostotus Hodgs.
Lepus otostolus Hodgson, J. A.8. B. ix. p. 1186 (1840) ; Blan-
ford, Faun. Br. Ind., Mamm. p- 452 (1891).
a. WKhamba Jong, Oct. 1903.
Apparently the common Hare of Tibet, two more skins having
been brought home by Col. Waddell. Capt. Walton states that
this hare, which, as a rule, avoids cultivated land and frequents
bare and rocky hillsides, was very common at Khamba Jong and
also at Tuna at the hand of the Chumbi Valley. It was, however,
much scarcer, although still occurring, between Gyangtse and
Lhasa.
OcHOTONA CURZONLE (Hodgs.).
Lagomys curzonie Hodgs. (nec Stoliczka) J.A.S. B. xxvi.
p- 207 (1858) ; Blanford, Faun. Br. Ind., Mamm. p. ABT (1891);
es P.Z.S. 1904, vol. 1. p. 214.
a 2. Yamdok Lake, 14,800’, 29th Sept., 1904.
b,c. No particulars
d. Ad. imspuit. Tuna.
The specimen from the Yamdok Lake had evidently just
assumed its new winter pelage, the other two skins being in old
and worn fur. Tuna, where the spirit-specimen was pr ocured, is
only a few miles north of the Chumbi Valley, the type locality of
the species.
Capt. Walton writes of this species :—“ They are exceedingly
common at Khamba Jong, Tuna, and in all the open bare country
from Tuna to Gyangtse, as well as between Gyangtse and Lhasa.
They, however, become less common as one approaches Lhasa,
probably because the country is more cultivated. They ayer
cultivated fields for the most part, and were always commonest in
bare sandy country. They do not hibernate at ‘all, and on any
sunny day i in the middle of winter they might be seen sunning
themselves at the entrance to their burrows. I dug up a few
burrows during the winter. The tunnel runs more or less
vertically downwards for 1 or 2 feet and then somewhat hori-
zontally for 4 to 6 feet. The passage is dilated at irregular
intervals in some two or three places. At these spots and at
the end of the burrow, which is also dilated, there is a certain
amount of coarse grass collected to form a kind of nest. The
ground in many places i is honeycombed with these burrows, which
sometimes communicate with one another close to the OUthe but
as a rule they are quite distinct. I never heard the animal utter
a ery of any sort.”
1905.| ON THE GEOGRAPHICAL DISTRIBUTION OF THE OKAPI. 309
2. Notes on the Geographical Distribution of the Okapi.
By Dr. E1yar Loénnpere, C.M.Z.8.
[Received August 28, 1905. |
I have had the pleasure recently of meeting my compatriot
Lieutenant Karl Eriksson, who delivered to Sir Harry Johnston
the first skull and skin of the Okapi. I took this opportunity of
asking Lieutenant Eriksson about the distribution of this remark-
able animal, and his reply was that he believed it to be distributed
practically over the whole of the “ equatorial forest” of the
Congo Free State. He showed me on the map of the Congo
basin appended to Mr. Boulenger’s work, ‘ Les Poissons du Bassin
du Congo’ *, the approximate limits of this area of distribution.
Tf we begin at the River Ubangi in the west about midway
between Mobena and Jmese, from there the limit extends north-
east towards Businga at the River Likame or somewhat north of
that place, and then more east to the River Uele just before it
joins the River Ubangi. From that place and eastward the
River Uele is the northern limit to a point about midway
between Amadi and Suruaugo. From there it turns south-east,
passing somewhat east of Mawambi, and continuing to a point a
little west of Karimi. Not much south of this, the most eastern
point of the great forest, the boundary-line turns westward
again and crosses the great Congo River at Ponthierville, and
continues westward a little south of Tschuapa River, but bends
by-and-by a little north, so that it passes on the northern side
of Bolondo towards Coquilhatville. It is evident that this is
only a rough outline of the area of distribution of the Okapi, but
it may hold good in a general way.
Outside this boundary-line there are many forest-clad areas,
but they are not extensive, and Lieutenant Eriksson does not
believe that they are inhabited by the Okapi. It is an in-
habitant of the great forest, but does not live everywhere in it.
Tts regular pasture-grounds are open glades in the forest, where
rivulets with shallow water expand and produce a rich growth of
grass. This grass and the leaves of the bushes and undergrowth
under the trees, which are especially luxuriant in such places, may
form the principal food of the Okapi. Although a shallow sheet
of water expands over the very flat ground to greater or less
extent in these glades, there are noswamps. ‘The soil is hard and
firm 7, which explains the shape of the hoofs of the animal.
Lieutenant Eriksson has not seen the Okapi in a living state in
its natural surroundings, as probably no white man ever has or is
likely to do. But he has, while on his marches during the night,
* Bruxelles, 1901.
+ Because gravel or hard red earth lies quite near the surface.
310 ON THE GEOGRAPHICAL DISTRIBUTION OF THE OKAPT. [ Nov. 14,
many a time heard it run away when he passed such glades as
described above.
The Okapi is extremely wary and shy, and nocturnal in its habits,
It lives singly or perhaps in pairs, never in herds. The negroes
know very little about it, and, as a rule, it is only the Wambutti-
dwarfs who ave able to kill it. These dwarfs are perhaps the
most perfect of all hunting tribes and steal up near the animals,
slaying them with spears.
How little the negroes (not counting the dwarfs) know about
the Okapi, may be concluded from the following ridiculous tale told
and believed by them. They have observed that the Okapi is very
cleanly, and even during the rainy season, when almost all other
animals are more or less dirty, its skin is justas clean as ever. The
negroes say then that the Okapi climbs up in the trees (!) to keep
itself clean and to avoid the dirty muddy soil.
I have used the name Okapi as that is the one known to the
zoological world, and has become the nomen triviale of this
interesting mammal. Lieutenant Eriksson informs me, however,
that it was only a mere chance that it happened so. Okapi (with
long-drawn a) is only used by the Wambobba tribe for signifying
this animal. ‘The Wambobba language is hardly spoken by more
than 300 persons, but it was Wambutti- dwarts, living in harmony
with Wambobbas and speaking their language * , that brought the
first remains of the Okapi, hence the name. (The first complete
specimens were procured by another tribe of Wambuttis belonging
to Wabira negroes, which use another name mentioned below.)
But it is still worse, because the word ‘ Okapi” means simply in
the Wambobba language cs donkey ” or “ass.” Strictly speaking,
therefore, the latinised “ Okapia,” which became the second and
permanent scientific generic name of this mammal, is not much
better with regard to its original meaning than the first generic
term “* Equus,” applied before anything but a piece of skin was
known.
The name by which the Okapi is known in most of the Congo
languages 1s ‘* Dumba.”
Tam glad to be able to add that the Okapi is protected by law,
-so that it is forbidden to kill it without special permission.
The Wambutti-dwarfs and the leopards do not, however, respect
any laws, and therein lies the danger for the existence of this
animal.
Lieutenant Eriksson has also told me that in the great forest a
kind of black wild hog is to be found, which may be the recently
deseribed Hylocherus meinertahagent. These hogs are called by
the negroes ‘ n’gulube bibi,” which means “ black hog,” whilst
“youlube” = hog is the name of the common Red River-Hog
(Potamochwrus porcus).
* The Wambuttis always use the language of those negro tribes with which they
live in symbiosis, and from which they obtain vegetables. for meat and honey from
the forest.
1905. | ON THE GORAL FOUND IN BURMA, 311
3. Notes on the Goral found in Burma.
By Major G. H. Evans *.
[Received September 2, 19085. |
The Himalayan range in Assam gives off a succession of spurs
southward to form a tract of mountainous and, in many parts,
almost impassable country extending into Arakan and Burma,
and inhabited by numerous wild tribes. That portion of this
tract lying between Assam and Manipur to the north, Chittagong
and Tipperah on the west, Arakan on the south, and Burma on
the east, is now known as the Chin-Lushai Hills. These so-called
hills vary in their altitude from 1000 to 10,000 feet.
T was employed in what was known as the Southern Chin Hills
from November till June 1889-90, and during my stay visited
several Chin villages. Like many others who have visited these
people, I came to the conclusion that Chins generally, and their
chiefs in particular, have one hobby at least, viz., collecting skulls.
Outside and inside the villages, skulls were to be seen stuck on
posts or kept in the houses. The finest collection I met with was
in the house of a Boungshé chief, whose tribe is thus called by the
Burmans, from the method in which they dress their long hair.
The whole hair is done up ina large knot placed well forward on
the top of the head, almost on the forehead, and round this ball
of hair is wound, round and round, usually a white turban with
a blue stripe through the centre. In the chief’s house was a
collection of skulls, excellent as regards the number and variety.
The heads ranged from those of elephants to palm-civets, and I
doubt if there are many museums which could excel the collection
of monkey skulls, at least numerically. The chief enjoyed the
reputation of having been a mighty Nimrod in his youth, and I
was informed that he had shot practically every head in the
collection. I noticed one splendid gaur skull, three or four fine
mythun or gayal, several sambar and serow, also some small heads
which I concluded must be goral. Game throughout the hills was
scarce, a matter not to be wondered at, inasmuch as every Chin
had a gun of some sort, and in addition was always trapping and
snaring. I was assured that the Goral heads had been obtained
in the hills, but that now the animals were very scarce. I had
no opportunity of verifying at this time the presence of Goral in
these hills, and any attempt to do so would have been a matter
of considerable risk owing to the most unfriendly attitude of the
people. Many months later I happened to be in a Burmese
village some hundred miles distant, but on the confines of the
South Chin Hills, and there discovered in a house the skull of a
Goral identical with those above mentioned. On enquiry from the
Burmans I learned that it had been obtained from some Chinbéks,
another tribe of Chins near Loungshé in the Yaw country. As
* Communicated by R. LypEKKER, F.Z.S.
Proc. Zoou. Soc.—1905, Vou. II. No. XXII.
bo
bo
312 MAJOR G. H. EVANS ON THE | Nov. 14,
the Burmans dare not venture into Chin-land, they could afford
no definite information beyond that the Chins had told them that
there were several of these animals on a certain high mountain
now known as Mount Victoria. Since then several Goral have
been shot there by policemen on outpost and others.
During the season of 1896-97 I visited the Arakan Hill-tracts,
which are merely a southern continuation of the Chin Hills into
the Akyab district of Arakan. Here again I came on askull and
a skin (the latter in a very bad state of preservation) of this Goral.
This animal, from the horns evidently a female, was shot in the
hills at a place not very far distant, and local informants said that
there were a fair number. Being unable to visit the place at
that time, I told a friend of the ground, and asked him to find
out if what I had heard was correct. He did so, and came
across some six animals, of which he shot a couple. One of these,
owing to the ground, it was impossible to recover. I sent a skull
for identification, and was informed that it was a Himalayan
Goral. I was unacquainted with the Indian Goral, but from the
descriptions in books I was not quite satisfied that it was the
same animal. Later on, while after Serow in the Shan range of
hills to the east of the Inrawaddy, I was much surprised again
to run across these animals. I was still more convinced that
the beast was not the same as the Indian Goral, so much so,
that I asked a friend to shoot an Indian Goral and send me a
head and skin, which he very kindly did. On comparison my
suspicions were confirmed. J was then most desirous to procure a
specimen for the British Museum, but luck was against me, as it
was a long time before I ran across them again.
The following are the chief characteristics of these Goral :—
General oie. —Goat-like with sturdy lmbs. Horns are
present in both sexes: those of the female are shorter, thinner,
and not so rough as those of the male. They are generally almost
parallel, 7. e. only shghtly divergent, and have a slightly backward
eurve. The coat is moderately long, close, and the hair rather
coarse ; there is generally a well-marked underfur. The mammee
are four in number.
General colowr—A dark, more or less rat-grey, with an
admixture of longish, dark, rufous-tipped hairs running through
the coat, but mostly on back and upper surface of body. In an
old buck the back, haunches, and upper portions of sides were
dark pepper-and- salt ox evizzled grey. Ina young specimen the
colour was generally lighter. There is no distinct dorsal stripe :
in a young animal a very faint but distinct brownish line was
traceable, extending from the nape to the dock, and in the skin
of a female also, when held in a good light, a darker brownish
median line could be discerned. The colour fades gradually on
the side to a dirty reddish white under the abdomen. The colour
about the back of the neck isa lighter grey than that of the body,
and the hair is longer. A distinct crest of longer hair of
blackish-brown colour extends from between horns to behind the
1905. ] GORAL FOUND IN BURMA. 313
ears. The hair surrounding base of horns is also long and of a
rufous tint.
The face is ruddy brown, passing into grey on the cheeks, and
to a fainter and almost whitish colour around the eyes and lips.
The throat is a yellowish white. The hair on the outer surface of
the ears is rufous; whitish on the inner surface. The mufile is
black in colour and naked. The tail is black or brownish black,
and has a tuft of long hair of varying length. The colour of the
iris 1s reddish brown.
The Limbs: Fore legs—Outer aspect a dark brown or yellowish
ved to just above the knees, and this colour is continued on the
posterior aspect of lower limb to hoofs. The anterior aspect from
below the knees, or in some cases just above the knees, 1s a
yellowish white.
Hind legs.—Outer aspect of thigh brownish, the posterior aspect
of the hocks dark brown, continuing down posterior aspect of lower
limb. The anterior aspect below the hocks is a dirty white.
Horns.—Short, black in colour, conical, irregularly ringed,
especially at the base in males. The annular markings extend
for about three quarters of the total length on the posterior aspect
of the horn; they appear to be rubbed off in front. The horns
are set close, and in some cases are almost parallel. For the first
inch or so from the base they are straight, then curved slightly
backwards, and are slightly divergent towards the tips.
Measurements of Horns.
iL, 2. 3. 4. 5.
| i inches. | inches. | inches. | inches. | inches.
Right horn ....... vl 5 | 4 ae BE i al
| | |
Left horn ........... v2 Az 4 | L 38 | 3 (broken)
ee 23 Peal dae e> | ares 23
Between horn-cores | 4 3 E i
Between points .........) 22 13 oF 2
Dimensions.
3. ©.
inches. inches.
eiehtrat; Shoulders sce. cheen oe naoa cau 2 tOnZ a ONtORA
Girth behind shoulder ........................ 294 PATE
teniethy tom) nese tortalllyeee tease eee DOs 50
Tail: average of five specimens............... 41
Tuft: average of five specimens ............ 23
Tcenethiol carsisy cette ee thee i eds 32 to 43
Wemetiot Meadye recta me tee cee ae 102 10
TByRSAGH Eli AGIROSS OIA OWES Goo accseccascenccdadceddous 4 37 to037
Jere OCH ANOTAOIS. Gan neooosdodacooes oe cuonsdaesoons 5 4a
Girtheotelronnshcn cen aeerrcs fen cen wnaeanies 2. to.22 2
22%
314 ON THE GORAL FOUND IN BURMA. [Nov. 14,
Distribution.—So far as is at present known to me, in the
localities noted, and at elevations above 3500 feet. These Goral
appear to be rather localised, and I should say are uncommon, It
is reasonable to expect, however, that when a more intimate
knowledge of the higher ranges is gained, the distribution of
these animals may be found to be more extensive.
These Goral, I believe, extend into Siam and are to be found in
suitable places on the Siamese side of the Thaungyin River, and
also occur, but are more scarce, about the hills at the headwaters
of the Me-Ping.
Habits—As has been recorded in the case of the Indian
form, these Goral live in parties of four, six, or even a dozen.
They inhabit very steep ground and the more precipitous it is the
better they seem to like it. They are never to be found at any
distance from rugged, rocky ground, even though there may be
forest near by. The only time they may be found away from
dangerous ground is during the early hours of the morning and
late in the evening, when they g graze on the grassy patches close
by. No doubt when the sky is ‘overcast, as is the case during the
rains, or in the cold weather when there is a heavy mist, they feed
much later. Apparently they are inclined to remain always about
any tavourite locality. Their sight seems to be extraordinarily
good, and they appear to rely more on this sense than on smell or
hearing. The day is usually passed lying on inaccessible ledges
of rock about precipices.
If a Goral is startled it Jumps up and makes a short: sharp
hissing or sneezing noise, very often repeated at short intervals.
It may be a note ‘of alas or a call to its mates, for as Sure as
one calls, if there are any others about (and this is generally the
ease), 1t 1s immediately answer ed. In Burma, at least, these Goats
are not easily followed, unless by expert cragsmen; and in this
category I do not include myself.
Goral, when standing about these crags, afford fairly easy
shots with high-velocity rifles, but the recovery of a carcase is, as
a rule, by no means an easy matter. The shikaris and followers
are generally anything but keen on a trip down one of these
precipices, and I for one do not blame them, Though they may
be adepts in woodcraft, they cannot be anything like the cragsmen
(hill-shikaris) met with in the Himalayas. Goral-flesh is not at all
bad, From December till May is the best season to hunt these
animals, and morning and evening is the best time to find them,
as they are then grazing or lying down in places more accessible.
I sent specimens of the skin &e. of this Goral to Mr. Lydekker,
by whom the animal has been named after myself, Urotragus
evanst.
I have to thank Captains Blakeway and Wood, R.E., and
Mr. W. B. Tydd, of the Burma Civil Service, for their kindness in
helping me in this matter,
Rangoon, Ist June, 1905.
1905. | ON THE MAMMALS OF CRETE. old
4, On the Mammals of Crete. By DororHEea M. A. BATE*.
( Received September 6, 1905. |
The following list of the wild mammals known to inhabit Crete
is based on a small collection made in the island during a stay of
four and a half months in the earlier part of last year (1904)
This includes only sixteen species, but it is quite possible that a
species of Crocidwra may have to be added to the number, for
remains of a Shrew were found in more than one Pleistocene
cave-deposit in the western part of the island, and it is not
unlikely that it may yet survive. It is probable that a Roedeer
still existed in the island during the earliest historical times.
Four species seem to be here recorded for the first time from this
locality ; these are Rhinolophus ferrum-equinum, R. hipposideros,
Micromys sylwaticus hayi, and Acomys dimudiatus minous.
In his work on Crete ¢ published in 1869, M. V. Raulin gives
a list of thirteen species, amongst which is included the Polecat as
well as the Beech-Marten and Weasel; however, no specimens
appear to have been obtained, so that their occurrence may have
been admitted on insufficient evidence or as the result of some
confusion with regard to the other members of the group.
Admiral Spratt t, in describing the country between Kremopoli
and Palaikastro, mentions that Foxes occur there; but this was
doubtless a slip, for elsewhere (vol. ii. p. 157), in reference to the
safety of the flocks of sheep, he says that ‘ Crete has no wild
animals but badger and weasels or martens.” Dr, Lorenz-
Liburnau has written at some length on the Wild Goat of Crete ;
and in 1903 Major Barrett-Hamilton described the Hare, and
noticed the Badger and Beech-Marten, at the same time remark-
ing on the paleness of the specimens from this locality. The
same may be said of the Cretan Hedgehog and Rabbit, but is not
the case with the Weasel and Spiny Mouse, which are both richly
coloured forms.
Crete has, in all probability, been isolated as an island for a
considerable period, therefore it is not surprising to find that
there are a number of localised forms amongst the Mammalia.
Admiral Spratt, whose valuable researches were carried on in so
many parts of the Mediterranean, was of opinion § that Crete was
connected in earlier times with Europe (including Asia Minor),
and not with the north coast of Africa as tradition would have
us suppose ||. Suess §[ would also seem to link this island rather
with the northern than the southern boundaries of the Medi-
terranean, The mammalian fauna, as well as the recent land-
* Communicated by OLrprreLp THomas, F.Z.S.
+ Description Physique de I’ Ile de Créte, 2 vols., Paris, 1869.
£ Travels and Researches in Crete, 2 vols., London, 1868 (vol. 1. p. 205).
§ Op. cit. vol. 11. pp. 408-10.
|| Ibid. pp. 278-9.
© la Face de la Terre, vol. 11. p. 713.
316 MISS D. M. A. BATE ON THE [Nov. 14,
shells, of the island shows a decided preponderance of Kuropean
types; the only suggestion of a North-African relationship bemg
found in the Wild Cat and perhaps the Spiny Mouse.
J should like to take this opportunity to express my thanks to
Mr. Oldfield Thomas, who has again most courteously g given me
every facility for working out my collection in his depar tment of
the British Museum (Natural History).
List of Species.
1. RuINOLOPHUS FERRUM-EQUINUM Schreb.
In the latter part of March three large Horseshoe Bats were
secured in a cave close to the sea, on the north-west coast of the
island.
RHINOLOPHUS HIPPOSIDEROS Bechst.
Only one specimen of this Bat was obtained, from a cave in the
hills south of Khania. Neither this nor the above mentioned
species appears to have been previously recorded from Crete.
3. Myoris Myoris (Bechst.).
When visiting the extraordinary underground quarry known
as the Labyrinth, near Haghia Dekka in the south of the island,
one of the galleries was found to be tenanted by hundreds of
Bats belonging to this species. They were hanging from the
roof in large clusters and became very noisy when approached.
Four specimens were preserved, and these appear to be somewhat
smaller than examples from the Continent. These underground
galleries have evidently been inhabited by this species of Bat for
many hundreds of years; their occurrence in the “ Labyrinth”
was noticed by Tournefort as early as about 1700*.
4, MINIOPTERUS SCHREIBERSI (Natt.).
Two examples of this species were also procured, and several
others observed, in the so-called Labyrinth. These, however,
occurred singly, and in galleries other than those occupied by
Myotis myotis.
5, KRINACEUS EUROPUS NESIOTES, subsp. n.
On comparing the three specimens obtained of the Cretan
Hedgehog, these were found to differ from all the forms of
E. europeus represented in the British Museum collection ;
therefore this island race may be given subspecific rank.
In external characters it seems to most closely resemble
E. e. italicus Bary.-Ham.t, from which it may be distinguished
by its slightly smaller size, dingy appearance, and the lighter
* See Raulin, op. cit. vol. ii. p. 1033.
+ Annu. Mag. "Nat. Hist. ser. 7, vol. v. April 1900, p. 364.
1905. | MAMMALS OF GRETE, 317
colour of the fur. In one specimen (No, 17) this is almost pure
white except on the face, hands, and feet. The spines are shorter
and more slender, whilst both the short and long hair of the under-
parts is much secantier.
The following measurements (in millims.) were taken in the
flesh :—
Head Tail. Hind Ear. Basal length
and body. foot. of skull.
(oa) (Gyre) eeeeee 208 29 AQ) 29 51-5
INCRE AN (COD) SMe tans eee sits 34 37 28°5 A8
Ione), sate ee NG aye BS OE 5 BOE
The skull differs from that of 1. e. italicus, and resembles that of
EL. 2. roumanicus Barr.-Ham.* in having the frontal processes of
the premaxille squared posteriorly, and further these only extend
backward for less than half the length of the nasals.
Jn Crete, Hedgehogs are common in the low country, but were
not met with in the hills. In captivity they will eat oats freely
as well as a more natural diet of eggs ce.
6. FELIS OCREATAYT AGRIUS, subsp. n.
This species is the chief exception to the general European
appearance of the mammalian fauna of the island, being unmis-
takably African in type and belonging to the Felis ocreata group.
The two specimens obtained were bought, at different times, in
the bazaar at Khania, and therefore are unaccompanied by any
measurements taken in the flesh, though they appear to have
been large and robust. In one of these, No. 35, the type, which
is in summer coat, the average length of fur on the back is about
32 mm., while in the other, No. 36, evidently a winter specimen,
the fur is much thicker and longer, averaging 45 mm. in length
on the back, and there is at the same time a corresponding
difference in the intensity of the markings of the dorsal region.
The Cretan race may be distinguished from specimens froni
Abyssinia, the type locality, and Egypt, by their much more
distinctly marked stripes, both longitudinal and transverse, and
by the greater number of rings, or half-rings, on the tail, which
is short. As Mr. de Winton has mentioned$, these markings of
the dorsal region are more distinct in short-coated specimens ;
and on comparing them it is found that even the /ong-haired
Cretan skin is more strongly marked than short-haired ones from
Abyssinia and Egypt in the British Museum collection, The
same holds good in the case of a short-haired specimen from
Machakos (B.M. 92.12.3.2.), which otherwise somewhat closely
resembles the skin in winter pelage from Crete. It may also
be mentioned that some specimens from Abyssinia show a
* Op. cit. p. 365.
+ For use of this specific name see Mr. H. Schwann, “On Felis ocreata and its
Subspecies,’ Ann. Mag. Nat. Hist. ser. 7, vol. xi. June 1904, pp. 421-2.
From @ypeus, a hunter.
Zoology of Egypt (Anderson), London, 1902, p. 173.
Me
318 MISS D. M. A. BATE ON THE | Nov. 14,
tendency towards a sandy colouring ; this is especially noticeable
in a skin from Zoulla (B.M. 69.10.24.9.), in which the trans-
verse dorsal bars are much broken up, causing a somewhat
‘“‘ spotty ” appearance.
In the specimens from Crete the proximal portion of the fur is
decidedly dark over almost the entire body ; this feature is hardly
noticeable in those from Abyssinia, and is not so strongly marked
in the examples examined from Egypt. The increased richness
in colour of the Cretan race is no doubt chiefly due to climatic
influences : a still further divergence in this particular direction
is exemplified by the wild cat, /. 0. sarda Lataste, from the more
westerly island of Sardinia.
Hybrids between /. 0. agrius and the domestic cat of the island
appear to be not uncommon, and this can easily be accounted for
by the fact that formerly small villages were often totally deserted
for a considerable time, or possibly entirely, during the insur-
rections which occur so frequently in Crete, when the cats, as
well as the villagers, are forced to take to a life in the hills.
Skins of these hybrids, which are generally of large size like the
true wild race, may often be seen hanging up in the bazaars at
Khania and Candia,
fF. 0. agrius was recorded by Raulin* as F’. catus.
7. MELES MELES MEDITERRANEUS Barr.-Ham. *
Only two immature specimens of this Badger were obtained ;
these came from an earth in a rocky mound, on the crown of
which is perched one of the several monasteries of the Lassethe
Plain.
The local name for the Badger is “ Arkalos” (épxados); it is
plentiful in the island, and is killed in some numbers by the
natives, the richer of whom use the skins for saddle-cloths and
for making into purses &e.
8. MusrELA FOINA BUNITES{, subsp. n.
Five skins of the Cretan Beech-Marten were obtained, and
have been carefully compared with those of MW. f. lewcolachnea
Blanf., from Turkestan, with which two specimens from Crete,
already in the British Museum collection, were formerly iden-
tified§. However, the examples from these two localities are
found to differ considerably and to be easily distinguishable ;
therefore it is proposed that the island form be known by the
above-given subspecifie name.
In length and woolliness of coat J. f. bunites is intermediate
between the typical M. foina and M. f. lewcolachnea, though in
general appearance it most closely resembles the latter. From
this it differs in its much duller and more uniform colouring,
* Op. cit. vol. ii. p. 1038.
y+ Ann. Mag. Nat. Hist. ser. 7, vol. iv. pp. 383-4.
£ From Bovrirns, a dweller on hills.
§ Ann. Mag. Nat. Hist. ser. 7, vol. iv. Nov. 1899, p. 313.
1905. | MAMMALS OF CRETE. 319
which is paitly caused by the slighter contrast between the upper
and under fur and by the lack of any gloss on the brown hairs,
particularly on the paws and tail. The tail is very much less
bushy and the fur shorter, in one specimen having an average
length on the back of 25-26 mm., while in a skin from Vernoé,
Turkestan (B.M. 83.4.21.2.), it is about 43 mm. The size and
shape of the throat-patch seem to be even more variable in the
Cretan race than it is in others; in one example of the former
(No. 31) it is represented by only a few white hairs on either side
of the throat close to the fore legs. The following measurements
of the type (No. 34) were taken in the flesh :—
Head and kody 403 mm., tail 255, hind foot 79, ear 39. The
basal length of the skull is 75 mim., and the zygomatic breadth
58 mm.
It is perhaps worth noting that MW. /. bunites also has much
closer and shorter fur and a less bushy tail than the type of
M. f. mediterranea Bary.-Ham.*, from Andalucia, from which it
further differs in colour.
The Beech-Marten is common in the island, both in the low
ground and in the hills, where it is known to occur at Katharo,
between 3000 and 4000 feet, though probably its range extends
to a much greater height than this. It is killed in some numbers
by the peasants, who bring the skins to the larger port-towns on
the north coast, whence they are exported, chiefly to Trieste.
The Cretans call this Marten “ Zouridha” (Zoupiéa), by which
name it is also known in the neighbouring island of Karpathos’.
9. PUTORIUS NIVALIS GALINTHIAS, subsp. n.
Only two specimens, without skulls or measurements taken in
the flesh, were obtained of this Weasel, which is of large size.
These I have been unable to identify with any one of the several
races of Putorius nivalis represented in the collection of the
British Museum. Therefore it seems necessary to regard it as
a local form, which I propose to name after the mythological
character changed into a weasel by the Moere and Ilithyie at
the time of the buth of Herakles t
It was somewhat unexpected to find that, among all the material
which I have been able to examine, this island race most closely
resembles in general appearance the type (the only specimen in
the British Museum collection) of P. 7. atlas Barr.-Ham.§, from
the Atlas Mountains, Morocco. Also there seems to be no ap-
preciable difference in size between these two subspecies, which
are amongst the largest of those belonging to the group of
Weasels in which the colours of the upper and under surfaces
are sharply divided.
* Ann. Mag. Nat. Hist. ser. 7, vol. i. June 1898, p. 442.
+ “ Karpathos.” Etude géologique &c. Prof. C. de Stefani, Dr. C. I. Forsyth
Major, and W. Barbey. Lausanne, 1895, p. 70.
a Ibid. p. 65.
§ Ann. Mee Nat. Hist. ser. 7, vol. xiii. April 1904, p. 323.
320 MISS D. M. A. BATE ON THE [ Nov. 14,
Considering the great distance by which the habitats of these
two forms are separated, and that a number of other races occupy
the intervening and neighbouring countries, the only plausible
explanation of such a remarkable likeness seems to be that in this
we havea striking case of similar characteristics independently
acquired. This does not seem so improbable when it is remem-
bered that among the Weasels variation acts only within very
narrow limits; the chief points in which differences occur bemg
in size, in the line of separation between the two colours, and in
the presence and amount of white on the upper surfaces of the
paws. In connection with the Cretan form it may be suggested
that its large size is, at any rate partly, due to prolonged isolation
in a locality where food is plentiful and competition not keen,
owing to the absence of Stoats m the island.
P. n. galinthias may be distinguished from P. . atlas by its
richer colouring and in having only a scarcely perceptible “pencil”
of darker hairs at the tip of the tail, which in one of the dried
specimens measures 89 mm. exclusive of the terminal hairs.
P.n. sicule Barv.-Ham.*, although differing from these species
in size and colouring, agrees with them not only in the well-
defined line of separation of the colours along the flanks, but also
in having white on the upper surfaces of the hind as well as the
fore paws.
The colour of the under side in one of the skins from Crete
(No. 33, ¢) is dirty white; while in the larger of the two (No. 15),
the type, probably an old male, this colour is washed with buftish
yellow. The “ white” extends im a narrow line along the upper
lips to the base of the nose.
This Weasel is common and frequently abroad in the daytime,
when it may be seen running along the loosely-built stone dykes
which are a noticeable feature of many parts of the country,
being built for the purpose of ridding the ground of some of the
overwhelming number of stones with which it is cumbered. It
probably feeds largely on the lizards of various kinds that
abound in the island: one day in an olive-grove at Phaestos a
weasel was seen to spring out of some thick undergrowth at the
edge of a stream and seize a large green lizard (Lacerta viridis
major Blgr.), which, on becoming aware of my presence, it
hurriedly carried off in its mouth.
It is known to the natives by different names in different parts
of the island: in the west it is called ‘“ Kalajannou,” in the east
“ Sinteknaria” (currecvdapea 7), and in the Lassethe Mountains a
modification of the former term which I neglected to make a note
of at the time.
10. Mus rarrus Linn.
This Rat is found in the port-towns on the northern coast, but
* Ann. Mag. Nat. Hist. ser. 7, vol. v. Jan. 1900, p. 46.
+ “eadoouytexvapta, according to Dr. Forsyth Major, op. cit. p. 63.
1905. } MAMMALS OF CRETE. 321
no specimens were obtained in the country, although traps were
frequently set for them in several localities. It is probably owing
to the occurrence in considerable numbers of a weasel that this
rat has not spread and increased in the interior of the island as it
has already done in Cyprus.
11. Mus muscuxus Linn.
This species like the last does not, so far as I am aware, occur
beyond the limits of the larger towns. In connection with the
restricted range of this Mouse, it is interesting to note that a form
of Micromys sylvaticus is abundant in the island.
12. Mircromys syLyaricus HAyI (Waterh.).
Of all the subspecies of J/. sylvaticus recognised by Major
Barrett-Hamilton in his paper published in 1900*, the specimens
from Crete seem to agree most closely with J/. s. hayi, though they
are, if anything, slightly smaller. In colouring they cannot be
distinguished from the darker examples of a series from Cintra,
Portugal, in the British Museum collection. None of the Cretan
skins shows any sign of a band of colour across the white of the
throat. The following are the maximum and minimum measure-
ments of the six specimens preserved ;—
Head and body 80-88 mim., tail 86—89°5, hind foot 21-22, ear
16-17 ; total length of skull 25-26.
This Mouse, which appears not to have been previously recorded
from Crete, is plentiful in the island and easily trapped. ‘Two
specimens, one of which (No. 11) is very dark, were caught not
far from Khania in rocky ground close to some patches of culti-
vated land; the remaining four are from Katharo, a small valley
in the Lassethe Mountains nearly 4000 feet above sea-level.
15. ACOMYS DIMIDIATUS MINOUS T, subsp. n.
The Cretan Spiny Mouse, a richly coloured form with fairly
large ears and tail equalling or exceeding in length the head and
body, i is evidently closely allied to 4. iniidiat ae It may be dis-
tinguished from examples of this species in the British Museum
collection from the vicinity of Aden, and one (somewhat faded)
from Sinai, the typical locality, by the very restricted area
occupied by the spines, which are exceptionally fine and have an
average length of about 10°5 mm. Further, these are pigmented
for a greater distance from the tip (about 45 mm.), which gives
the spmous region a more richly coloured appearance owing to
the proximal and semi-transparent portions of the spines “not
showing on the surface. The colours of the upper and under
surfaces do not intergrade, the line of separation along the flanks
being very sharply defined.
* “On Mus sylvaticus and its Allies,’ P.Z.S. 1900, p. 387.
+ “Minotis”’ was employed by the early poets as equivalent to Cretan.
322 ON THE MAMMALS OF CRETE. [ Noy. 14,
The following measurements (in millimetres) of the three speci-
mens pr eserved were taken in the flesh :-—
Skull.
aS
Head
fy Foeotic
Sri adie Tail lind footae Wang ee eters
length. breadth.
Nome er ae ie ey). as
No. 12(d) ...... Cae ce tet 15
VF
No. 16 (9, PEC NT wote Dalila Wels gen 19:5 ane Tees
of subspecies.) |
The threespecimens obtained were trapped in the same locality —
in rocky ground close to cultivated land between Khania and
Suda. It was not known to any of the natives questioned on the
subject. This discovery of an Acomys in Crete is interesting,
being an extension, in a somewhat unexpected direction, of the
recorded range of the genus.
14. Lepus EUROP2US CRETICUS Barr.-Ham.
This Hare was described in 1903 by Major Barrett-Hamilton*
but as no measurements accompanied the four skins received by
him, the following dimensions of a single example (a ¢), taken
in the flesh, may be of interest :—
Head and body 514 mm., hind foot 123, ear 102. The basal
length of the skull is 71 mm.
Hares are found all over the island, even near the summit of
Mount Ida, which attains a height of over 8000 feet, where
Admiral Spratt mentions having disturbed a number out of
their ‘‘ forms” in the open snow. The same author remarks that
those seen on Mount Ida “seemed to be a smaller species than
the Hare of the lowlands.” Unfortunately no specimens were
obtained from this locality, so that this observation still awaits
confirmation.
Of late a close season has been instituted in the island, and the
Hare is among the number of species so protected. It was
recorded by Raulin = under the name of Z. timidus.
15. ORYCTOLAGUS CUNICULUS CNOSssIUS §, subsp. n.
This Rabbit is paler and decidedly more uniformly grey in
colour than the typical form; this lightness is partly caused
by the paleness of the reddish area on the back of the neck, which
more or less affects the greater part of the dorsal region, and
further by the absence of a markedly dark ring between the
smoky grey of the proximal portion of the hairs and the sub-
terminal light band.
In the one specimen preserved (a 2), which lived for some
months in the Zoological Society’s Gardens, the hind paws are
* Ann. Mag. Nat. Hist. ser. 7, vol. x1. Jan. 1903, p. 126.
+ Op. cit. vol. 1. p. 13.
t Op. cit.
§ “Cnossius ” was employed by the early poets as equivalent to Cretan
1905. ] ON A HORSE BEARING HORN-LIKE STRUCTURES. 323
almost entirely white, and its dimensions, taken in the flesh, are
as follows :—
Head and body 341 mim., tail 65, hind foot 82, ear 70; weight
2 lbs. #0z. The skull’s greatest length 75 mm., basal length 57:5.
It seems curious that this Rabbit does not occur on the main-
land of Crete, and I have found no record of its having done so
formerly. Raulin wrote* of it as being very plentiful in the
small islands off the coast, and a man who brought me three from
Dhia, off Candia, said that it is still found there in considerable
numbers.
16. CAPRA #GAGRUS CRETENSIS Lorenz-Liburnau 7.
The Cretan Wild Goat has been known from very early times,
and has doubtless acquired an added interest on account of the
legend of Zeus’ upbringing on Mount Ida by the goat Amalthea.
It is still found in the three main mountain masses of the island—
the Aspro Vouno, Mount Ida, and the Lassethe Mountains. One
skin, that of a ¢, was forwarded to me in the spring of the
present year (1905), it having been obtained during the winter
in the Sphakia district. The horns indicate an animal of eight
years old, and measure 605 mm. along the front curve, while the
circumference at the base is 175mm. ‘The greatest length cf
horn given by Dr. Lorenz-Liburnau £ for this subspecies is 81 em.
(810 mm.), this being in a seven-year old specimen preserved in
the Vienna Museum.
November 28, 1905.
Dr. Henry Woopwarp, F.R.S., Vice-President, in the Chair.
Mr. J.T. Cunningham, M.A., F.Z.S., exhibited some photo-
graphs of a Horse bearing structures that’ he interpreted as
incipient horns, and made the following remarks :—
The peculiarity of the horse represented in these photographs
was described by Dr. G. W. Eustace, of Arundel, before the
Linnean Society in 1903. The horse, the name of which is
“¢ Domain,” was then in the stables of Mr. Alfred Day at ‘ The
Hermitage’ near Arundel, and was still there when, by the
‘kindness of Mr. Day, these photographs were taken for me in
October last. A few other similar cases have been recorded, but
the pedigree of Domain contains no individuals which are known
to have possessed the peculiarity, and it appears therefore to be
a new variation, not a result of reversion or heredity.
Dr. Eustace’s paper was illustrated by plaster casts of the fore-
head of Domain which are now in the Natural History Museum,
and Dr. Ridewood has presented to the Museum the frontal
* Op. cit. vol. 1. p. 253.
+ ‘Die Wildziegen der Griechischen Inseln &c.,’ 1889.
t Op. cit. p. 24.
324 MR. W. R. OGILVIE-GRANT ON BIRDS FROM JAPAN. [ Nov. 28,
portion of the skull from another case whose history is unknown.
‘Domain’ was stated to be five years old in 1903, so that he was
seven years of age when the photographs were taken.
The horns are about 2 inch in length, the left slightly larger
than the right. There can be no doubt that they are outgrowths
of the frontal bone. They are covered by normal skin and hair.
Mr. Frank Slade, F.Z.8., showed three photographs of the
Sea-Anemone (Anemonia sulcata), which had been taken from
life in the Horniman Museum at Forest Hill, in the process of
division. The first photograph showed the Anemone at rest after
having made the initial tear in the body-wall. The second showed
the animal, two days later, straiming to increase the tear, whilst
the third, taken after an interval of sixteen days, showed the
division completed.
Mr. Douglas English exhibited and made remarks upon a
living albino Field-Vole (JMcrotus agrestis) which had been
captured last July in Wales.
My. G. A. Boulenger, F.R.S., exhibited a living Lizard, Lacerta
muralis, from Brozzi, province Florence, which he had received
from Dr. A. Banchi, through the mediaticn of Dr. J. de Bedriaga,
C.M.Z.S8. The lizard belonged to the typical form of the Wall-
Lizard, but was remarkable for its black coloration, above and
below. Melanistic forms of the Wall-Lizard were well known on
small islands in the Mediterranean, but, so far as Mr. Boulenger
was aware, no black specimen had ever been recorded from the
mainland. The scales across the body numbered: 58 and the
lamellar scales under the fourth toe 25 in the specimen exhibited ;
these two numbers being sufficient to distinguish the Brozzi
lizard from the melanistic insulars previously described.
Capt. Albert Pam, F.Z.S., made some remarks on a living
specimen of the Violet-cheeked Humming-bird (Petasophora
iolota) which he had recently brought home from Venezuela and
presented to the Society’s Menagerie. He also gave a general
account of the habits of these birds, as observed by him, in a wild
and captive state, and notes on their management and feeding
while in confinement.
Mr. W. R. Ogilvie-Grant, F.Z.8., sent for exhibition a named
set of the Birds collected in Japan by Mr. M. P. Anderson in
connection with the Duke of Bedford’s Exploration in Eastern
Asia. No new species were discovered, but several of the spe-
cimens were of special interest as illustrating stages of plumage
not represented in the British Museum.
1905. | MR. R, LYDEKKER ON GUEREZA MONKEYS. 325
The following papers were read :—
1. Colour Hyvolution in Guereza Monkeys.
By R. LyDEKKER.
[Received November 7, 1905. |
(Text-figures 54-58.)
An interesting example of the progressive evolution of
specialised features in colouring (if we may thus term com-~
binations of black and white) is afforded by the black and black-
and-white African long-haired monkeys included in the genus
Colobus, and which may be collectively designated Guerezas,
although the name “ guereza” refers properly only to the north-
east African representative of the group.
Beginning at one end of the series, we have the Black Guereza
(Colobus satanas), of West Africa, which, as shown in text-fig. 54,
Text-fig. 54.
Black Guereza (Colobus satanas).
is wholly black with tufts of long hair on each side of the
face and throat, a pointed crest on the crown of the head, and
the long tail short-haired from base to tip. Following on this we
may take a variety of the Mantled Guereza from East Central
Africa which I have recently described as Colobus palliatus cottoni,
in which the face-tufts, chin, and narrow pendent tufts of long
hair on the shoulders are white, while the terminal half of the
tail is grey with a white tip, which shows a slight tendency to
326 MR. R. LYDEKKER ON GUEREZA MONKEYS. [ Nov. 28,
expand into a brush. A further development is exhibited by the
typical form of Colobus palliatus (text-fig. 55), from British Kast
Africa and the neighbouring districts, in which the two lateral
white face-tufts are connected by a white band across the brow,
while the shoulder-tufts are of considerably larger size, a small
whitish patch beneath the tail occupies the perineal region, and
the tail has its terminal third whitish, the middle third grey, and
the remainder black. A nearly allied type is found in the form
of the Mountain Guereza (C. ruwenzorii), of the Ruwenzori dis-
trict, in which the white perineal patch has assumed much larger
proportions, although the extreme tip of the tail is alone greyish ;
the latter feature placing the species, so far as the colouring of
this appendage is concerned, next to the Black Guereza.
Text-fig. 55.
Mantled Guereza (Colobus palliatus).
From the three foregoing black-and-white forms there is an easy
transition to Sharpe’s Guereza (C. sharpei), of Nyasaland, in which,
as shown in text-fig. 56, p. 327, the white brow-band, face-, throat-,
and shoulder-tufts have become very long and pronounced, the
hairs of the last hanging down the outer side of the fore-limbs.
Moreover, the white terminal third of the tail has developed a dis-
tinct tuft, not dissimilar in relative size and form to that of a
lion’s tail. A step still further in advance is taken by the typical
Guereza (C’. guereza) of Abyssinia and North-east Africa generally.
In this handsome monkey the white shoulder-tufts extend back-
wards to form a long mantle, falling down each side of the body
1905. ] MR. R. LYDEKKER ON GUEREZA MONKEYS. 327
Text-fig. 56.
rete att
Sa
Sharpe’s Guereza (Colobus sharpei).
Text-fig. 57.
White-tailed Guereza (Colobus caudatus).
Proc. Zoou. Soc.—1905, Vor. Il. No. XXITT. 23
328 MR. R. LYDEKKER ON GUEREZA MONKEYS. [Nov. 28,
and uniting on the lower part of the back. . The culmination of
this type of coloration is formed by the White-tailed Guereza
(C. caudatus, or albocaudatus as it ought to have been called) of
the Kilimanjaro district and other parts of Eastern Africa. Here,
as we see from text-fig. 57, the beautiful pendent white mantle
has become still longer, and the tail, which is wholly white except
for a very small length at the root, is clothed with long pendent hair
comparable to the “ flag” of a setter ; the cheek- and throat-tufts,
however, have been completely lost, so that the head is wholly
short-haired, with the face and throat white.
The difference between the species last-named and the Black
Guereza in the matter of colouring is enormous, and yet the
transition from the one to the other in this respect is almost
complete. In the case of the white-tailed species the excessive
Text-fig. 58.
White-thighed Guereza (Colobus vellerosus).
length of the white hair forming the mantle and the tail-fringe
appears to have been evolved in order to render the creature as in-
conspicuous as possible amid the long pendent greyish-white lichens
which clothe the branches of the trees of an East African forest.
The evolution of such a type is, of course, easy to comprehend ;
but, as in so many other cases, the difficulty comes in with regard
to the purpose of the coloration in the intermediate types con-
necting this species with the Black Guereza. What purpose do
these incipient attempts at the development of a pied coat serve ?
The line of evolution culminating in the white-tailed species by
no means, however, brings us to the end of the modifications in the
colour and local development of the hair in this group of monkeys,
1905. ] ON THE WHITE-MANED SEROW. 329
for the West African White-thighed Guereza (C. vellerosus), text-
fig. 58, appears to exhibit a kind of retrograde development in
these respects. The body, for instance, has entirely lost the mantle
of long white hair and the tail its white “flag,” while the white of
the perineal patch has spread on to the hinder and outer sides of
the thighs. In this case we find, indeed, a practical reversion to
the type of the Black Guereza, with the exception that the band
on the forehead, the sides of the face and throat, the thighs, and
almost the whole of the tail have become white, while the long
hair has entirely disappeared from the face.
That the colouring and special development of the long hair in
the White-tailed Guereza form a protective modification, there
seems to be little doubt. Whether, however, the colour-phases
and hair-growth in the other forms are of a protective nature, or
are merely due to what is commonly called sexual selection, must
be left for those to decide who have the opportunity of seeing
these beautiful monkeys in their native haunts.
2. The White-maned Serow. By R. LypEeKKeEr.
[Received November 11, 1905. |
(Plate VIII.*)
In 1888 the very appropriate name of Vemorhedus argyrochetes
was bestowed by the Rev. Pére Heude* on a large and strikingly
coloured species of Serow inhabiting the mountains of Central
China in the neighbourhood of Che-kiang in the Upper Yang-tse-
kiang district. Later, a fuller notice, with a figure of the skull,
was given by the same writer; while in 1890 Dr. A. Henry $
contributed a note on skins of the species which had come under
his notice while in China. Hitherto, however, so far as I am
aware, no coloured figure of the entire animal has appeared ;
and since the colouring is of a very remarkable and striking type,
somewhat different from that of the ordinary Serow, I think the
opportunity ought to be taken of remedying this deficiency.
This opportunity has heen afforded by the recent addition to
the Collection of the British (Natural History) Museum of a
mounted male specimen of this Serow and of the Tibetan Takin ~
(Budorcas taxicolor tibetana). They were acquired by Rowland
Ward, Ltd., from a French dealer, by whom they were stated to
have come from Tibet; but I should think that Sze-chuen, or
thereabouts, is more probably their place of origin, unless, indeed,
the Serow was procured still farther east. The two are, I believe,
the first representatives of their respective kinds ever received in
England, and it is quite probable that in the case of the Serow
this statement may be extended to European museums in general.
* For explanation of the Plate, see p. 331.
+ Mém. Hist. Nat. Emp. Chinois, vol. ii. p. 4, note (1888).
t T. ce. p. 228, pl. xxxi. (1890).
§ Proc. Zool. Soc. London, 1880, p. 93.
23*
330 ON THE WHITE-MANED SEROW. [ Nov. 28,
In his note of 1890, Dr. Henry described the White-maned
Serow as being as tall as a cow, and employed by the natives of
Central China for riding and as a beast of burden. This, I think,
is somewhat exaggerating matters (unless a very small breed of
cattle is referred to), and a good-sized donkey would seem to be a
better standard of comparison. Although, from the circumstance
that the skull still retains the last two premolars, and therefore
indicates an animal not yet fully mature, it is possible that the
specimen in the Museum does not quite represent the full height
attained by the species, yet it certainly cannot fall very short of
this, and, as mounted, the skin indicates an animal only about
three inches taller than the ordinary Himalayan or (as it may
well be called) Black-maned Serow.
The general build and type of coloration approximate to those
of the last-named animal, although im two respects there are
marked peculiarities in the matter of colourmg. The horns are
small and very thickly rmged for more than half then length,
differing, I think, in these respects to some extent from those of
the Himalayan animal, although, on account of the immaturity
of the Museum specimen, I cannot be confident on these points.
The ears certainly appear to be larger, but here again it is difficult
to say that there may not have been shrinkage in the mounting
of the Himalayan specimens.
The general colour of the upper-parts is mingled black and
white, but the face and outer surface of the ears are blackish
brown, with an admixture of chestnut hairs on the upper part of
the forehead and the sides of the upper lips. The insides of the
ears and part of the muzzle are white, but the white area on the
latter is of much smaller extent than in the Himalayan species,
being confined to the margins of the upper lips, although wider
on the lower lips, whence it extends as a streak on the sides of the
jaws. A large patch on the throat, another on the chest, and
the whole mane are dirty white. On the other hand, the lower
portion of the buttocks, the whole hind limb (except a light
streak inside), and the middle third of the tail are bright mahogany
or ferruginous red. The fore legs from the knees downwards,
and to some extent on their inner and outer sides above the
latter, are of a lighter and more chestnut-red.
The upward extension of the red of the legs and its deeper tone
are features of this species as contrasted with the Himalayan and
Sumatran Serows, which are best regarded as varieties of one
species, the latter distinguished by the legs being chestnut in place
of wholly white. It appears, however, that in some cases the
Sumatran Serow has the mane white, as in the present animal.
The prevalence of bright red, reddish yellow, and yellow in the
colouring of mammals of the West Tibetan province, as exemplified
by Rhinopithecus roellane, Budorcas taxicolor tibetana, and the
present species, is very remarkable, and stands in need of
explanation.
The skull belonging to the same individual as the skin is in a
1905. | ON MAMMALS FROM JAPAN. 331
somewhat damaged condition, having a large portion of the
parieto-frontal region cut away, and also lacking the nasal and
premaxillary bones; it still, however, serves as a basis of com-
parison between the present species and V. bubalinus. The third
and fourth milk-molars are still retained, the second premolar is
just piercing the gum, and the third molar has its summits
slightly abraded by wear. The animal may therefore be con-
sidered to have been sub-adult at the time of its death, and may
perhaps have not quite attained its full stature.
As it is, the skull is fully as large as that of an aged individual
of V. bubalinus, but appears to have been of a relatively broader,
deeper, and shorter type, although from its imperfection I cannot
be sure on all these points. The palate is, however, evidently
wider, the interval between the bases of the second molar being
about a quarter of an inch more than in the Himalayan species.
The basioccipital and basisphenoidal rostrum is also markedly wider
and more tapering, with less prominence of the anterior tubercles
for muscular attachment, which are, however, much larger.
Perhaps the most important distinctive feature of the skull of
the white-maned species is the much greater backward extent of
the nasals on to the frontal region, in consequence of which the
fronto-nasal suture is situated only a short distance in front of the
vertical line formed by the anterior border of the orbit, instead
of very considerably in advance of the same. The pit for the
face-gland also occupies nearly the whole extent of the lachrymal
bone, instead of leaving a large flat surface along the upper
border of the same. The palatine bones likewise extend much
further forward on the palate, so that the palato-maxillary
foramina are situated on the line of the hinder lobe of the first
molar instead of opposite the cleft between the two lobes of the
second tooth of the same series.
EXPLANATION OF PLATE VIII.
The White-maned Serow (Nemorhedus argyrochetes), from the specimen
in the British Museum.
3. The Duke of Bedford’s Zoological Exploration in Eastern
Asia—I. List of Mammals obtained by Mr. M. P.
Anderson in Japan. By Oiprietp THomas, F.R.S.*
[Received October 9, 1905. }
(Plate IX.7)
AsT announced at the last Meeting of the Society, our President,
His Grace the Duke of Bedford, K.G., has consented, in order to
* [The complete account of the new species described in this communication
appears here; but as the names and preliminary diagnoses were published in the
‘Abstract,’ such species are distinguished here by the name being underlined.—
Eprror. |
+ For explanation of the Plate, see p. 363.
332 MR. OLDFIELD THOMAS ON [Nov. 28,
further the cause of zoological exploration, to bear the cost of a
collector working systematically through the islands of the Far
East, and I now have to give an account of the Mammals obtained
by that collector—Mr. Malcolm P. Anderson—in Japan, where
he has begun his labours.
The selection of Japan for the first field of Mr. Anderson’s work
was almost a necessity, for practically nothing has been done
with regard to the Mammalogy of that country since the time
of Siebold and Burger, whose collections resulted in Temminck’s
great work of 1842-45, while authentic modern specimens of the
species then described were necessary before any further progress
could be made. It is true that, by the liberality of the Leyden
Museum, typical specimens of most of Temminck’s species were
distributed to many European museums, our own National Museum
receiving a very complete set, but these specimens, 60 to 70 years
old, are all naturally much deteriorated by exposure to light,
while scarcely any of them have any more exact locality recorded
than “ Japan.”
Under these circumstances no words can express the value of
the fine series of specimens obtained by Mr. Anderson, who has
proved himself a most successful collector, and one well able to do
full justice to the liberality of our President. The specimens,
which are of all classes, after being exhibited before the Society,
are to be transferred by His Grace to our National Museum,
where they will be most gratefully appreciated.
Mr. Anderson landed at Yokohama in July 1904, and began
collecting at once in Hondo (Central and North), and made two
trips to Hokkaido in September and November.
Later he went to the two large southern islands, Shikoku in
March 1905, and Kiushiu in April and May, the specimens from
this latter being particularly valuable, as the Dutch Factory, from
which the Leyden Museum obtained its materials, was situated at
Nagasaki, at the south-eastern corner of the island.
Lastly, Mr. Anderson visited the Oki group of islands, to the
north of Southern Hondo, and Tanegashima, south of Kiushiu,
while his brother, Mr. Robert Anderson, went to Yakushima,
still further south. The specimens from these separate island
collections 1 have included in an Appendix to the paper.
In all, the mammals: referred to in the present communication
number about 600 examples, belonging to 50 species and sub-
species. Of these I have found it necessary to give new names
to twelve, besides describing one new Shrew discovered by
Mr. Hawker in 1903. The fine new Marten, Mustela melampus
bedfordi, now figured, but described last session, is also to be
eredited to Mr. Anderson’s collection.
As yet I am chary of making any general conclusions about
the mammal-fauna of Japan. It is, however, evident from this
collection that there is little faunistic difference between Shikoku,
Kiushiu, and the main southern portion of Hondo, but that a
number of species do not extend into the north of Hondo, where
1905. | MAMMALS FROM JAPAN, 333
such species as occur are sometimes subspecifically different from
those of the south. Hokkaido, of course, is very different from
Hondo, and the occurrence there of such typically Japanese species
as Mieromys speciosus and geisha is somewhat unexpected ; possibly
they are comparatively recent introductions, even though in each
case subspecifically separable from their Hondo relatives.
The following is a list of the species obtained in each ofithe
four islands referred to :—
Hokkaido :
Sciurus vulgaris orients.
Mus norvegicus.
Micromys speciosus ainu, geisha hokkaidi.
Evotomys mikado, bedfordie.
Lepus timidus ainw.
Hondo:
Pinistrellus abramus.
Sorex shinto, hawkeri.
Crocidura dsi-nezumi chisar.
Chimarrogale platycephala.
Mogera wogura.
Urotrichus talpoides pilirostris.
Canis hodophylax.
Nyctereutes viverrinus.
Mustela melampus bedfordi.
Putorvus ttatsr.
Petaurista leucogenys.
Sciuropterus momonga amygdali.
Sciurus lis.
Mus tanezumi, molossinus.
Micromys speciosus, geisha.
Microtus montebelli.
Evotomys (Craseomys) andersont.
ae (Phaulomys) smithit.
Lepus brachyurus.
Sus leucomystax.
Nemorhedus crispus.
Cervus sika.
Shikoku :
Macacus fuscatus.
Crocidura dsi-nezumt.
Mogera wogura kobee.
Urotrichus talpordes.
Putorius ttatst.
Meies anakuma.
Micromys speciosus, geisha, minutus japonicus.
Evotomys (Phaulomys) smathir.
Lepus brachyurus.
334 MR. OLDFIELD THOMAS ON [ Nov. 28,
Kiushiu :
Rhinolophus ferrum-equinum nippon.
Myotis macrodactylus, natterert hombinus.
Miniopterus schreibersi japonie.
Crocidura cerulea, dsi-nezwmi.
Urotrichus talpordes.
Mustela melampus.
Putorius itatst.
Meles anakuma.
Petaurista leucogenys.
Micromys speciosus, geisha, minutus japonicus.
Microtus montebelli.
Evotomys (Phaulomys) smathii.
Lepus brachyurus.
In order to focus so far as possible the existing information
about the mammals of Japan, I have prepared the following
résumé of the literature, which, apart from 'Temminck’s fine work,
is of a very fragmentary character.
1824. Siebold, G. T. de. Spicilegia Faun. Japon., in Dissertatio
Hist. Nat. Japon. p. 13.
Description of “ Wyoaus lineatus”—a Tamias, from Hokkaido.
1842-45. Temminck, C. J. Mammalia of P. F. de Siebold’s
‘Fauna Japonica,’ pp. 1-60, pls. 1.—xxx.
A complete account of the Fauna, as known from the col-
lections sent by Messrs. Siebold, Burger, and other Dutch
naturalists to the Leyden Museum.
One of the finest and most complete faunistic works ever
published. Up to 1904, that is, for more than sixty years, the
only valid species added to those contained in it were MWicrotus
montebelli M.-Edw., Murina hilgendorfi Peters, and Talpa
mizura Giinth.
The following species are first described in this great work :—
Macacus fuscatus (under the name of /nwits speciosus), Pteropus
dasymallus, Rhinolophus nippon and cornutus, Pterygistes
molossus, Myotis macrodactylus, Pipistrellus abramus and
akakomuli, Talpa wogura, Urotrichus talpoides, Chimarrogale
_platycephala, Crocidura dsi-nezumi and umbrina, Meles ana-
kuma, Mustela melampus and brachyura, Putorius ttatsi,
Nyctereutes viverrinus, Lepus brachyurus, Sciwrus lis, Pieromys
leucogenys, Sciuropterus momonga, Mus erythronotus, argenteus,
molossinus, tanezumi, and speciosus, Glirulus japonicus, Cervus
sika, Nemorhedus crispus, and Sus leucomystax.
1857. Schlegel, H.
Ursus japonicus, sp.u. Handl. Beoefening der Dierkunde,
1. p. 42; Sclater, P.Z.8. 1862, p. 261; Giinther, P.Z.8. 1880,
p. 442.
The U. torquatus of the ‘ Fauna Japonica.’
1905. ] MAMMALS FROM JAPAN. 335
1862.. Gray, J. E.
Leopardus japonensis, sp.nu. P.Z.S8. 1862, p. 262, pl. xxxiii.
Based on a tanned Leopard-skin without exact locality.
1865. Gray, J. E. ;
Martes japonica, sp. n. P.Z.8. 1865, p. 104; Cat. Carn.
B.M. p. 82 (1869).
‘No doubt the summer form of Mustela melampus.
1867. Gray, J. E.
Lutronectes whiteleyt, g. & sp. nov. P.Z.S. 1867, p. 181;
Cat. Carn. B.M. p. 107 (1869).
Based on young specimens of the Japanese Otter.
1868. Gray, J. E.
Vulpes japonicus, sp.n. P.Z.S. 1868, p. 517; Cat..Carn.
B.M. p. 204 (1869).
“ Japan.”
1874. Milne-Edwards, A. Recherches Mammifeéres. Texte, p. 285.
Description of Microtus montebelli, from Fusi-yama.
1875. Von Martens, E. Die Preussische Expedition nach Ost-
Asien. Zoologische Abtheilung. I. Pt. 1, pp. 75 & 362.
General account of Japanese mammal-fauna, and list of
species obtained. (Determinations by W. Peters.)
1875. Rein, J. J. Notizen iiber die Verbreitung einiger Siuge-
thiere auf Nippon. Zool. Gart. xvi. 1875, p. 55.
Notes on habits, native names, and distribution of thirteen of
the better-known species. In the same author’s ‘Japan,’ 1881,
1. p. 201, these notes are incorporated in a general popular account
of the fauna.
1880. Giinther, A. Notes on some Japanese Mammalia. P. Z.S.
1880, p. 440.
Notes on Urotrichus talpoides (with description of Vewrotrichus
g.n. for the American U. gibbsi), Talpa mizura, sp. n., Ursus
arctos, U. japonicus, and Calorhinus ursinus.
The new Mole, Zalpa mizura, has not since been obtained.
It is closely allied to the European 7’. europea.
1880. Peters, W. Ueber die von Hrn. Dr. F. Hilgendorf in
Japan gesammelten Chiropteren. MB. Ak. Berl. 1880,
p. 23.
Records of 7 species, and description of Murina hilgendorfi
from Yedo, near Tokyo.
1880, Thomas, O. On the Myoxus elegans of Temminck. P.Z.S.
1880, p. 40.
See below, under Glirulus japonicus.
336 MR. OLDFIELD THOMAS ON [ Nov. 28,
1882. Doederlein, L. Ueber einige Japanische Saiugethiere. MT.
Deutsch. Ges. Ostasiens, vol. 111. Heft 25, p. 210.
(1) Existence of Fox in Shikoku. (2) A Changing Hare
(“ Lepus variabilis”) in Japan. (3) On a small musky-smelling
rodent (more likely a Shrew).
1886. True, F. W. Description of a new genus and species of
Mole (Dymecodon pilirostris) from Japan. Pr. U.S. Nat.
Mus. 1886, p. 97.
From Yenoshima, near Tokyo.
This Mole is probably an immature Urotrichus talpoides.
1900. Barrett-Hamilton, G. E. H.
Lepus timidus ainu, sabsp.n. P.Z.S8. 1900, p. 90.
From Hokkaido.
1904, Sasaki, C. A new Field-Mouse in Japan. Bull. Coll.
Agric. Tokyo, vi. p. 51.
Description of Arvicola hatanedzumi (= Microtus montebelli),
from Tokyo.
1904. Beard, J. C.
Nyctereutes albus, sp.n. Scientific American, 1904, p. 237.
Based on a white specimen in the New York Zoological Park,
said to be from Hokkaido.
1905. Thomas, O. On some new Japanese Mammals presented to
the British Museum by Mr. R. Gordon Smith. Ann. &
Mag. N. H. (7) xvi. p. 487.
Descriptions of Mogera wogura kobew, Petaurista leucogenys
nikkonis, oreas, and tose, Micromys geisha, and Hvotomys
(Phaulomys, subg. n.) smithit.
1905. Thomas, O. Exhibition of Mammals from Japan. Abstr.
IP /Ap tle USOS, jos OS IPs As tele IOS) ithe foe ssh,
Description of Mustela melampus bedfordi.
1. Macacus Fuscatus Bly.
Macacus fuscatus Bly. J. A. S. B. xliv. extra number, p. 6 (1875).
6. 304. ©. 303, 323. Jinrio, Tokushima Ken, Shikoku.
500’.
This is the Jnwus speciosus of the ‘ Fauna Japonica,’ nec F. Cuv.
‘¢ Numbers of monkeys live in the forest surrounding certain
large temples at a distance from Jinrio. I did not see them, but
sent my servant in search of them, and through him secured these
specimens. They are considered difficult to hunt, for they hide
themselves very effectually in the high Cryptomeria trees. It is
said that with the help of a dog they can easily be shot, as the
monkey pays little heed to the man and his whole attention is
absorbed in exhibiting his anger towards the barking dog. The
flesh is commonly eaten by the natives, but on trying it I did not
dee) hey) SL, J Al
1905. | MAMMALS FROM JAPAN, 337
2. RHINOLOPHUS FERRUM-EQUINUM NIPPON Temm.
3. 485. Tano, Miyasaki Ken, Kiushiu.
3. PIPISTRELLUS ABRAMUS Temm.
g. 6. Takayu, near Yonezawa, Uzeu, N. Central Hondo.
Dr. Jentink* has shown that Temminck’s Vespertilio akokomuli
is the same species as his V. abramus. The type locality of both
is Nagasaki, Kiushiu.
“Caught, with the two succeeding species, in caves near the
village.”— WM. P. A.
4, Myoris (LEvcoNoE) MAcRoDACTYLUS Temm.
3. 490,500. 9. 493, 494, 515, 516, 517. Tano, Miyasaki
Ken, Kiushiu. 500’.
Dimensions of an adult male :—
Forearm 36 mm.
Head and body 44; tail 35; ear 14:5.
These specimens agree absolutely with Temminck’s description,
and there can be no doubt that they belong to his species, in spite
of Peters’s assertion t that macrodactylus resembled very closely
the European J. capaccinii, to which these examples bear no
resemblance whatever. Indeed, so great is the discrepancy, that I
am tempted to suppose that Peters did not really see the specimens
described by Temminck at all. I. macrodactylus in fact is more
closely allied to WM, daubentoni.
5. MYoris NATTERERI BOMBINUS, subsp. n.
@. 486, 487, 488, 489, 492. Tano, Miyasaki Ken, Kiushiu.
500".
Similar in essential respects to the European J. natiereri, which
it evidently represents in Japan. But the ear appears to be rather
longer (judging from skins only), the tragus narrower and more
boldly curved outwards, the skullis more abruptly and considerably
inflated in the frontal region, and the colour is not quite the same.
In true W. natterert the colour is paler and more uniform than
in the other small European species of I/yotis, this being apparently
due to the fact that the pale brown ends to the hairs are longer
and therefore hide the blackish-grey of their bases. In bombinus,
however, the coloration is more normal, a darker variegated brown,
the blackish-grey bases of the hairs showing through. In a
similar way below, the light ends to the hairs are shorter and less
prominently white.
Dimensions of the type :—
Forearm 40 mm.
Head and body 52; tail 44; ear 17.
* Notes Leyd. Mus. ii. p. 37 (1879).
+ MB. Ak. Berl. 1866, p. 681. Dobson, on this statement, actually synonymised
macrodactylus with capaccinii.
338 MR. OLDFIELD THOMAS ON [ Nov. 28,
Skull—greatest length 15:5; basal length in middle line 11°8 ;
front of canine to back of m® 5:9.
Type. Old female. B.M. No.6.1.4.14. Original number 487.
Collected 30 April, 1905.
It is a matter of interest to find in the Far East this repre-
sentative of JZ. natterert, which has hitherto only been known from
Kurope. It is probable, also, that Mr. Miller’s I. thysanodes is
the corresponding Bat in the N. American fauna.
6. MINIOPTERUS SCHREIBERSI JAPONL®, subsp. n.
3. 501, 502, 503, 505, 510, 511, 512, 513,514. 9.495, 496, 497,
904, 507, 508, 518, 519, 520, 521. And twoim alcohol. Tano,
Miyasaki Ken, Kiushiu. Alt. 500 feet.
Size rather large, uniformly larger than in the Liu-Kiu form,
M. fuscus Bonh.*
Colour of back between ‘“seal-brown” and dark ‘ Prout’s
brown”; head and nape rather greyer, though the difference
is perhaps due rather to the ends of the hairs being more glossy
and so catching the light, than to any essential difference in colour.
Under surface like the head.
Dimensions of the type :—
Forearm 47 mm. (range from 46 to 48).
Head and body 57; tail 53; ear 12.
Skull—greatest length 16, median basal length 12; front of
canine to back of m* 6-4.
Type. Adult male. B.M. No. 6.1.4.22. Original number 512.
Collected 3 May, 1905.
As was to be expected, the Japanese J/iniopterus is clearly
different from the pale European one, nor does any form quite
agreeing with it appear to have been described. Bonhote’s
M. fuscus from the Liu-Kiu Is. is similar in colour (or slightly
darker), but is uniformly smaller, the forearm rarely reaching
44mm. Seven additional examples of fwscus recently received
from Mr. A. Owston confirm the characters derived from the three
originally examined by Mr. Bonhote.
The fine series obtained by Mr. Anderson is remarkably uniform
both in colour and size.
This Bat is of course the ‘“‘ Vespertilio blepotis” of the ‘ Fauna
Japonica’; but that species was primarily described on examples
from Java.
i)
7. SoREX sHINTO Thos.
Sorex shinto Thos. Abstr. P. Z.S. No. 23, p. 19, Dee. 5, 1905.
3.47. Makado, near Nohechi, Aomori Ken, N. Hondo. Alt.
400 ft.
A small species with a long tail.
Size as in S. macropygmeus Miller, though tail much longer.
Fur of back slightly over 3mm. in length. General colour above
* Nov. Zool. ix. p. 626 (1902).
1905. ] MAMMALS FROM JAPAN. 339
uniform brown (between ‘ seal-brown” and “ Prout’s brown”),
quite similar in tone from head to rump. Sides not presenting a
contrasted light area, being scarcely lighter than the back, and
passing gradually without line of demarcation into the drab-washed
belly. Chin and throat slightly more greyish. Hands and feet
glossy brown, the hairs at the tips of the digits silvery. Tail long,
nearly as long as the head and body, well-haired throughout,
slightly pencilled at tip, blackish brown above, dull whitish below.
Skull conspicuously larger than that of S. minutus, but of the same
light and delicate build. Upper unicuspids subequal in transverse
section, the last one not smaller than the rest or outof series. All
the teeth liberally tipped with brown.
Dimensions of the type, measured in the flesh :—
Head and body 50 mm.; tail 49; hind foot 11:5; ear 7.
Skull—greatest length 17°5; basal length 15; breadth of
brain-case 8°5; length of upper tooth-series 7-6.
Hab. as above.
Type. Adult male, B.M. No. 6.1.4.30. Original number 47.
Collected 28 September, 1904.
This small Shrew belongs to the genus Sorex, which had not
hitherto been recorded from Japan. It appears to be a member
of the S. minutus group, but may be readily distinguished by its
size and unusually long tail. A second specimen of it is in the
Museum collection, obtained by Mr. Alan Owston near Tokyo.
[SoREX HAWKERI, sp. n.
3. Inukawa, Yedo, Hondo.
Size very small, about as in S. minutus. Fur, in summer, about
3 mm. long on the back. General colour of the dorsal area brown,
near ‘‘ Prout’s brown” but considerably paler. Sides distinctly
different from back, greyish broccoli-brown ; belly like sides, but
paler. Upper surface of hands and feet pale drab. Tail short,
much shorter than head and body, well-haired and pencilled, pale
broccoli-brown above, rather lighter below.
Skull crushed in the single specimen, but apparently even smaller
than that of S. minutus, as indicated by the short tooth-row.
Anterior incisor large, not very deeply notched. Five upper uni-
cuspids broad, closely packed, in even slightly decreasing sequence
to the penultimate, the fifth again slightly larger than the fourth,
in the tooth-row, clearly visible from without. Brown on teeth
about as in S. minutus.
Dimensions of the type :—
Head and body (measured in skin) 55 mm.; tail (measured in
flesh) 30; hind foot 9.
Skull—tip of anterior incisor to that of large premolar 2:8 ;
to back of m* 5:2.
Type. Male. B.M. No. 3.9.10.1. Collected 7 June, 1903, and
presented by R. McD. Hawker, Esq.
Although not collected by Mr. Anderson, I take this opportunity
to describe a tiny Shrew obtained in Japan by Mr. Hawker. It
340 MR. OLDFIELD THOMAS ON [ Nov. 28,
has no alliance with any of the European types of Shrews, but
would seem to have relatives among some of the short-tailed Arctic
American forms, with which it will no doubt prove to be linked by
allied species from the East Siberian mainland. |
8. CROCIDURA CHRULEA Kerr.
4 in alcohol. Nagasaki; in houses.
9. CrocrpuRA (CR.) DsI-NEzZUMI Temm.
S$. 263, 275, 293. Jinrio, Tokushima Ken, Shikoku. 500’.
9. 321. Tanano, Tokushima Ken, Shikoku. 250’.
3g. 420, 423. ©. 446. Takamori, Kumamoto Ken, Kiushiu.
1850’.
3. 463. Kawachi, Miyasaki Ken, Kiushiu. 1500’.
Flesh-measurements of an adult male from Shikoku :—Head
and body 67 mm.; tail 46; hind foot 13°5 ; ear 9.
These specimens from the two southern islands are all of a
uniform brownish grey, very lke the colour of the European
C’. russula, of which this is evidently the Japanese representative.
The type locality is presumably Kiushiu.
But the corresponding Shrew found by Mr. Anderson in the
north of Hondo is not quite the same, and may be regarded as a
different subspecies.
10. GrociIDURA DSI-NEZUMI CHISAI*, subsp. n.
) Pp
go. 51. @. 48. Tsunagi, near Morioka, N. Hondo.
9.93. Morioka, N. Hondo.
Similar to dsi-nezumi in size, but tail rather and hind feet
decidedly shorter. General colour much darker, near ‘ seal-
brown,” but browner and less purple. Under surface ‘“ mouse-
grey.” Tail uniformly dark brown.
Skull rather narrower, less broadly flattened than in dsi-
nezume.
Measurements (in mm.) of three specimens in the flesh :—
51. (Type.) Head and body 68; tail 43; hind foot 12.
48. ” ” Og a) O03 ” ne
93. ” ” 3 oegy Oehs ” le
Skull of type—Greatest length 18, basal length 15°4; greatest
breadth 8°5; length of upper tooth-series 7:5.
Type. Adult male. B.M. No. 6.1.4.43. Original number 51.
Collected 3 October, 1904.
Temmincek’s “ Sorex umbrinus” would appear to be similar to
this Shrew in colour and size, but is distinguished by its very long
tail, 54 mm. in length.
11. CHIMARROGALE PLATYCEPHALA ’emm.
@. 168. Tajima, E. coast of Izu Peninsula, 8.E. Hondo.
Flesh measurements :—Head and body 112 mm.; tail 90; hind
foot 25°5; ear 9.
* Chisai=small.
1905. |} MAMMALS FROM JAPAN. 341
12. Mocera wocura Temm.
gd. 96. Tsunagi, near Morioka, Iwate Ken, N. Hondo.
Flesh measurements :—Head and body 108 mm.; tail 20; hind
foot 16°5.
13. MoGERA woGuRA KOBE Thos.
6. 336. Ochi, Kochi Ken, Shikoku.
Flesh measurements :—Head and body 160 mm.; tail 25; hind
foot 21.
No specimens intermediate in size between these large Moles
and the true wogura have as yet turned up. Possibly the two
forms ought to be regarded as specifically distinct.
14. Urorricuus TALPoIDEs Temm.
3. 397, 398, 406, 429, 444. 9. 385, 396, 422, 430, 435.
Takamori, Kumamoto Ken, Kiushiu. 1800’,
3. 471, 472, 476. 9. 447, 473, 474. Kawachi, Miyasaki
Ken, Kiushiu. 1500’.
3. 274, 290. &. 288, 289, 310. Jinrio, Tokushima Ken,
Shikoku. 500’.
2. 314. Fukuhara, Tokushima Ken, Shikoku. 750’.
Q. 324. Ikeda, Tokushima Ken, Shikoku.
3. 339, 357. 2. 337, 338, 342, 343,358. Ochi, Kochi Ken,
Shikoku. 1300’,
©. 329. Sakawa, Kochi Ken, Shikoku.
3. 370, 378, 379, 380. ©. 371, 377. Kuma, Ehime Ken,
Shikoku. 1200’.
Specimens from Kiushiu may be regarded as typical talpoides,
for that island is the first locality mentioned in Temminck’s
original account, besides being that which contains Nagasaki,
where the factory of the early Dutch traders was situated.
A pair of well-grown Kiushiu specimens measure (in mm.) as
follows :—
©. Head and body 99; tail 34; hind foot 16.
” cB 102; 9 34 ; ” 16.
The Shikoku specimens appear to be quite similar to those from
Kiushiu. <A pair measure :—
3. Head and body 96; tail 32; hind foot 15:5.
: 5 DOR SOs ‘3 15:5.
The gener al colour of the Kiushiu and Shikoku specimens is a
brown, between vandyke and seal-brown, much browner than in
those from Northern and Central Hondo.
“These animals are undoubtedly partly herbivorous; for
examination of many stomachs showed them to be frequently
filled with vegetable matter, probably some root. Remains of
earthworms are also frequently found. I catch as many specimens
in traps baited with wheat or rice as in those baited with flesh. At
all times of the year they come frequently above ground, especially
in grassy places.
342 MR. OLDFIELD THOMAS ON [ Nov. 28,
“Not uncommon; usually found in the embankments that
bound the terraced paddy-fields. Often accepting bait of rice or
wheat. The stomach contents of those examined was largely of a
vegetable character, not mixed with earth as when earthworms
are the chief food.”—I/. P. A.
This observation about the food of Urotrichus is of remarkable
interest, as it is quite opposed to the general rule in the Talpide.
I can find no previous statement on the subject, either as regards
this genus or its American ally Veurotrichus.
15. UrorricHUs TALPOIDES PILIROSTRIS True.
Dymecodon pilirostris True, P. U.S. Nat. Mus. 1886, p. 97
(juv.).
3. 53, 61, 62, 65, 73, 74,75. 2.55. Tsunagi, near Morioka,
Iwate Ken, N. Hondo.
3. 94,95. Morioka, Iwate Ken, N. Hondo.
6. 142, 144, 145, 162. 9. 143, 152, 161. Nakaomi, near
Ohito, Izu, 8.E. Hondo. 400,
These specimens, from Hondo, are all of a “ slate-black” (grey
no. 2), with a slight tinge of “‘mouse-grey,” and are without the
distinctly brown tone of the typical ¢alpoides of Kiushiu and
Shikoku. They are also very slightly smaller, with shorter tails
and shorter hind feet.
The following are the measurements (in mm.) of a pair from
Izu, near the typical locality of ‘‘ Dymecodon pilirostris” :—
3. Head and body 92; tail 30; hind foot 14°45.
: . 905 20 " 14°5,
A study of Mr. True’s description of the genus Dymecodon
convinced me that his specimen was a young Uvotrichus, and this
suggestion has been confirmed by Mr. Gerrit Miller, who tells me
that the type, now in the U.S. National Museum, “is young,
with the milk-dentition still in place.”
But Mr. Miller goes on to state that the molars of pilirestris
are smaller than those of talpoides, and that there are other slight
cranial differences, although, owing to the youth of the specimen,
he cannot express an opinion as to their value. ‘‘ My surmise
would be that Dymecodon is the same as Urotrichus, but that the
species pilirostris is quite distinct from the ordinary animal.”
On geographical grounds, however, it appears to me so unlikely
that there should be a different species of Urotrichus at Yeno-
shima, a place in the Bay of Tokyo quite close to Misaki, where
we know the ordinary form occurs, and not far from the Izu
peninsula, that I do not at present feel justified in giving the
Hondo subspecies any other name than pilirostris.
16. Canis HoDOPHYLAX Temm.
¢. 255. Washikaguchi, Nara Ken, Hondo.
“The Wolf was purchased in the flesh, and I can learn but little
about it. It is rare, some say almost extinct. Japanese name
‘Okami’ or ‘ Aamainu.’”—J/. P. A.
1905. ] MAMMALS FROM JAPAN. 343
17. NYcTreREUTES VIVERRINUS Temm.
g. 251. Washikaguchi, Nara Ken, Hondo.
““ Japanese name ‘ Tanuki.’”—W/, P. A.
18. MusteLA MELAMPUS ’emm.
2. Takamori, Kumamoto Ken, Kiushiu.
The beautiful golden yellow of this fresh specimen shows a
striking contrast to the dark general colour of the Hondo
subspecies.
19. MusrELA MELAMPUS BEDFORDI Thos. (Plate IX.)
Mustela melampus bedfordi Thos. Abstr. P. Z. 8. No. 21, p. 10,
June 13, 1905; P.Z.8. 1905, i. p. 183.
go. 213, 254. ©. 217, 232. Washikaguchi, Nara Ken, east
of Hiogo, Southern Hondo,
This handsome form of the Japanese Marten, the first new
mammal obtained by Mr. Anderson, has already been described,
and a figure of it is now given to show its striking colour:
contrasts. It will no doubt prove to be the form found all over
Southern Hondo, the true yellow melampus being a native of
Kiushiu.
T am informed that the two forms of the Japanese Marten are
well known to the furriers, through whose hands many thousands
of skins pass every year.
“The Marten may be regarded as common in Nara Ken.
Besides the specimens sent, T saw three other individuals which
were shown me by peasants. It lives in the more remote parts
of the forest, where its burrows are to be found beside rocks or
stumps. Native name ‘Teng.’”—WM. P. A.
20. Purortus rratst Temm.
3. 185, 186. Tsushima, Aichi Ken, Hondo.
6. 224, 225, 226, 227, 233, 245. Washikaguchi, Nara Ken,
Hondo.
g. 281, 319. @. 308. Jinrio, Tokushima Ken, Shikoku.
500’.
3d. 427, 442. 9.405. Takamori, Kumamoto Ken, Kiushiu.
1850'.
3. 466. Kawachi, Miyasaki Ken, Kiushiu. 1500’.
The Japanese Mink is evidently very common in Southern
Hondo and Shikoku, as every collector sends a number of speci-
mens. But in Northern Hondo My. Anderson does not seem to
have met with it. In Hokkaido it is probably replaced by some
representative of the P. ermimeus group.
‘‘ These animais infested the houses of the neighbourhood, pre-
sumably for the purpose of catching rats. All the specimens
secured were trapped near houses.’”—J/. P. A.
Proc. Zoou. Soc.—1905, Vou. Il. No. XXIV. 24
344 MR. OLDFIELD THOMAS ON [ Nov, 28,
21. MeLEs ANAKUMA 'Temm.
3d. 312, 313. @. 295. Jinrio, Tokushima Ken, Shikoku.
500’.
Ss. 403, 404. Takamori, Kumamoto, Kiushiu.
“Not uncommon. The peasants secure them by smoking them
out of their holes.” —J/. P. A.
22, PRYAURISTA LEUCOGENYS T’emm.
6. 231, 234, 240. 9. 253. Washikaguchi, Nara Ken, Hondo.
3. 477. 9. 479, 480, 481. Mitai, Miyasaki, Kiushiu.
The specimens from Kiushiu are nearly topotypical, but are
less similar to the Nagasaki skin which I provisionally took as
typical when recently writing on the subject, than to the form
from Shikoku which I described as P. 0. tose*. Further material
from different localities will be needed before the races of this
interesting and variable animal can be satisfactorily understood.
“The large Flying Squirrel is well-known in this region
(Washikaguchi), and is probably as plentiful as anywhere in
Japan, It is found in the large Cryptomerias and other trees
which grow about some of the temples and shrines and are never
cut. The specimens were all purchased from peasants, who
brought them to me. The people say that this animal possesses
great control over its ‘ flight,’ being able to turn almost at right
angles while in mid-air. Japanese literary ‘ Musasabi,’ but called
‘ Bandari’ in this locality.” P. A:
“ At Mitai, Kiushiu, they lived in numbers in a grove of
Cryptomerias surrounding a temple. On the evening of April 21
they appeared about 7.30, when darkness was coming on. The
first I saw alighted noiselessly on a trunk near me and immediately
ascended rapidly among the branches. Another I saw ‘ fly’ from
near the top of a Cryptomeria, make almost a half-circle past a
cluster of trees, and alight some 40 ft. from the ground on another
Cryptomeria. The ‘flight’ is swift, but we had time to notice
that the tail is held nearly straight out behind.”—J/. P. A.
23. ScIUROPTERUS MOMONGA AMYGDALI 7, subsp. n.
3g. 257, 259. Q. 258, 260, 261, 262. Washikaguchi, Nara
Ken, Southern Central Hondo.
The Flying Squirrel received by the British Museum in 1844
from the agent of the Leyden Museum as representing Temminck’s
“ Pteromys momonga” is so much smaller than these examples
that there is no doubt that the two should bear different names.
But it is probable that both are included in Temminck’s descrip-
tion, in which case one or other of them must be selected as
typical of his species. JI would therefore propose to select the
smaller one, of which he figured the skull, even though he himself
* Ann. Mag. N. H. (7) xv. p. 488 (1905).
+ Dr. Rein states that the Japanese name for this animal, Momodori, means
* peach-bird.”
1905. | MAMMALS FROM JAPAN. 345
believed that it was ‘“semi-adulte.” This course, besides making
the figure fix the type, has the advantage of giving at least one of
the two forms an exact typical locality, whereas if the name
momonga were applied to the large form and a new name given
to the small one, the typical locality of neither would be definable.
We may thus treat the British Museum 1844 specimen as a
co-type, as it was one of those on which the description was based
and agrees absolutely with the typical figure. This specimen, far
from being ‘‘semi-adulte,” is absolutely full-grown, its teeth
showing more evidence of wear than is the case with any of
Mr. Anderson’s examples.
The new subspecies may be briefly described as similar to true
momonga, but conspicuously larger and with a much longer tail.
The co-type above referred to has a skull measuring 36 x 20 mm.,
Temminck’s figure is 35°D x 21:5; while the smallest of the Nara
skulls is 41x 23°5. The hind foot of momonga is just 30 mmn.,
that of amygdali 37-38.
In colour there is probably little difference, but direct com-
parison is not possible, as the co-type of momonga is in the brown
summer pelage. ‘The new form, in its winter pelage (January),
has its dorsal hairs blackish slaty, washed terminally with isabella,
tending sometimes towards buffy. Cheeks and under surface
white, the hairs slaty basally. Under side of membranes irregu-
larly washed with pale fawn. Upper surface of hands and feet
grizzled black and fawn, a prominent tuft of longer hairs at the
end of each hind toe clear isabella. Tail subdued wood-brown,
washed above and below with black.
Skull larger and heavier in every way than that of true momonga.
Dimensions of the type, measured in the flesh :—
Head and body 166 mm.; tail 139; hind foot 38; ear 25.
Skull—greatest length 42:2; basilar length 31:5; greatest
breadth 26; length of nasals 13:6; breadth of brain-case 19 ;
palatilar length 17-7; palatal foramina 4°3; length of upper tooth-
series, exclusive of p’, 6:8,
Type. Adult male. B.M. No. 6.1.4.122. Original number 257.
Killed 27 January, 1905.
It is probable that the smaller form, to which I restrict the
name momonga, will prove to be an inhabitant of one of the
southern islands, while the larger one is no doubt spread widely
over Hondo.
‘“‘ Brought to me by a servant after my departure from Washi-
kaguchi. They were taken near the top of a rather high
mountain, in a forest of Chamccyparis. Regarded by the peasants
as the young of the Petaurista, and therefore called ‘ Bandari.’”—
ESE Ab
24, SCIURUS VULGARIS ORIENTIS, subsp. n.
3. 98,102. @. 103. Aoyama, Hokkaido.
Ce oa eel Og Olio eS eS ls2 lao. M38. Nobori-
betsu, near Moruran, Hokkaido.
24*
346 MR. OLDFIELD THOMAS ON [ Nov. 28,
Sid Os A Sa gO emee WAS BVOC ai Lore. Ocpemelc anil
ear Sapporo, Hokkaido.
The Noboribetsu and Aoyama specimens are in the winter, and
the Jozankei specimens in the summer pelage.
In Major Barrett-Hamilton’s paper* on the subspecies of
Sciurus vulgaris, those from the Far East, from Koreaand Hokkaido,
are assigned to S. v. calotus Hodgs.t, whose typical locality is the
high region of Central Asia. But the valuable series obtained by
Mr. Anderson indicates that they are sufficiently different to have
a subspecific name of their own. For while the type of calotus
and other specimens from the Altai are, in winter pelage, a clear
deep grey above without rufous suffusion, the whole of the
Hokkaido examples are strongly suffused along the head, dorsal
area, and base of the tail with a colour between ‘* Mars-brown ”
and ‘‘ vinaceous-cinnamon ” of Ridgway, though paler than either.
Sides clearer and more silvery grey, especially on two patches on
each side, behind the shoulders and in front of the hips. Throat,
chest, and belly pure sharply defined white, the hairs white to
their roots. Har-tufts, hands, and feet blackish, more or less
speckled with fulvous. ‘Tail broadly washed with black, the basal
part of the hairs more or less greyish or fulvous.
In summer pelage the ground-colour (apart from melanism) is
dull reddish brown, with dark red ears and feet, and perhaps
sometimes a more or less red-washed tail. But every specimen is
to a certain degree affected with melanism, and the only one that
has the body, ears, feet, and proximal half of tail red, also has the
terminal half of the latter organ blackish, as the whole. of it is in
the majority of specimens.
Dimensions of the type, measured in the flesh:—
Head and body 244 mm.; tail 175; hind foot (s,u.) 60; ear 34.
Skull—ereatest length 54; basilar length 43.
Hab. Hokkaido. ‘Type from Aoyama.
Type. Adult male in winter pelaget. B.M. No. 6.1.4.128.
Original number 98. Collected 9 November, 1904.
Two specimens from Sdul, Korea, presented by Mr. C. W.
Campbell, and killed in January 1889, appear to be quite similar
to the Hokkaido Squirrel.
This Hastern form of S. vulgaris is no doubt most closely related
to S. v. calotus, but may be distinguished by. the rufous suffusion
along its dorsal area. This produces, at least in the winter coat,
a considerable resemblance to the Scandinavian Squirrel, but from
that animal it is readily distinguished by its dark ear-tufts and
feet, and by the sharp definition and complete whiteness of the
colour of the under surface.
This Squirrel is of course the Sciwrus varius of the ‘ Fauna
* P. Z.S. 1899, p. 3.
+ Mustela (2?) calotus Hodgs. Calc. Journ. N. H. ii. p. 221 (1842).
+ The hands and feet of the type have some of the red of the summer coat still
on them, and this specimen is not, as I at first thought, an exception to the rule
that the Hokkaido Squirrel has dark feet in the winter pelage.
1905. | MAMMALS FROM JAPAN, 347
Japonica,’ but that name, first used by Pallas for the Siberian
Squirrel, was rendered invalid by its previous use by Kerr, as
shown in Major Barrett-Hamilton’s paper.
25. Scrurus tis Temm.
@.7. Takayu, near Yonezawa, Uzeu, Northern-Central
Hondo, 3000’. 13 August.
@. 208. Nara, east of Hiogo, Hondo.
3. 242. ©, 249, 250. Washikaguchi, Nara Ken, Hondo.
The Uzeu specimen is in the red-footed summer pelage, without
ear-tufts; the othersare in the grey winter coat. By some curious
error, Temminck has described the former pelage as that of winter,
and the latter of summer, but even with only undated specimens
available, it is difficult to understand how such a mistake could
have been made, as the difference in the quality of the fur is very
considerable.
Mr. Anderson did not send any true Squirrels from Kiushiu
or Shikoku, but he tells me that they do occur there, though rare
and local.
Mr. Gordon Smith’s collection contains examples of Seiwrus lis
from Shimosa, Misaki, and the Hiogo Hills, all in Southern
Hondo.
“These Squirrels were shot in the groves of pine-trees along
the tops of ridges above the village. We found them scarce in
the neighbourhood, the three secured being the only ones seen.
Native name ‘ Kinezumi.’”—J/. P. A.
[GurRULUSs (g. n.) sAPONICUS Schinz.
Myoxus elegans Temm. 1844.
Although not included among Mr. Anderson’s captures, the
Japanese Dormouse needs a few remarks on its systematic
position and nomenclature, which may conveniently be made here.
Firstly in regard to its specific name. Temminck unfortunately
gave it a title which was preoccupied (Graphiurus elegans Ogilby,
1838* ; Myoxus elegans Wagn. 1843), and it was therefore renamed
first, in 1845, by Schinz, who called it javanicus, and then in 1882,
on the ground that javanicus was invalid owing to its incorrect-
ness, by myself, with the name of lasiotis.
But the plea of incorrectness is no longer admitted, and we are
therefore forced to take Schinz’s name. We may, however, look
upon it as a misprint for japonicus, and amend it accordingly, for
the statement ‘“ Habitat in Japonia” clearly shows that Schinz
did not suppose it came from Java, and the accidental alteration
of two letters only would make the difference. This course has
been already taken by Wallace‘, and is, I think, the best way out
of the difficulty.
With regard to the generic position of this Dormouse, I think it
* References to all the names here mentioned are given in Reuvens, ‘Myoxide ;
p. 66 (1890).
+ ‘Island Life,’ 2nd edition, p. 395 (1892).
348 MR. OLDFIELD THOMAS ON [ Nov. 28,
cannot be assigned to any of the existing groups and must have
a special name of its own. It is no doubt most nearly allied to
Eliomys (Dryomys, subg. n.) nitidalus* Pall., but may be readily
distinguished by the rather more complicated pattern of its teeth,
its small bulls, the absence of the angular foramen in its mandible,
and its peculiar and characteristic colour-pattern. These characters
are all brought out in Reuvens’s descriptions and figures, and do
not need further reference here. |
26. Mus norvecicus Erxl.
3g. 21. Jozankei, Sapporo, Hokkaido.
3. 96,97. Shinshinotsu, Sapporo, Hokkaido.
2.99. Aoyama, Hokkaido.
‘“‘ Caught in forest; extremely abundant.”
27. Mus tanezumi Temi.
@. 42. Makado, near Nohechi, Aomori Ken, N. Hondo. 400’.
$. 5. Takayu, near Yonezawa, Uzeu, Hondo. 3000’.
This is the Japanese representative of the Chinese Mus losea
Swinh.
28. Mus motossinus Temm.
@. 66. Tsunagi, near Morioka, Iwate Ken, N. Hondo.
@. 482. Tano, Miyasaki Ken, Kiushiu. 500’.
‘“¢ Contained 6 embryos 17 mm. in length.”
No. 66 has all the appearance of a wild-living individual,
not that of a house-mouse, and its proportions approximate to
those of the European Jus spicilegus. Head and body 92 mm. ;
tail 55; hind foot 15.
29, Micromys speciosus Temm.
6. 28, 30, 33, 34, 36. Q. 29, 37, 40, 41. Makado, near
Nohechi, Aomori Ken, N. Hondo.
6. 52, 54,160, 63, 77, 78. 9. 49, 59, 79, 82, 83. Tsunaeiy
N. Hondo.
Ga WOR, IG Is ito “Se Is Ite Ayer, Ibm, Si.10,
Hondo.
&. 189, 153, 156, 164. ©. 141, 150, 154, 157. Nakaomai,
Izu, 8.E. Hondo.
6. 276, 278, 279, 285, 302. 9. 264, 265, 266, 272, 277, 280,
284. Jinrio, Tokushima Ken, Shikoku. 500’.
3. 3380. 2. 331, 332, Sakawa, Kochi Ken, Shikoku.
6. 334, 335, 344. 9. 340, 341, 353, 356, 369. Ochi, Kochi
Ken, Shikoku. 200’—1000’.
3. 326, 327. 9. 328. Ikeda, Tokushima Ken, Shikoku.
@. 317, 318. Fukuhara, Tokushima Ken, Shikoku. 750’.
* Better known as dryas Schr. The peculiarities of this species, which, while
essentially an EHliomys, shows certain leanings towards Glis, demand a special sub-
generic name. Hlius Schulze is not available, being a synonym of Gis.
1905. ] MAMMALS FROM JAPAN. 349
3. 373, 374. 9. 375, 376. Kuma, Ehime Ken, Shikoku.
1200’.
3d. 459, 460, 461. 9. 452. Kawachi, Miyasaki Ken, Kiu-
shiu. 1500’.
3. 390, 391, 402, 411, 412, 425, 486, 487. 9. 393, 418, 419
426, 433. Takamori, Kumamoto Ken, Kiushiu. 1850’.
3. 483, 498, 499. 9. 484,491. Tano, Miyasaki Ken, Kiu-
shiu. 500’.
“*Common everywhere.’
Even with this fine series, combined with that sent by
Mr. Gordon Smith, I am unable to trace completely the relation
of the presence of spines in the fur to season and sex. Many
specimens of each sex are spinous, many spineless, and in a general
way it is clear that spines are a character of summer, while they
are rarely or never present in the winter pelage. Two examples,
however, killed in the middle of December have spines, and one
from Shikoku, killed in February, so that there are evidently
exceptions to the general rule.
Young specimens, before the development of the rufous colour,
are always spineless.
The mammary formula in this species is 2—2=8.
It appears probable that Temminck’s Mus argenteus, also
described in the ‘ Fauna Japonica,’ was based on small spineless
specimens of J/, speciosus.
The following are the dimensions (in mm.) of a pair from the
Izu peninsula :—
3. Head and body 128; tail 112; hind foot 24; ear 16.
2. 2 ” 115; ” 105; ” en; ” 15.
30. MICROMYS SPECIOSUS AINU, subsp. n.
3.10. Jozankei, near Sapporo, Hokkaido.
@. 26. Shinshinotsu, near Sapporo, Hokkaido.
©. 108,117. Aoyama, Hokkaido.
As in true speciosus, but with rather longer feet and longer
skull.
General characters as in the J/. speciosus of Hondo, with the
same dark fulvous colour blackened along the dorsal area and the
same whitish underside. Fur similarly either spinous or spine-
less. Hands and feet greyish white. Feet longer and heavier
than in true speciosus.
Skull rather narrower and more elongate than in true speciosus ;
palatal foramina longer.
Dimensions of the type, suSASEee in the flesh :—
Head and body 118 mm.; tail 107; hind foot 27-5; ear 15.
Skull—greatest length 31: basilar length 25; nasals 12:2;
soy amare breadth 48: breadth of brain-case 12°8; palatilar
length 14:4; diastema 9-5; palatal foramina 5°8; length of upper
molar series 4°2.
Hab. Hokkaido. Type from Aoyama.
350 MR. OLDFIELD THOMAS ON [Nov. 28,
Type. Female. B.M. No. 6.1.4.219. Original no. 117. Col-
lected 15 November, 1904.
Of the large series of JZ. speciosus from Hondo, enumerated
just previously, only one has a hind foot as much as 25:5 mim. in
length, the majority of the adults ranging from 23 to 25, And
of those from Shikoku and Kiushiu one only has 25°5, and
one 26. On the other hand, the four from Hokkaido are all
measured as 26 or over, and in addition their skulls are rather
more elongate, especially in the muzzle, than those of the more
southern form.
Under these circumstances, in view of the general difference
between the faunas of Hondo and Hokkaido, I have thought it
advisable to give the form from the latter island a special sub-
specific name, like as it is to its ally in all other respects.
31. Micromys GEtsHaA Thos.
Ann. Mag. N. H. (7) xv. p. 491 (1905).
¢. 32,35. 9.31. Makado, N. Hondo.
G0, 558,045 160,08.. Oh 69570) Tlf.) isumnaed, slevcain
Ken, N. Hondo.
®@.1,2,4. Takayu, Uzeu, Hondo.
Ge WAG WG Ma Oa Oe OdslOse Willies keamarias Iau,
S.E. Hondo.
6. 140, 147, 155. @. 148, 149, 158, 163. Nakoma, Izu,
S.E. Hondo.
Bs WO, CO, BOO, Oe ia; By SOO, sls diuiao; Wolk
shima Ken, Shikoku. 500’.
6. 351, 363, 364, 365, 366. 2. 352, 354, 362, 368. Ochi,
Kochi Ken, Shikoku. 1500'—2100’.
3g. 381. @. 372. Kuma, Ehime Ken, Shikoku.
$. 394, 401, 416. @. 409, 410, 417. Takamori, Kumamoto
Ken, Kiushiu. 1800’.
3. 453. ©. 451, 454. Kawachi, Miyasaki Ken, Kiushiu.
1500’.
Two specimens of this pretty little species were obtained by
Mr. H. Pryer in the Yokohama region in 1888, but it was only
when Mr. Gordon Smith’s collection was being worked out that
it was recognised as new. It would appear to be generally dis-
tributed over Hondo, Shikoku, and Kiushiu, and is represented
in Hokkaido by a short-eared subspecies.
Its mammary formula, as previously stated with doubt, is
2—2=8.
The following are the flesh measurements (in mm.) of a pair
from the Izu peninsula :-—
g. Head and body 94; tail 99; hind foot 20; ear 14.
2 : 2? 99 94; 9? 94 ; 79 Si 9 14,
32. MICROMYS GEISHA HOKKAIDI, subsp. n.
& 100, 110) 111, 1112, 1184 9.) 109" 1119)) 120.) Aoyama,
Hokkaido.
1905. | MAMMALS FROM JAPAN. 351
6. 122, 123, 124, 130; 134,137. @. 135. Noboribetsu, near
Moruran, Hokkaido.
“Common in bamboo-grass.’
Similar to true WZ. g geisho: i in all respects except that the general
colour averages slightly paler (nearly as pale as “isabella,” but
of a more rufous brown), and the ears are decidedly shorter.
Dimensions of the type, measured in the flesh :—
Head and body 90 mm.; tail 95; hind foot 19; ear 12°5.
Skull—greatest length 23°5 ; basilar length 18; ‘palatilar length
10; palatal foramina 5; length of upper molar series 3°6.
Hab. Hokkaido; type from Noboribetsu.
Type. Adult male. B.M. No. 6.1.4.269. Original number 123.
Collected 21 November, 1904.
The ear-measurement of J/. geisha was given in the original
description as 12°5 mm., but this was taken on a poorly-made skin,
and it is evidently Below the correct dimensions. For of nine
adult Izu examples seven have been measured by Mr. Anderson as
14 mm., and two as 13°5, while of thirteen adult Hokkaido skins
two have this measurement 12, two 12°5, eight 13, and one 13:5.
Little as this difference sounds in figures it is easily recognisable
by eye.
The occurrence in Hokkaido of representatives of MJicromys
speciosus and geisha shows that there is a genuine Japanese
element in the fauna of that island, mixed with the boreal non-
Japanese fauna indicated among others by the occurrence of
Sciurus vulgaris instead of lis, and Lepus timidus instead of
brachyurus.
33. MICROMYS MINUTUS JAPONICUS, subsp. n.
6. 286. Jinrio, Tokushima Ken, Shikoku. 500’.
3. 322. Tanano, Tokushima Ken, Shikoku. 250’.
@. 462. Kawachi, Miyasaki Ken, Kiushiu. 1500’.
General colour above dusky sepia, the rump only rufous, as in
the Eastern forms of minutus; belly sharply contrasted white,
though with slaty bases to the hairs, as in the European races.
One old specimen, however, is more or less rufous over the whole
of the upper surface ; but this would seem to be an exception.
Skull apparently thicker and heavier than in the other races,
with an unusually large brain-case and short muzzle, but material
is lacking for a satisfactory comparison with the Eastern forms
pygmeus and ussuricus*. Molars decidedly larger than in
ussuricus, which has the tooth-row only 2°8 mm. in length.
Dimensions of the type, measured in skin :—
Head and body 66 mm.; tail 61; hind foot 14:5.
Skull—basilar length 13-7; interorbital breadth 3:4; breadth of
brain-case 9°3 ; palatilar length 8; diastema 4°5 ; palatal foramina
3; length of upper molar series 31.
* The type of wsswricus has a hind foot 14 mm. in ength, not 12 as given in the
original description.
352 MR. OLDFIELD THOMAS ON [ Nov. 28,
Dimensions of one of Mr. Anderson’s specimens, measured in
the flesh :—
Head and body 59 mm.; tail 55; hind foot 15; ear 7.
Hab. Southern Hondo, and the islands of Shikoku and Kiushiu.
Type from Tosa, Kochi Ken, Shikoku.
Type. Adult male. B.M. No. 5.3.3.44. Collected 15 February,
1904, by R. Gordon Smith, Esq.
The occurrence of the Harvest-Mouse in Japan was recorded
by Temminck. ;
34. MiIcRoTUS MONTEBELLI M.-Edw.
Arvicola montebelli M.-Edw. Rech. Mamm. p. 285 (1874).
(Fusiyama.)
Arvicola hatanedzumi Sasaki, Bull. Tokyo Coll. Agric. vi. p. 51
(1904). (Tokyo.)
3. 39. @. 38, 43, 45,46. Makado, near Nohechi, Aomori
Ken, N. Hondo.
3. 80, 84, 85, 86. ©. 81, 87, 88, 89, 90, 91, 92. Morioka,
Iwate Ken, N. Hondo.
go. 151. 2.159. Nakaomi, nr. Ohito, Izu, 8.E. Hondo.
Q. 464, 467. Kawachi, Miyasaki Ken, Kiushiu. 1500’.
The British Museum owes to the kindness of Prof. Sasaki
representative examples of the Vole described by him as Arvicola
haianedzumi, and with these Mr. Anderson’s specimens entirely
agree. But Prof. Sasaki’s name is unfortunately antedated by
that given by Milne-Kdwards in 1874, the type of which latter is
in the Paris Museum.
This type was carefully examined by Mr. Gerrit Miller during
his recent visit to Europe, and on his later studying in London
the specimens of ‘‘ hatanedzwmi” from Tokyo, and a series from
_ Misaki sent home by Mr. Gordon Smith, he came to the conclusion
that all belonged to one species, a conclusion from which I see no
reason to differ.
One (No. 80) of the twenty-three specimens has a supplementary
agrestis-like lobe on m’, but does not differ from the rest in any
other respect.
This Vole is evidently rare in Shikoku and Kiushiu, for
Mr. Anderson obtained no example of it in the former island and
only two in the latter.
35. Evotomys MIKADO Thos.
Evotomys mikado Thos. Abstr. P. Z.8. No. 23, p. 19, Dec. 5,
1905.
3g. 121. Noboribetsu, near Moruran, Hokkaido.
9.107. Aoyama, Hokkaido. 400’. Type.
‘Under moss-grown log in forest of alders and birches.”
A true Hvetomys of medium size, similar in general appearance
to Danish examples of #. glareolus.
Rufous dorsal area covering the whole top of the head and
breadth of the back fairly well defined laterally, especially on the
1905. | MAMMALS FROM JAPAN. 353
fore-quarters; its colour rather redder than in #. glareolus,
approaching “ hazel” of Ridgway. Sides greyer. Belly washed
with pale buff, not sharply defined laterally. Ears bright rufous.
Upper surface of hands and feet pale brownish white. Tail of
medium length, well-haired and tufted, dark brown above, dull
white below, the terminal tuft black above, whitish below.
Skull rather flatter than in #. glareolus, with a low weak
muzzle and the frontal outline not so convex. Palatal foramina
longer. Choanze broad and low, their structure as usual.
Molars with the same essential pattern asin /. glareolus, but
they are peculiarly compressed from before backwards, so as to be
unusually broad in proportion to their length, this proportion also
being shown in the individual cement-spaces, which are broad
transversely, short antero-posteriorly, and with their lateral
angles (especially the outer above and the inner below) very
sharp.
Dimensions of the type, measured in the flesh :—
Head and body 104 mm.; tail 34; hind foot 17; ear 11:5.
Skull—tip of nasals to back of frontals 15°5; nasals 6°7 x 2°9 ;
height of muzzle behind incisors 3°5; interorbital breadth 3:8 ;
palatilar length 10-4; diastema 7; palatal foramina 5; length of
upper molar series (crowns) 4°7.
Type. Adult female. B.M. No. 6.1.4.296. Original number
107. Collected 13 November, 1904.
The occurrence of a typical Hvotomys in Hokkaido was quite
to be expected from the general character of the fauna of that
island.
36. Evoromys (CRASEOMYS) BEDFORDIH Thos.
Evotomys bedfordie Thos. Abstr. P. Z. 8. No. 23, p. 18, Dee. 5,
90
Ue
6. 22, 23, 24. 9. 25, 27. Shinshinotsu, near Sapporo,
Hokkaido. Below 100’.
SolOily MOA, MOG, Wile WW Is NGS Oe Oss owen,
Hokkaido. 200’.
‘On plains covered with tall grass and scattered alders.”
‘Tn bamboo-grass.”
Size about as in the Scandinavian #. (C.) rufocanus Sund. Fur
as in that species, long and loose; hairs of back about 10 mm. in
length. (General colour less contrasted red and grey than in r2fo-
canus, the back darker chestnut, more /. glareolus-like, and the
sides darker and less sharply contrasted grey. Under surface dull
greyish washed with buffy. Crown rufous-chestnut, like the back.
Kars inconspicuously reddish. Cheeks like sides. Upper surface
of hands and feet dull greyish, the fingers whiter. A prominent
glandular patch present in the male on each flank in front of the
hip, rather further back than in #. rwfocanus. Tail considerably
longer than in rwfocanus, less thickly haired, the rings of scales
not hidden ; brown above, dull white below.
Skull apparently very much as in Z. rufocanus. It may be
304 MR. OLDFIELD THOMAS ON | Nov. 28,
noted that in not one of the specimens are the two bridges over —
the lateral grooves on the posterior palate complete, while they
appear to be always complete in true Hvotomys.
Teeth broad and powerful, their pattern much asin #. rufo-
canus; last segment of m® simple, with scarcely any trace of a
postero-internal re-entrant angle.
Dimensions of the type, measured in the flesh :—
Head and body 119 mm. ; tail 47 ; hind foot (s.u.) 20; ear 15.
Skull—greatest length 27:8; basilar length 24; zygomatic
breadth 16 ; length of nasals 8 ; interorbital breadth 3-7; diastema
79; palatilar length 13; palatal foramina 5-7; length of upper
molar series 6°4; breadth of front lamina of m? 1°3.
Hab. Hokkaido. Type from Shinshinotsu.
Type. Adult male. B.M. No. 6.1.4.298. Original number 23.
Collected 10 September, 1904.
T have named this handsome Vole after Her Grace the Duchess
of Bedford, whose interest in zoology is not less than that of her
husband.
E. bedfordie agrees with the Scandinavian L. rufocanus, the
type of the subgenus Craseomys, in all essential particulars, but
may be readily distinguished by its more glareolus-like colour, less
contrasted back and sides, and longer, less hairy tail.
E. (C.) latastet Allen, from Kamtchatka, is a considerably
smaller animal.
An example of this species was obtained by the late Dr. John
Anderson in Hokkaido in 1885, and presented by him to the
British Museum, but has not hitherto been identified.
37. Evoromys (CRASEOMYS) ANDERSONI Thos.
Hvotomys andersoni Thos, Abstr. P.Z.S8. No. 23, p. 18, Dec. 5,
1905.
3. 76. Tsunagi, near Morioka, Iwate Ken, N. Hondo. (7'ype.)
6.44. Makado, near Nohechi, Aomori Ken, extreme North
Hondo.
Very like H. (Craseomys) bedfordie externally, but with longer
tail, and the teeth much less powerful.
General external appearance almost exactly the same as in
E. bedfordic, the fur of the same long loose texture, and the
colour similarly dark lined chestnut passing gradually into
greyish on the sides, without the marked contrast found in
EF. rufocanus. Under surface rather darker buff than in £. bed-
fordiec. Feet rather shorter than in the allied species; tail
longer, its dark upper less contrasted with its pale lower surface.
Skull of the same general shape as in /. bedfordic, and with
the same long parallel-sided interorbital region, but more lightly
built throughout. Palatal foramina shorter. Hinder edge of
palate with the bridges over the lateral grooves complete.
Teeth conspicuously lighter and weaker than in /. bedfordie,
the incisors and all the molars much narrower. Pattern in a
1905. ] MAMMALS FROM JAPAN. 355
general way similar, but the broad bold outlines of #. bedfordice
are replaced by a weaker and more rounded pattern, more like
that of ordinary Hvotomys, to which this species shows some
approximation. But the teeth are rootless, and with m° and m,
encapsuled as in Craseomys. Posterior section of m* more com-
plicated than in bedfordiw, forming an inturned C, there being
three re-entrant angles on each side of this tooth, the last at least
half as deep as the two anterior ones. In JZ, bedfordiw and
E. rufocanus there is scarcely any trace of a third concavity on
either side, while the two anterior re-entrant angles are exceed-
ingly deep and bold.
Dimensions of the type, measured in the flesh :—
Head and body 120 mm.; tail 54; hind foot (s.u.) 18-5; ear 13.
Skull—ereatest length 26°6; basilar length 22°7; zygomatic
breadth 15; length of nasals 7:8; interorbital breadth 3°3;
diastema 7; palatilar length 12:2; palatal foramina 5; length of
upper molar series 5-1 ; breadth of front lamina of m? 0°9.
Hab. Northern Hondo. 'Type from near Morioka.
Type. Adult male. B.M. No. 6.1.4.807. Original number 76.
Collected 10 October, 1904.
The second specimen (No. 44) is younger and therefore more
greyish brown in colour, and its teeth are more angular than those ©
of No. 76. But I do not think that there is any doubt as to its
belonging to the same species as the type.
T have named this interesting Volein honour of Mr. Anderson,
its discoverer, who has so far carried out the Duke of Bedford’s
exploration with conspicuous success.
38. Evoromys (PHAvLomys) smirHit Thos.
Evotomys (Phaulomys) smithii Thos. Ann, Mag. N. H. (7) xv.
p. 493 (1905).
g. 146. &. 160. Nakaomi, nr. Ohito, Izu Peninsula, 8.H.
Hondo. 400’.
3. 345, 346, 347, 348, 359, 360. 9. 333, 349, 350, 361, 362.
Ochi, Kochi Ken, Shikoku. 1400’.
G26 200. Zils 296.4297, Slo. 287, 291, 293 tedimmio,
Takushima Ken, Shikoku. 500’.
$. 382, 383, 384. Kuma, Ehime Ken, Shikoku. 1200’.
$. 315. @.316. Fukuhara, Tokushima Ken, Shikoku. 750’.
g. 325. Ikeda, Tokushima Ken, Shikoku.
@. 320. Yanainidane, Tokushima Ken, Shikoku. 1600’.
3. 387, 388, 399, 407, 414, 424, 431,445. 2. 386, 389, 400,
415, 439, 440, 441. Takamori, Kumamoto Ken, Kiushiu.
3. 465. 9. 448,449, 450, 455, 457, 468, 469, 470. Kawachi,
Miyasaki Ken, Kiushiu. 1500’.
3.478. Mitai, Miyasaki Ken. 1000’.
This fine series, numbering 53 examples, of the new form of
Red-backed Vole discovered by Mr. Gordon Smith, adds con-
siderably to our knowledge of its variation and distribution. It
356 MR. OLDFIELD THOMAS ON [ Nov. 28,
would seem to be widely spread over Southern Hondo, 8. of 35° N.,
and to be common in both Shikoku and Kiushiu, its distribution
thus corresponding with that of somany Japaneseanimals. There
does not appear to be any tangible difference between the speci-
mens from the Izu Peninsula, from the type locality, Kobe, or from
the two southern islands, Shikoku and Kiushiu. In each place,
however, there seems a good deal of variability, both in colour,
which ranges from a light russet-brown to a dark “ vandyke-
brown,” and in tooth-pattern.
In the latter respect the following description applies to the
majority of the specimens, the type being among the minority ,
but there is every gradation between the two.
M? with the first outer and inner re-entrant angles subequal,
the latter being much deeper in the type; second and third
spaces partially, and in some cases fully, separated, not continuous
as in the type; fourth space not always separated off from the
posterior C; head and tail of the C strongly developed, with a
deep re-entrant angle between them, as deep as the one before the
head, the third internal projecting angle of the tooth; there are,
therefore, three subequal internal re-entrant angles, while in the
type there are two deep ones only (the second deeper than is
shown in my figure and running more directly backwards), the
third being represented by a quite inconspicuous concavity.
Similarly on the outer side of the tooth the third concavity is
usually far more marked than in the type. As a result of these
variations in the depths of the re-entrant angles, the whole tooth
appears more bilaterally symmetrical than in the figured specimen.
Below, the spaces of m, are usually less uniformly coalesced with
each other, and the slight antero-internal concavity of the front
trefoil is often developed into a well-defined re-entrant angle, so
that there are four inner re-entrant angles to the tooth instead of
three.
The measurements (in mm.) in the flesh of two Kiushiu adults
are as follows :—
gS. Head and body 100; tail 50; hind foot 17-5; ear 11.
Pray! tas » 103; ,, 49; » 180; ,, 12.
With regard to the number of the mamme, there appear to be
only 6, two inguinal pairs and a posterior pectoral pair, no trace
of an anterior pectoral pair being discoverable. But the exami-
nation has only been made on skins, none of them killed in the
breeding-season, and must therefore not be looked on as final.
‘¢ Lives both in forest and on grassy hill-sides.”—J/, P. A.
39, Lepus TIMIDUS AINU Barr.-Ham.*
3. 129. Noboribetsu, near Moruran, Hokkaido.
In the white winter pelage.
Dimensions in the flesh :-—
Head and body 510 mm.; tail 85; hind foot 142; ear 65.
* P,Z.S. 1900, p. 90.
1905. | MAMMALS FROM JAPAN. 307
40. Lepus BRAcHYURUS Temm.
3.3. Takaya, near Yonezawa, Uzeu, Hondo.
S. 175. Tajinia, Izu Peninsula, 8.E. Hondo.
3. 180. Ohito, Izu Peninsula. 100’.
3. 235, 242. 9. 239, 244. Washikaguchi, Nara Ken,
Hondo.
3. 282, 305. 2. 283, 306, 307. Jinrio, Tokushima Ken,
Shikoku.
3. 421. 2. 413. Takamori, Kumamoto Ken, Kiushiu.
Dimensions of an adult female in the flesh :—
Head and body 505 mm.; tail 40; hind foot 135; ear 78.
“Very common ; called ‘Usangi’ by the Japanese.’—/, P. A.
4], PENTALAGUS FURNESSI Stone,
3. 600, Oshima, Okinawa, Liu-Kiu Is.
This specimen of the interesting Liu-Kiu Hare was presented
to Mr. Anderson by My. Alan Owston, of Yokohama. It agrees
with the type in the possession of only five upper cheek-teeth.
Another specimen is now living in the Duke of Bedford’s
menagerie at Woburn.
42. Sus tEucomystTax Temm.
@. 252. Washikaguchi, Nara Ken, Hondo.
“The Wild Boar is very common, some 500 being killed yearly
in Nara Ken alone. Japanese name ‘ Inoshishi,’”— I, P. A.
43, NEMORHDUS CRISPUS Temm.
3. 229. 9. 230. Washikaguchi, Nara Ken, Hondo.
“The Goat-Antelope is exceedingly rare in Nara Ken, and
probably everywhere, for this is but the second place where I have
heard of its existence. I was told that 5 to 7 are killed yearly
in Nara Ken. It inhabits dense forested heights, and when
pursued seeks the rockiest and most precipitous places where it
can find cover. Japanese name ‘ Niku.’”—J/. P. A.
44, Cervus stkA Temm.
@, 228. Washikaguchi, Nara Ken, Hondo,
““Common, many hundreds being killed yearly by the natives.
Native name ‘ Shika.’ ”—J, P. A.
APPENDIX,
On Collections from the Islands of Oki, Yakushima, and
Tanegashima,
I. Oxr Isuanps.
These islands lie about 50 miles out at sea, north of Matsuye,
towards the western end of South-west Hondo. Mr. Anderson
says :—‘‘ Dogo Island, the largest of the group, is a heavily-wooded,
358 MR. OLDFIELD THOMAS ON [ Nov. 28,
mountainous island, rising in places to over 2000 feet. Only the
broadest valleys are cultivated, and the hill-sides near the sea.
The mountains are steep, but not usually rocky. With few
exceptions dense forest clothes all the mountain-sides and tops.
It consists of oaks, elms (‘zelkova’), chestnuts, camelias, pines,
firs, and eryptomerias.
“The island is well watered. We had frequent heavy rains
during our stay, which was from June 28 to July 12. The
prevailing temperature at the little interior hamlet where we
stayed was 74° F. at noon. The nights were slightly cooler.”
Of the geology Mr. Robert Anderson says: ‘‘ Dogo seems to be
founded on a formation of very old gneiss of sedimentary origin,
which is concealed over much of the surface by recent volcanic
vocks and local Tertiary deposits.”
31 specimens were obtained in Dogo, belonging to the following
six species. Several show some slight modification as compared
with their Hondo allies.
1. MocEra woGuRA KoBE#, Thos.
3g. 586, 587, 596, 602. 2. 582, 585, 588, 589, 590, 594, 595,
597, 601, 605, 607, 610. Dogo Island. 100’.
These specimens are in no way distinguishable from the large
Mole of 8.W. Hondo.
Their skulls, without exception, are all within the narrow
limits of 38 to 40 mm. in total length.
2. URoOTRICHUS TALPOIDES T'emm.
g. 591. Dogo Island. 100’.
3. CROCIDURA DSI-NEZUMI Temm.
g. 599. Dogo Island. 100’.
4. MicROMYS SPECIOSUS NAVIGATOR *, subsp. n.
3d. 583, 592, 593, 603. ©. 580, 584. Interior of Dogo
Island.
General characters as in Japanese speciosus, though the colour
is a little duller than the average and the feet are more brownish
ervey, not so distinctly white. Tail markedly shorter than m any
specimens from elsewhere.
Skull as in true speciosus.
The following are the dimensions (in mm.) of four well-grown
specimens :—
ae Head and body 112; tail 87; hind foot 24:5; ear 16.
te eee e gy B20 Soe SS. i Dias ee Orn
gd (Type) ,, OS OS my) OD hey ID.
Or Bras = eae ree eS, . DAS samme
Skull of type—greatest length 29 mm.; basilar length 23;
length of upper molar series 4:2.
* Qki=out in the sea, out in the offing.
1905. ] MAMMALS FROM JAPAN. 359
Type. Young adult male. B.M. No. 6.1.4.378. Original
number 583. Collected 30 June, 1905.
This insular form of the common Japanese Field-Mouse is
readily recognisable by its much shorter tail, this organ in true
speciosus being rarely less than 100 mm. in length.
5, MICROMYS GEISHA CELATUS, subsp. n.
3. 598,611, @. 581, 606. Interior of Dogo Island. 100".
Average size distinctly smaller than in mainland geisha, and
the tail proportionally short. Fur fine and close; hairs of back
about 6-7 mm. in length. Colour as in true geisha.
Dimensions (in mm.) of three specimens, measured in the flesh :—
3 (Type) Head and body 80; tail 80; hind foot 19; ear 15.
Eeenee im iy? OOF Rs Oey wae
OP ier 5 Se ES aN se TOS a acmlicte
Skull of type—greatest length 24 mm., length of upper molar
series 3°6.
Type. Male. B.M. No. 6.1.4.385, Original number 611
Collected 10 July, 1905.
These insular examples of the common geisha-mouse are 5—
15 mm. less in the head and body measurement, and 5-20 less
in the taiJ, than specimens from the mainland, but are like the
latter in all other respects.
6. LEPUS BRACHYURUS OKIENSIS, subsp, n.
3. 609 (yg.). 2. 604, 608 (yg.). Dogo Island, 100’,
Size and other essential characters as in true brachyurus, but
the colour heavily blackened throughout, more or less melanistic.
Of the type, the only adult, the general colour above is uniform
bistre-brown, the ordinary subterminal buffy rings on the hairs
being either absent or much reduced. Central area of face and
crown similar to back, as are the cheeks; a lighter line running
from the whiskers past the eyes to the ears. Nape brown. Ears
with the proectote* deep black, inconspicuously fringed with
buffy ; metentote blackish proximally, brownish buffy terminally,
outer fringe narrow, dull buffy, inconspicuous ; metectote brown
proximally, the terminal half-inch black. Sides little hghter than
back. Interramia dull whitish, reduced in size by the extension
of the black chin-patch. Collar deep bistre-brown. Belly dull
whitish. Limbs coloured like back, the long hairs of the feet
* Hvery mammalogist in describing specimens has felt the need for names to
characterise the different parts of the ear when folded, as in repose. The anterior
third and posterior two-thirds of the outer surface, and the same of the inner, make
four areas always distinguished from each other by colour or degree of hairiness, and
constantly have to be described. If, therefore, the whole outer surface of the ear be
called the ectote, we may call its anterior part the proectote and the posterior the
metectote. Similarly the inner surface would be the entote, its anterior part the
proentote and the posterior part the metentote. In ordinary specimens, with
the ears folded back, it is the proectote and the metentote which are visible and
characteristically coloured, while the metectote and proentote are commonly more
or less naked and colourless.
Proc. Zoou, Soc.—1905, Vou. Ll. No. XXV., 25
5
360 MR. OLDFIELD THOMAS ON [ Nov. 28,
smoky blackish. Tail black above, very slightly more greyish
below.
Skull as in true brachyurus.
Dimensions of the type, measured in the flesh :—
Head and body 506 mm.; tail 54; hind foot 138; ear 78.
Type. Adult female. B.M. No. 6.1.4.389. Original number
604. Collected 7 July, 1905.
This Hare affords an instance of the blackening so often found
in insular forms. No doubt it is a kind of melanism, but the
indications given by three specimens, even though they differ in
degree, that the darkening is not spasmodic or individual, renders
it necessary to recognise the animal by a subspecific name*.
I]. YAKUSHIMA.
Yakushima was not visited by Mr. Malcolm Anderson, but by
his brother, Mr. Robert V. Anderson, who had been helping him
in his collecting work in Kiushiu, Shikoku, and the Oki Islands.
The following is an extract from the admirable notes on the
island he has given me :—
““'Yakushima lies some forty miles south of the southernmost
headland of Kiushiu, a few miles south-west of Tanegashima, and
between 30° 15’ and 30° 25’ N. lat. It is one of the Osumi
group of small islands which are the most northerly of the
Liu-Kiu curve. It is extremely mountainous in character, the
only approximation to the level being along the coast whence a
gentle incline slopes to the steep hills a quarter of a mile to a mile
away. The island is seen from the sea as a mass of densely-
forested high mountains with straight low coast-line, several
ridges that inclose basins culminating centrally in Miyanoura-
dake at an altitude of more than six thousand five hundred feet.
The island is circular, with a diameter of about fifteen miles.
The sides of the hills usually slope at an angle of forty-five
degrees, except here and there where great cliffs of granite make
a break in the forest.
“The climate is very wet, and the island abounds in streams and
mountain-torrents. Light snow sometimes falls, even in summer,
on the highest peaks.
“There are no rabbits or martens in Yakushima, but, according
to native reports, weasels are common.”—A. V. A.
Although he heard of them from the natives, Mr. Anderson
was not able to obtain any specimens of the Yakushima monkey,
weasel, or deer; but it fortunately happens that a collection of
Mammals has just been acquired by the Museum from Mr. Alan
Owston, which contains examples of the first and third, besides a
weasel from Tanegashima, and I therefore record them here, so
as to complete the list of the Mammals known to exist in the
island.
* Mr. Anderson has since written to me expressing his conviction that the Oki
Hare is constantly different from that from Hondo.
1905. ] MAMMALS FROM JAPAN. 361
1. Macacus Fuscatus, Bly.
36. Owston Collection. Nos. 1, 3,4. @Q. 2, 5.
These specimens are dark in colour, but not darker than some
of the Shikoku examples.
2. MoGERA WOGURA KANAI, subsp. n.
3. 560, 561, 564, 566, 569, 571, 573, 574. 2. 562, 563.
Miyanoura, Yakushima. Sea-level.
Two specimens in the Owston Collection.
A small insular form, rather larger than the typical wogura of
Yokohama, far smaller than the large kobee of 8.W. Hondo,
Shikoku, and the Oki Islands. Colour rather dark, tending towards
slaty ; not so brown as in kobec.
Dimensions of the type, measured in the flesh :—
Head and body 138 mm.; tail 14; hind foot 19.
Skull—egreatest length 35; basal length 30°3; greatest breadth
16:6; front of upper canine to back of m’ 12°8.
Lengths of six other skulls, all male—36°2, 36°5, 35:1, 34:9,
36°5, 35:4.
Type. Old male. B.M. No. 6.1.4.394. Original number 569.
Collected 13 June, 1905.
The recurrence of a small Mole at the south-west corner of the
Japanese Islands, separated from the other smail one of N.K.
Hondo by the large kobew, renders it a difficult matter to know
how best to name the different forms. But as in my paper
describing kobe the original wogura is allocated to the Yokohama
animal, it seems better to maintain that reference in the absence
of direct evidence to show that wogura was given to the small
Mole now described.
The extreme uniformity in the size of the specimens is very
noteworthy.
At the instance of Mr. Robert Anderson I have used for this
Mole the name of Mr. K. Kanai, a native Japanese helper, to
whom he and his brother were much indebted for assistance.
Mr. Anderson states that the Mole is exceedingly common in
Yakushima, where the damp climate no doubt produces a plentiful
crop of earthworms.
3. CROCIDURA DSI-NEZUMI UMBRINA T'emm. (?).
@. 547. Miyanoura. 40’.
“Caught in forest of large trees and bamboo undergrowth.”—
tig Vole
This Shrew is rather darker and longer-tailed than the
ordinary Japanese C’. dsi-nezwnui, and may represent the form
described by Temminck as Sorex umbrinus.
4. Mus motosstnus 'Temm.
3S. Miyanoura, Yakushima. 500’,
25*
362 ON MAMMALS FROM JAPAN. [ Nov. 28,
5. Micromys sprecrosus Temm.
3. 556. 9. 545. Miyanoura, Yakushima. Sea-level to 400’.
These specimens are rather more heavily blackened on the
; ,
back than average mainland examples.
6. MicrRoMyYs GEISHA YAKUI, subsp. n.
g. 549, 551, 552.. 9. 548, 550. Mountains of Centvral
Yakushima, 3500’.
Size and length of tail about as in typical geisha, but the feet
unusually long and heavy. Colour rather darker and fur longer
(hairs of back 7-8 mm.).
Dimensions (in mm.) of three specimens, taken in the flesh :—
Gus ose Head and body 88; tail 101; hind foot 21 ; ear 15.
Ou (ype) ee, » 86; ,, 96; Be AO ee
Ofte tia un sb, eke io. OGs i Ae ee shad:
Skull of type—greatest length 25; length of upper molar
series 4.
Type. Female. B.M. No, 6.1.4.407. Original number 548.
Collected 7 June, 1905.
_ The long and rather dark fur of the Yakushima geisha is
probably due to the extreme dampness of the island, where the
rain is heavy and continuous.
These Mice were obtained during a trip Mr. Anderson made
up to the mountainous centre of the island, part of the way down
into the basin which succeeds the highest ridge to be seen from
the sea. They appeared to be abundant in the forest.
7. Cervus stkA Temm.
3. Owston Coll. No.1. Yakushima.
III. TANEGASHIMA.
‘“Tanegashima lies between Yakushima and the mainland of
Kiushiu, from which it is distant about 20 miles. It is com-
paratively flat, the highest ridge attaining about 1200 feet. It
is cultivated except on the central hills, which are covered partly
with forest, partly with grass.
“Monkeys, weasels, deer, and boars were reported to us by
the natives. No hares exist here.’—J/. P. A.
Mr. Anderson only succeeded in obtaining examples of the two
usual species of Micromys. A weasel from Tanegashima is in
the Owston Collection.
1. Purortus rrarsr Temm.
@. Owston Coll. No.1. Tanegashima.
2. Micromys specrosus 'lemm.
go. 522, 524. 2. 523, 525. Northern Tanegashima. Sea-
level,
1905.]| = - ON THE FISHES OF THE FAMILY GALAXIID. 363
3. 527, 528, 537, 538, 539. 2. 526, 529, 531, 532, 533, 534,
540. Central Tanegashima. 300
3. 542. ©. 543,544. Nishinoomote, Tanegashima. 150’.
3. Micromys GEisHa Thos.
3. 536. ©. 535, 539, 541. Central Tanegashima. 300’.
These specimens are intermediate, as should be the case,
between the long-footed yakuz and the ordinary geisha of Japan.
Three of the specimens are measured as having the hind foot
19°5 mm.
EXPLANATION OF PLATE IX.
Mustela melampus bedfordi, p. 343.
4. A Revision of the Fishes of the Family Galavide.
By C. Tare Ruean, B.A., F.Z.S.
{Received October 26, 1905. |
(Plates X.—XITI.*)
The Galaxiide are a family of Teleostean Fishes which are placed
by Boulenger in the Haplomi, a suborder defined by the abdominal
ventral fins, the persistent pneumatic duct, and the absence of a
mesocoracoid element in the pectoral arch.
They may be thus defined :—
Maxillary behind the premaxillary and toothless, but to a
certain extent bordering the mouth. Parietals in contact,
separating the frontals from the supraoccipital; orbitosphenoid,
basisphenoid, and opisthotic wanting; pro-otics not forming a
roof for the eye-muscle canal, which is confluent with the cranial
cavity ; mesethmoid small, unpaired. Ribs attached to auto-
genous pavapophyses; epipleurals and epineurals present. Post-
temporal simple, attached to the epiotic; pectoral pterygoids
normal, 4 in number. 5 to 11 branchiostegals; gill-membranes
free from the isthmus; pseudobranchie present; four gills, a
slit behind the fourth. Body naked. No adipose fin, Pectorals
placed low; ventrals, if present, with 6 or 7 rays. Air-bladder
present. Ova falling into the abdominal cavity before extrusion,
The closely allied Haplochitonidee differ in the greater develop-
ment of the premaxillaries, the presence of a roof for the eye-
muscle canal, formed by the pro-otics, and in having an adipose fin.
The Esocide of the Northern Hemisphere resemble the
Galaxiidee and Haplochitonide of the Southern in the primitive
structure of the vertebral column, also in the shape of the cranium,
the orbitosphenoid wanting and the opisthotic very small or absent.
However, the presence of well-developed paired ethmoids and the
separation of the parietals by the supraoccipital are cranial
differences of considerable importance.
* Hor explanation of the Plates, see p. 383.
364 MR. C. TATE REGAN ON THE FISHES [ Nov. 28,
So long as they were supposed to be a fresh-water group, the
geographical distribution of the Galaxiidee was considered to be of
considerable interest, occurring as they do in the Southern half of
Australia, Tasmania, New Zealand and the neighbouring islands,
Chile, Patagonia and the Falkland Islands, and at the Cape of
Good Hope.
The occurrence of Galaxias maculatus in the sea has been
recorded by Valenciennes and by Philippi, off the Falklands and off
the coast of Chile respectively. The observations of Johnston in
Tasmania and of Hutton and Clarke in New Zealand are to the
effect that Galaxias attenuatus descends to the sea periodically to
spawn. Mr. Rupert Vallentin has seen shoals of little fishes,
which I identify with the Galaxias gracillimus of Canestrini, in
the sea at the Falkland Islands. Recently Galaxias brevipinnis
has also been found to be marine, G. 6ollansi, described by
Hutton from the Auckland Islands, proving to be identical with
this species.
The Galaxiide present many analogies to the Salmonide of the
Northern Hemisphere, both being circumpolar groups of marine
origin which are establishing themselves in fresh-water. In both
families we meet with non-migratory forms which appear to have
finally left the sea and with others which return to the sea
periodically; but whilst the migratory Salmonide are anadromous,
the migratory Galaxiidee, on the contrary, are catadromous.
The enormous range of variation in the fresh-water Salmonide
renders the delimitation of species a matter of great difficulty,
and so it is with the Galaxiide, with the similar result that a
large number of nominal or insufficiently defined species have
been described.
Tn some species numerous small blackish spots on the body and
fins, due to the presence of parasitic organisms, are almost always
present, and have been mistaken for colour-markings characteristic
of the species (e.g. G. lynx and G. olidus).
The burrowing-habits of a species of Galaxias have been recorded
by T. S. Hall (Vict. Nat. xviii. 1900, p. 65), who states that,
according to the observations of Mr. Russell Ritchie of Launceston,
in Tasmania Galaxias have been dug up in moist peaty soil, and
swim when placed in water. As many as twelve at a time have
been dug up in one place and lived in water in a pickle-jar for
various periods up to three days. The loss of the ventral fins and
the small eyes of the New Zealand Neochanna apoda, which
burrows in damp clay, show its special adaptation to similar habits.
The material on which the present revision is based consists of
the specimens in the British Museum, including all the types
described by Richardson and by Giinther, as well as a series of
specimens from Tasmania, sent by Mr. R. W. Johnston in 1880,
representing the species described by him, and typical examples of
G. nigothoruk Lucas and G. bollanst Hutton. A large series of
specimens has been received from the Australian Museum, in-
cluding the types of G. occidentalis, G. waterhousei, and G. kayi.
1905. ] OF THE FAMILY GALAXIIDA. 365
The author has also been permitted to examine the types of
G. scriba and G. ornatus, preserved in the Paris Museum, and
those of G. attenuatus, G. maculatus, and G. alpinus, in the
Museum of the University of Cambridge.
The author wishes to gratefully express his thanks to the
Director of the Australian Museum, to Mr. E. R. Waite, to
Professor L. Vaillant and to Dr. S. F. Harmer. Also to Mr. J.
A. Wolffsohn, who has kindly sent him a copy of Philippi’s paper
describing the Chilian species.
27 species may be regarded as well established, but this number
will doubtless soon be augmented. ‘Two genera may be recognised,
Galaxias and Neochanna.
GALAXIAS.
Galawias Cuv. Régne Anim. ii. p. 183 (1817); Cuv. & Val.
Hist. Nat. Poiss. xviii. p. 340 (1846) ; Giinth. Cat. Fish. vi. p, 208
(1866).
Mesites (non Geoftr.) Jenyns, Voy. Beagle, Fish. p. 118 (1842).
Austrocobitis Ogilby, Proc. Linn. Soc. N.S. Wales, xxiv. 1899,
p. 158.
Body more or less elongate. Teeth conical, pointed, in a single
series in the jaws and on the inner edge of each entopterygoid,
and in a double series on the tongue. Eyes small or moderate,
with a free circular lid. Dorsal fin more or less posterior in
position, with 9 to 15 rays; anal opposite or posterior to the dorsal,
with 10 to 19 rays. Ventral fins present, with 6 or 7 rays.
Vertebre 53 to 64 in number (53 in G. olidus, 56 in G. plate,
60 to 61 in G. findlayi, 61 in @. fasciatus, 62 in G. attenuatus and
G. maculatus, 64 in G'. brevipinnis).
Synopsis of the Species.
I. South African. (Ventrals 6-rayed; dorsal and anal fins each
with 9 to 12 rays; cleft of mouth rather small.)
@audalktruncatesnonnd cole teeerteeen err ee eter ene ee eri-en
Caudal emarginate
. zebratus.
. punctifer.
nore
II. South American.
A. 6 or7 branchiostegals; caudal emarginate ; origin of anal
opposite or slightly posterior to that of the dorsal.
1. Origin of ventral equidistant from tip of snout and
base of caudal or nearer the former.
Length of head 5 (young) to 65 (adult) in the length of the fish. 3. attenuatus.
Length of head 7 to 7 (young) in the length of the 1HISIO. o0nc0.c08 A. gracillimus.
2. Origin of ventral nearer to base of caudal than to
tip of snout.
Maxillary extending to below anterior margin of eye or slightly
[Be C001 epee se eee enbcebs CRMs esneacecae ec Heneses-beecasauctessenoceeamcs | Sp maculatus.
Maxillary extending to below anterior 3 of eye 0... 6. alpinus.
B. 8 or 9 branchiostegals; caudal truncate; origin of anal
posterior to that of the dorsal.
Origin of ventral considerably nearer to base of caudal than to
» tip of snout...... 7. platet.
Origin of ventral slightly nearer to tip of snout than to base of
ATCA ee OU he ian eee ere eM GER a ae enawanads. Seu SUVILee
366 MR. C. TATE REGAN ON THE FISHES
III. New Zealand and neighbouring islands.
A. Anal fin, when laid back, not reaching the procurrent
caudal rays.
1. 6 or7 branchiostegals; 9 to 11 gill-rakers on the lower
part of the anterior arch.
Pectoral extending less than 3 of the distance from its base to the
base of ventr al; anal with 12 to 15 branched rays ........
Pectoral extending more than 3 of the distance from its base to
the base of ventral; anal with 10 to 12 branched TERY ococae
2. 8 or 9 Dechinateeale, 12 to 14 gill-rakers on the
lower part of the anterior arch
B. Anal fin, when laid back, extending to the procurrent
caudal rays but not to the base of the caudal; 7 to 9
gill-rakers on the lower part of the anterior arch ......
©. Anal fin, when laid back, extending to or beyond the
base of caudal; 10 or 11 gill-rakers on the lower part of
the anterior arch.
Length of head 4-5
82-215 mim.) .
Length of head 32 a3 in the length of the fish (in specimens of
163-205 mm. Neh
IV. Australian and jesturten
A. Ventrals 7-rayed.
1. Origin of anal opposite to that of the dorsal.
Analiwath 2s) branchedinaysieysceeeeeeeereee rece eeceen acetate:
Anal yore 10 branched rays.
. Origin of anal poet ouor a that ae the ‘onal, halo
or in advance of the middle of the dorsal.
a. Origin of ventrals equidistant from tip of snout
and base of caudal.
Lower jaw pr ojecting ; pectoral extending less than 2 of the
distance from its base to the base of v entral..
Lower jaw shor ter than the upper (in the adult) ; 2 pector al
extending 3-2 of the distance from its base to the base of
ventral .. yates
bs Onn igin of swenvinells nearer fo iase ar eondall hen
to tip of snout; jaws equal anteriorly.
a. Pectoral extending much less than 3 of the
distance from its base to the base of
ventral setasuadgae
3. Pectoral extending shone f a - of “Alo afetenes
from its base to the base of ventral.
* Maxillary extending to below anterior
+ or anterior 4 of eye.
Length of head 43-4 in the length of the fish................
Length of head 4 in the length of the fish a5
**k Maxillary extending to, or non 4a,
below middle of eye.
Anal, when laid back, extending to the base of caudal ............
Anal, when laid back, not extending to the base of caudal
3. Origin of anal posterior to the middle of dorsal.
' a. Pectoral extending less than % of the distance
from its base to the base of ventral.
a. Lower jaw slightly projecting ..............1
3. Jaws equal anteriorly or the lower some-
what the shorter.
Caudal peduncle 14-13 as long as deep ...
Caudal peduncle 11-2 as long as deep ban
b. Pectoral extending more than $ er ihe digtanee
from its base to “the base of ventral
Bs Wiewmtrals G-rayeds cass dacecniemuennonaecamenuraravocatice variant
in the Jength of the fish (in specimens of
112.
16.
17.
| Nov. 28
. attenuatus.
. huttoni.
. Lyne.
. brevipinnis.
fasciatus.
. alepidotus.
. abtenuatus.
. occidentalis.
. waite.
weedoni.
rostratus.
. truttaceus.
. auratus.
. COvti.
» affinis.
22. ornatus.
23. olidus.
. findlayi.
. schomburgkii.
. dissimilis.
1905. ] OF THE FAMILY GALAXIID. 367
1. GALAXIAS ZEBRATUS.
Cobitis zebratus Casteln. Poiss. Afvique Austr. p. 56 (1861).
Galaxias capensis Stemd. Sitzb. Ak. Wien, ci. 1894, p. 460,
pl. ii. fig. 2.
Teeth in the joe subequal, without distinct enlarged canines.
Depth of body 5-54 in the length, length of head 4-4}. Snout
a little shorter than eye, the diameter of which is about 4 in the
length of head, interorbital width nearly 3. Jaws equal anteriorly ;
maxillary extending to below anterior + of eye. 8 gill-rakers on
the lower part of the anterior arch. Dorsal III 7-8; distance
from origin of dorsal to base of caudal 24-22 in the length of the
fish. Anal ITI-IV 8, commencing below the middle or anterior
part of the dorsal. Pectoral extending 4-2 of the distance from
its base to the base of ventral. Ventrals 6-rayed, originating at
a point nearly equidistant from tip of snout and base of caudal,
extending 4—% of the distance from their base to the origin of anal.
Caudal subtruncate. Caudal peduncle twice as long as deep.
Irregular dark cross-bars on the back and sides of the body; head
and ‘body covered with small dark dots.
Cape of Good Hope.
1. (54 mm.) — Sir. A. Smith.
2-6. (35-55 mm.) Near Cape Town. Prof. M. Weber.
2, GALAXIAS PUNCTIFER. (Plate X. fig. 3.)
Cobitis punclifer Casteln. Poiss. Afrique Austr, p. 56 (1861).
Teeth in the jaws subequal, without distinct enlarged canines.
Depth of body about 53 in the length, length of head 41-44,
Snout shorter than eye, the diameter of tare | is 3-33 in the length
of head, interorbital width 25-3}. Jaws sume anteriorly ; :
maxillary extending to below ie margin of eye or slightly
beyond. 8 or 9 gill-rakers on the lower part of the anterior arch,
Dorsal III-IV 7-8; distance from origin of dorsal to base of
caudal 23-25 in the ‘length of the fish. Anal ITI-IV 6-8, com-
mencing below de middle or posterior part of the dorsal,
Pectoral extending 4 the distance from its base to the base of
ventral. Ventrals 6- rayed, originating at a point nearer to tip
of snout than to base of caudal, extending 4—3 of the distance from
their base to the origin of anal. Caudal slightly emarginate,
Caudal peduncle 23-35 as long as deep. A series of obscure dark:
bars or blotches on the upper part of the sides; head and body
covered with small dark dots.
Cape of Good Hope.
This species is distinguished from G. zebratus by the shorter
head, smaller mouth, more slender caudal peduncle, &e., but
especially by the different shape of the caudal fin.
ale
1-2. (47 and 54 mm.) Near Cape Town. S. African Mus.
3-12. (27-30 mm.) Durban Rd., Cape Town. C. D. Rudd, Esq.
368 MR. GC. TATE REGAN ON THE FISHES [Nov. 28,
3. GALAXIAS ATTENUATUS. (Plates XII. fig. 1, and XIIT. fig. 2.)
Mesites attenuatus Jenyns, Zool. ‘ Beagle,’ Fish. p. 121, pl. xxii.
fig. 5 (1842).
Galaxias truttacews (non Cuy.) Valence. in Cuv. Régne Anim.,
Poiss. pl. xevii. fig. 2 (1829).
Galaxias scriba Cuv. & Val. Hist. Nat. Poiss. xviii. p. 347 (1846);
Richards. Zool. ‘ Erebus’ & ‘ Terror,’ Fish. p. 66 (1848); Giinth.
Cat. Fish. vi. p. 212 (1866).
Galaxias attenuatus Cuv. & Val.t.c. p. 348; Giinth. t.c. p. 210;
Hutton, Fish. N. Zeal. p. 60, pl. x. fig. 96 (1872); Klunz. Sitzb.
Ak. Wien, lxxx. 1879, p. 412; Macleay, Proc. Linn. Soc. N. 8.
Wales, vi. 1881, p. 230; Johnston, Proc. Roy. Soc. Tasmania,
1882, p. 130; Hutton, Trans. New Zealand Inst. xxviii. 1896,
p. 317; Ogilby, Proc. Linn. Soc. N. 8. Wales, xxi. 1896, p. 71;
Clarke, Trans. New Zealand Inst. xxxi. 1899, p. 78.
Galaxias maculatus (non Jenyns) Richards. t. c. p. 75, pl. xlii.
figs. 14-17.
Galaxias minutus Philippi, Arch. f. Nat. 1858, vol. xxiv. i. p. 309.
Galaxias kreftit Giinth. t. c. p. 211.
Galaxias punctatus Giinth. t. c. p. 212.
Galoxias waterhousei Krefft, Proc. Zool. Soc. 1867, p. 943;
Klunz. 1. ¢.
Galaxias cylindricus Casteln. Proc. Roy. Soc. Victoria, 1. 1872,
p. 177; Macleay, t. c. p. 235.
Galaxias delicatulus Casteln. t. c. p. 178; Macleay, 1. c.
Galaxias campbelli Sauv. Bull. Soc. Philom. (7) iv. 1880, p. 229.
Galaxias nebulosa Macleay, t. c. p. 234.
Galaxias alpinus (part.), Smitt, Bih. Svenska Ak. xxvi. iv.
No. 13, p. 21, pl. ui. figs. 9-12 (1901).
Teeth in the jaws subequal, without distinct enlarged canines.
Depth of body 54-10 in the length, length of head 5-63. Snout
a little longer than eye (in the adult), the diameter of which is 3
(young)-5 in the length of head, interorbital width 27-23. Jaws
equal anteriorly ; maxillary extending about to the vertical from
anterior margin of eye ora little beyond. 6 or 7 branchiostegals.
9-11 gill-rakers on the lower part of the anterior arch. Dorsal
10-13 (III-IV 7-9); distance from origin of dorsal to base of
caudal 32? (young)-44 in the length of the fish. Anal 16-19 (III-V
12-15), commencing below the origin of dorsal. Pectoral ex-
tending from less than 3 to more than 2 of the distance from its
base to the base of ventral. Ventrals 7-rayed, originating at a
point about equidistant from tip of snout and base of caudal or
from base or anterior part of pectoral and origin of anal, extending
less than + of the distance from their base to the origin of anal.
Caudal slightly emarginate. Caudal peduncle 14-2 as long as
deep. Golden or orange; upper parts of head and body finely
punctulated with blackish and spotted or marbled with dark
purplish ; fins immaculate.
South Australia, Victoria, New South Wales, Tasmania, New
1905.] OF THE FAMILY GALAXIIDA, 369
Zealand and neighbouring islands, Falkland Is., Tierra del Fuego,
Patagonia, and Chile.
With the type of the species, which I have been enabled to
examine through the courtesy of Dr. 8S. F. Harmer, I have com-
pared the types of @. scriba, for permission to examine which I
am indebted to Prof. L. Vaillant, of G’. waterhousei, kindly lent by
the Director of the Australian Museum, and of G. krefftii and
G. punctatus, preserved in the British Museum.
The varying size of the eye in preserved specimens is sometimes
due to the method of preservation ; often the eye tends to protrude
and the circular fold surrounding it is stretched or broken, thus
apparently increasing the size of the eye. Inthe type of @. seriba,
which measures only 74 mm. in total length, the eye is slightly
more than 4 the length of head,
1. (130 mm.) } types of Murray R. A. Lloyd, Esq.
2-4. (70-90mm.)§ G. krefftii. ; Sydney. G. Krefit, Esq.
5. (170 mm.) type of G. Eastern Creek. G. Krefft, Esq.
punctatus.
6-8. (80-95 mm.) Australia. G. Krefft, Esq.
9. (105 mm.) Mooraboul R. Mr. E. Degen.
10-19. (75-135 mm.) Tasmania. J. B. Jukes, Esq.
20. (90 mm.) Tasmania. R. W. Johnston, Esq.
21. (170 mm.) Tasmania. Sir. J. Richardson.
22-23. (78 and 110 mm.) ? New South Wales. G. Krefft, Esq.
24-26. (65-135 mm.) New Zealand. Otago Mus.
27-33. (90-120 mm.) New Zealand. New Zealand Inst.
34-85. (85 and 110 mm.) Falkland Islands. Sir J. Richardson.
36. (60 mm.) Tierra del Fuego. Marquis G. Doria.
37-44. (55-60 mm.) Magellan. Dr. Coppinger.
45-50. (63-80 mm.) P Peru. Royal Coll. Surgeons.
The New Zealand race may usually be distinguished by the
following characters :—Head moderate (54-64 in the length in
specimens of 65-135 mm.) ; eye rather large (34-43 in the length
of head); ventrals nearly always nearer to tip of snout than to
base of caudal; dorsal and anal fins almost triangular in shape,
the rays decreasing from the first branched ray, which is the largest,
to the last, which is very short, the free edge of the fin being
straight ; caudal distinctly emarginate.
The Australian race often shows a slightly longer head (5-6 in
the length in specimens of 70-170 mm.) and a slightly larger eye ;
the ventrals are sometimes equidistant from tip of snout and base
of caudal, sometimes a little nearer to one or the other; the dorsal
and anal fins are often more rounded than in the New Zealand
form, the anterior branched rays being longer and decreasing in
length less rapidly, the last ray also being longer; the caudal 1s
usually not quite so distinctly emarginate.
The South American race seems perhaps to differ from the New
Zealand one in having a slightly smaller head (54-64 in the length
in specimens of 55-110 mm.) anda smaller eye (33-42 in the length
of head).
Galaxias versicolor Casteln. (Proc. Zool. Soc. Victoria, i. 1872,
p. 176) is probably allied to G. attenuatus, agreeing in the small
head (5,8, in the total length), small mouth (the maxillary just
370 MR. CG. TATE REGAN ON THE FISHES [ Nov. 28,
reaching the vertical from the anterior margin of the eye), and in
having the dorsal and anal opposite one another and the caudal
emarginate. It appears to differ in the deeper body (depth 42 in
the total length) and the fewer fin-rays (Dorsal 9, Anal 12). It
is described from a specimen of 140 mm. from a marsh near
St. Kilda, Victoria.
4, GALAXIAS GRACILLIMUS.
Mesites gracillimus Canestvini, Arch. Zool. Anat. Fisiol. 11
18645 pp. LOOM ply. texi2.
Galaxias gracillimus Giinth, Cat. Fish. vi. p. 213 (1866).
Galaxias maculatus (non Jenyns) Smitt, Bih. Svenska Ak.
xxvi. iv. No, 13, p. 21, pl. 1. figs. 5-8 (1901).
Teeth apparently as in . attenyatus. Depth of body 10-12 in
the length, length of head 7-74. Snout a little shorter than eye,
the donner of which is 34 =J2i in the length of head and less than
the interorbital width. ai aws equal anterior ly; maxillary ex-
tending nearly to the vertical from the anterior margin of eye.
5 or 6 branchiostegals. 9 or 10 gill-rakers on the lower part of
the anterior arch. Dorsal 11-12 (ITI-IV 8-9); distance from
origin of dorsal to base of caudal about 33 in the length of the fish.
Anal 16-17 (III-IV 13-14), commencing below “the or igin of
dorsal, when laid back not extending to the caudal. Pectoral ex-
tending about 2 of the distance from its base to the base of ventral.
Ventrals 7- rayed, originating ata point nearer to tip of snout than
to base of caudal, and nearer to origin of anal than to base of
pectoral, extending about 7 of the distance from their base to te
origi of anal. Caudal slightly emarginate. Caudal peduncle 23
as long as deep. Some small blackish spots on the head and on
the upper part of the body; a line of black dots along the middle
of the side and one at the base of each of the unpai: ad fins.
Chile; Falkland Is.
1-4. (53-55 mm.) Falkland Is. R. Vallentin, Esq.
Possibly this species may be based ona larval forin of @, attenuatus,
but if so it is remarkable that it has been recorded only from
South America and that larval forms of other species have not
been described.
5, GALAXIAS MACULATUS.
Mesites maculatus Jenyns, Zool. ‘ Beagle,’ Fish. p. 119, pl. xxi.
fig. 4 (1842).
Galaxias maculatus Cuv. & Val. Hist. Nat. Poiss. xvii. p. 355
(1846); Giinth. Cat. Fish. vi. p. 212 (1866),
Galaxias punctulatus Philippi, Arch. £. Nat. 1858, vol. xxiv, 1.
p. 310.
Galaxias coppingert Giinth. Proc. Zool. Soc. 1881, p. 21.
Galaxias alpinus (non Jenyns) Smitt, Bih. Svenska Ak. xxiv,
iv. No. 5, p. 56, pl. v. fig. 40 (1899).
Teeth in the j jaws A ibeagal without distinct enlarged canines.
Depth of body 6-8 in the length, length of head 43-52. Snout
1905.) OF THE FAMILY GALAXIID®, 371
nearly as long as eye, the diameter of which is 33-43 in the length
of head, interorbital width 22-3. Jaws equal anteriorly ;
maxillary extending to below anterior margin of eye or slightly
beyond. 6 or 7 branchiostegals. 9-12 gill rakers on the lower
part of the anterior arch. Dorsal TIL-IV' 8; distance from origin
of dorsal to base of caudal 33-44 in the length of the fish. Anal
IV—V 11-14, commencing Below the origin of dorsal, when laid
back not reaching the one. Pectoral extending from less
than 2 to 4 of the ‘distance from its base to the base of ventral.
Ventrals 7- rayed, originating at a point a little nearer to base of
caudal than to tip of Snowe or equidistant from middle of pectoral
and origin of anal, extending from a little less than 2 to nearly 2
of the distance ‘arin their base to the origin of anal. Caudal
slightly emarginate. Caudal peduncle 13 9 ‘ds long as deep.
Olivaceous, covered with numerous irreg vilee blackish ‘spots ; fins
immaculate.
Patagonia; Tierra del Fuego; Falkland Islands.
1. (73 mm.) type of G. coppingeri. Alert Bay. Dr. Coppinger.
2-3. (76 and 83 mm.) Orange Bay. Paris Mus.
4-8. (82-93 mm.) Falkland Is. Commander Knocker.
9-11. (65-75 mm.) Falkland Is. R. Vallentin, Esq.
12-21. (70-120 mm.) Estero de Penco. Mons. F, Lataste.
6, GALAXIAS ALPINUS.
Mesites alpinus Jenyns, Zool. ‘ Beagle,’ Fish. p. 121 (1842).
Galaxias alpimus Cuyv. & Val. Hist. Nat. Poiss. xviii. p. 356
(1846); Giinth. Cat. Fish. vi. p. 212 (1866).
Teeth in the jaws subequal, without distinct enlarged canines.
Depth of body about 7 in the length, length of head 41—- -42, 2, Snout
shorter than eye, the diameter of w hich is 3 -37 in the length of head
and equal to the interorbital width. Lower jaw slightly projecting ;
maxillary extending to below anterior 1 of eye. 6 branchiostegals.
12 gill-rakers on the lower part of the anterior arch. Dorsal IIT
8-9; distance from origin of dorsal to base of caudal 33-34 in the
length of the fish. Anal ITV 12-15, commencing below or slightly
behind the origin of dorsal, when laid back not reaching the
caudal. Pectoral extending 1 or nearly 4 of the distance from its
base to the base of ventral, Ventrals 7- rayed, originating at a
point equidistant from middle or posterior part of eye and base
of caudal or from middle of pectoral and origin of anal, extending
3-2 of the distance from their base to the origin of anal, Caudal
apparently shghtly emarginate. Caudal peduncle twice as long
as deep. Head and body with small blackish dots, which are
especially developed to form a mid-dorsal longitudinal band.
Alpine lakes of Hardy Peninsula, Tierra del Fuego.
1. (52 mm.) one of the types of the species. Cambridge Univ. Mus.
Through the kindness of Dr. 8, F. Harmer, F.R.S., I have been
enabled to examine the types of the species, two specimens which
measure 52 and 62 mm. respectively in total length, and to retain
one of these for the British Museum Collection,
372 MR. C. TATE REGAN ON THE FISHES [ Nov. 28,
7. GALAXIAS PLATEI.
Galaxias platei Steind. Zool. Jahrb. Suppl. iv. 1897, p. 329,
pl. xx. fig. 13.
Galaxias alpinus, (part.) Smitt, Bih. Svenska Ak. xxvi. iv.
Nong oa pao, plait OOM):
Teeth in the jaws subequal, without distinct enlarged canines.
Depth of body 5-6 in the length, length of head 44-437. Snout
longer than eye, the diameter of which is 53-73 in the length of
head, interorbital width 23-22. Jaws equalanteriorly; maxillary
extending to below the middle of eye. 8 or 9 branchiostegals.
11-13 gill-rakers on the lower part of the anterior arch. Dorsal
IV 8; distance from origin of dorsal to base of caudal 33-32 in
the length of the fish. Anal IV—V 10-11, commencing below the
anterior part or middle of the dorsal, when laid back extending to
the procurrent rays or base of caudal. Pectoral extending 2-4 of
the distance from its base to the base of ventral. Ventrals
7-rayed, originating at a point equidistant from cheek or pre-
operculum and base of caudal or from middle or extremity of pectoral
and origin of anal, extending 3-2 of the distance from their base
to the origin of anal. Caudal truncate. Caudal peduncleas long
or a little longer than deep. Head, body, and fins covered with
numerous irregular dark spots.
Patagonia.
1. (195 mm.) Rio Chico. Marquis G. Doria.
2-5. (260 and 300 mm.) Magellan. Mons. F. Lataste.
The two large fishes, undoubtedly belonging to one species, from
a lake in the province of Punta Arenas, Chile, described by
Philippi (Verh. Deust. Wiss. Ver. Sant. Chile, iii. 1895, p. 19)
under the names of Gialaxias grandis and G. delfini, agree with
G. platei in the form and proportions of head and body, size of the
eye, shape of the caudal, length of pectoral and ventral and size
of the dorsal fin, and also in coloration. The unpaired fins are
torn in the type of G. grandis, a fish of 330 mm., and the number
of fin-rays in G. delfini is given as Dorsal 8, Anal 18. If it were
not for this, I should have no hesitation in regarding this species
and G. platei as the same.
8. GALAXIAS SMITHII, sp. n.
Lower jaw with distinct lateral canines, Depth of body 63 in
the length, length of head 53. Snout slightly longer than eye,
the diameter of which is 4; in the length of head, interorbital
width 22, Jaws equal anteriorly; maxillary extending nearly to
below middle of eye. 8 branchiostegals. 10 gill-rakers on the
lower part of the anterior arch. Dorsal III-IV 9; distance from
origin of dorsal to base of caudal 32 in the length of the fish.
Anal IV 10, commencing below the anterior part of the
dorsal, when laid back not extending to the caudal. Pectoral
extending more than 4 of the distance from its base to the base
of ventral. Ventrals 7-rayed, originating at a point slightly
1905.] OF THE FAMILY GALAXIIDA. ae
nearer to tip of snout than to base of caudal or equidistant from
base of pectoral and origin of anal, extending nearly 3 of the
distance from their base to the origin of anal. Caudal truncate.
Caudal peduncle 12 as long as deep. Greyish, with traces of
darker vertical stripes; a dark bar above the pectoral.
Falkland Islands.
1. (110 mm.) type of the species. ~ Falkland Is. Sir A. Smith.
9. GALAXIAS HUTTONI, sp. n. 7 (Plate X. fig. 2.)
Teeth apparently as in G. attenuatus. Depth of body
about 7 in the length, length of head nearly 5. Snout a
little shorter than eye, the diameter of which is 3-34 in the
length of head, interorbital width about 24. Jaws equal an-
teriorly; maxillary extending to below anterior } or anterior +
of eye. 7 branchiostegals. 9 gill-rakers on the lower part of
anterior arch. Dorsal I1I--IV 7-8; distance from origin of dorsal
to base of caudal 33-3? in the length of the fish. Anal TV—V 10-12,
commencing below the origin or anterior part of dorsal, when laid
back not extending to the caudal. Pectoral extending from more
than 4 to 2 of the distance from its base to the base of ventral.
Ventrals 7-rayed, originating at a point equidistant from tip of
snout and base of caudal, or nearer the former, or equidistant from
base of pectoral and origin of anal, extending from more than 3 to
2 of the distance from their base to the origin of anal. Caudal
emarginate. Caudal peduncle 12-2 as long as deep. Yellowish
with brown cross-bars ; fins pale.
Lake Rainiera, New Zealand.
1-7. (89-45 mm.) types of the species. Lake Rainiera. Prof. F. W. Hutton.
Perhaps as closely allied to G. lynx as to G. attenuatus.
10. GaLAxtas LyNx. (Plate X. fig. 4.)
Galaxias olidus (non Giinth.) Hutton, Trans. N. Zealand Inst.
v. 1872, p. 270, and Fishes of N. Zeal. Suppl. p. 11 (1873).
Galaxias lyn«e Hutton, Trans. N. Zealand Inst. xxvii. 1896,
(D> Ble
Lower jaw with distinct lateral canines. Depth of body 6-7 in
the length, length of head 43-42. Snout nearly as long as or
longer than eye, the diameter of which is 34-5 in the length of
head, interorbital width 23-3. Jaws equal anteriorly or the lower
slightly projecting; maxillary extending to below middle of eye,
in the adult. 8 or 9 branchiostegals. 12-14 gill-rakers on the
lower part of theanteriorarch. Dorsal TV 8; distance from origin
of dorsal to base of caudal 33-32 in the length of the fish. Anal
V 10-11, commencing below the anterior part of the dorsal, when
laid back not nearly extending tothe caudal. Pectoral extending
2 or nearly 3 of the distance from its base tu the base of ventral.
Ventrals 7-rayed, originating ata point about equidistant from eye
and base of caudal or from middle or posterior part of pectoral and
origin of anal, extending 3-5 of the distance from their base to
374 MR. C. TATE REGAN ON THE FISHES [ Noy. 28,
the origin of anal. Caudal truncate or slightly emarginate.
Caudal peduncle nearly twice as long as deep. Traces of irregular
dark eross-bars in the young.
Lakes Coleridge and Wakatipu, New Zealand.
1-3. (58-83 mm.) Lake Coleridge. Canterbury Mus.
4. (170 mm.) Take Wakatipu. Otago Mus.
11. GALAXIAS BREVIPINNIS *.
Galavias brevipinnis Giinth, Cat. Fish. vi. p. 215 (1866); Hutton,
Fish. N. Zeal. p. 59 (1872), and Trans, N. Zealand Inst. xxvii.
1596, p. 317.
Galaxias grandis Haast, Trans. N. Zealand Inst. v, 1872, p. 278.
Galaxias robinsont Clar ke, Trans. N. Zealand. Inst. xxxi. 1899,
(Ds OB [alle We
Galaxias bollansi Hutton, Trans. N. Zealand Inst. xxxiv. 1902,
p. 198:
Lower jaw with distinct lateral cemmmies Depth of body
42-62 in the length, length of head 42-51, Snout as long
Ag or longer than eye, the diameter a which is 4-6 in the
length of head, interorbital width 2-23. Jaws equal anteriorly
or the lower a little shorter than the upper; maxillary
extending to below middle of eye or a little beyond. 7 branchio-
stegals. 7-9 gill-rakers on the lower part of the anterior arch,
Dorsal LV 8-9; distance from origin of dorsal to base of caudal
32-4 in the length of the fish. “pall TV—V 9-10, commencing
below the aaiile of the dorsal, when laid back exte nding to the
payee caudal rays. Pectoral extending from 2 to more than
4 of the distance from its base to the base “os ventral. Ventrals
a -rayed, originating at a point about equidistant from angle of
mouth and ane of ‘Gamal or from middle of pectoral and origin of
anal, extending 4-2 of the distance from their base to the origin
of ¢ ene Caudal truncate or slightly emarginate. Caudal peduncle
11-12 aslong as deep. Head, body, and fins with dark brown
spots, ” marblings, or reticulations.
New Zealand oral neighbouring islands.
1-3. (133-153 mm.) types ot the species. New Zealand. Capt. Stokes.
4, Skeleton. New Zealand. Dr. Giinther.
5. (210 mm.) North Island, N.Z. H. IX. Nicholl, Esq.
6. (158 mm.) Dunedin, N.Z. Otago Mus.
7-11. (73-115 mm.) Wellington Mus.
12. (105 mm.) type of G bollansi. Auckland Is. Prof. F. W. Hutton.
12. GALAXIAS FASCIATUS.
Galaxias fasciatus Gray, Zool. Mise. p. 73 (18351), and in
Dieffenb. New Zealand, ii. p. 221 (1842); Cuv. & Val. Hist. Nat.
Poiss. Xvi. p. 350 (1847); Richards. Zool. ‘ Krebus’ & ‘Terror,’
Fish, p. 77 (1848) ; Giimth. Cat. Fish. vi. p. 209 (1866); Hutton,
Fish. N. Zeal. p. 59, pl. x. fig. 94 (1872), and Trans. N. Zealand
Inst. xxviii. 1896, p. 317; Clarke, ib. xxxi. 1899, p. 90, pl. v.
* An excellent figure of this species is given in the ‘Cambridge Natural History,’
vol. vii. p. 607.
1905. | OF THE FAMILY GALAXIIDA. 315
Galaxias brocchus Richards. t. ¢. p. 76, pl. xliii. figs. 8-13.
Galaxias reticulatus Richards. 1. ¢. pl. xlii. figs. 7-12.
Galaxias postvectis Clarke, t. c. p. 88, pl. v.
Lower jaw with distinct lateral canines. Depth of body
4-54 in the length, length of head 4-5. Snout as long as
or a little longer than eye, the diameter of which is 4-5
in the length of head, interorbital width 13-21. Jaws equal
anteriorly ; maxillary extending to below posterior part of eye.
8 or 9 branchiostegals. 10 or 11 gill-rakers on the lower part of
the anterior arch. Dorsal IV 7-9; distance from origin of dorsal
to base of caudal 34-42 in the length of the fish. Anal 1V—-V
10-11, commencing below or a little behind the origin of dorsal,
when laid back extending to or a little beyond the base of the
caudal. Pectoral extending from more than 3 to nearly } of the
distance from its base to the base of ventral. Ventrals 7 if -rayed,
originating at a point equidistant from snout or eye and base of
caudal or from cumibemiloy part or middle of pectoral and origin of
anal, extending 2—} of the distance from their base to the origin
of anal. Caudal truncate. Caudal peduncle from # to as long as
deep. Brownish, with narrow light vertical stripes, which may
be undulating or irregular or may form reticulations ; often a light
vertical bar above the base of pectoral, succeeded by a dark purplish
blotch.
New Zealand and neighbouring islands.
1-3. (82-210 mm.) types of the New Zealand. Dr. Dieffenbach.
species.
4. (145 mm.) New Zealand. Dr. Sinclair.
5. (215 mm.) typeof G.brocchus. Auckland Islands. Sir J. Richardson.
6-8. (140-170 mm.) types of Auckland Islands. Sir J. Richardson.
G. reticulatus.
9-10. (150-185 mm.) New Zealand. Capt. Stokes.
11. (115 mm.) Porirua. Wellington Mus.
12. (205 mm.) Chatham Islands. Prof. F. W. Hutton.
A large female specimen, ready to spawn, measuring 265 mm.
in total length, has not been included in the above diagnosis.
The depth of the body is 2 of its length, the caudal peduncle is 2
as long as deep, the maxillar y does not extend beyond the middle
of the eye, the origin of the anal fin is only a little in advance
of the middle of the dorsal. These peculiarities appear due
partly to the condition of the fish, partly to individual variation.
13. GALAXIAS ALEPIDOTUS.
Esox alepidotus Forster, Descript. Anim. p. 142 (1844);
Schneider in Bloch’s System. Ichthyol. p. 395 (1801).
Galaxias alepidotus Cuv. Régne Anim. ii. p. 283 (1829); Richards.
in Dieffenb. New Zealand, Appendix, p. 219 (1842), and Zool.
‘Erebus’ & ‘Terror,’ Fish. p.77 (1848); Giinth. Cat. Fish. vi. p.208
(1866); Hutton, Fish. N. Zeal. p. 58 (1872), and Trans. N. Zealand
Inst. xxviii. 1896, p. 317.
Galaxias forstert Cuv. & Val. xviil. p. 351 (1847).
Proc. Zoou. Soc.—1905, Vou. I. No, XX VI, 26
376 MR. C. TATE REGAN ON THE FISHES [ Nov. 28,
Galaxias kokopu Clarke, Trans. N. Zealand Inst. xxxi. 1899,
p- 88, pl. iv.
Lower jaw with distinct lateral canines: Depth of body 4-43
in the length, length of head 32-34. Snout a little longer than
eye, the diameter of which is 5 in the length of head, interorbital
width 21-21. Jaws equal anteriorly; maxillary usually extending
beyond middle of eye. 8 or 9 branchiostegals. 10 or 11 gill-rakers
on the lower part of the anterior arch. Dorsal IV 9-10; distance
from origin of dorsal to base of caudal 4-44 in the length of the
fish, Anal IV—V 10-11, commencing below or a little behind the
origin of dorsal, when laid back extending beyond the base of
caudal. Pectoral extending 2—% of the distanec from its base to
the base of ventral. Ventrals 7-rayed, originating at a point
equidistant from cheek or posterior margin of eye and base of
caudal or from middle of pectoral and origin of anal, extending
3+ of the distance from their base to the origin of anal. Caudal
truncate. Caudal peduncle nearly 2? as long as deep. Brownish,
with rather large rounded, oblong or crescentic, light yellowish
spots ; fins dusky.
New Zealand.
1-3. (163-205 mm.) New Zealand. Capt. Stokes.
4. (196 mm.) Thomson Sound, Otago. Otago Mus.
14, GALAXIAS OCCIDENTALIS. (Plate XI. fig. 4.)
Galaxias occidentalis Ogilby, Proc. Linn. Soc. N. 8S. Wales,
xemiye IWIOO, [d. LOY
Teeth in the jaws subequal, without distinct lateral canines.
Depth of body 53 in the length, length of head 54. Snout a
little longer diner eye, the diameter of which i is 45 an the length
of head, interorbital width 22, Lower jaw projecting ; maxillary
extending to below anterior 3 of eye. 6 or 7 branchiostegals.
10 gill-rakers on the lower part of the anterior arch. Dorsal 10
(II 7); distance from origin of dorsal to base of caudal 44+ in
the length of the fish. Anal 15 (V 10), commencing below the
origin of dorsal, when laid back not nearly extending to the
procurrent caudal rays. Pectoral extending a little more than
4 of the distance from its base to the base of ventral. Ventrals
(-rayed, originating at a point equidistant from tip of snout
and base of caudal or a little nearer to origin of anal than to
base of pectoral, extending a little more than 4 of the distance
from their base to the origin of anal. Caudal slightly emarginate.
Caudal peduncle 14 as long as deep. Yellowish, with narrow
dark cross-bars on the sides of the body; a pair of dark blotches
on the basal part of the caudal.
Western Australia.
1. (155 mm.) one of the types. W. Australia. Australian Mus.
15. GALAXIAS WAITIH, sp. n. (Plate XI. fig. 2.)
Teeth in the jaws subequal, without distinct lateral canines.
Depth of body 65-6 in the length, length of head 42-44. Snout
BY
1905. | OF THE FAMILY GALAXIID&. Suit
longer than eye, the diameter of which is 5-51 in the length of
head, interorbital width 25-22. Lower jaw slightly or distinctly
projecting; maxillary extending to below anterior j of eye. 6 or
7 branchiostegals. 11 or 12 gill-rakers on the lower part of the
anterior arch. Dorsal 11-13 (IV-V 7-8); distance from origin
of dorsal to base of caudal 34-41 in the length of the fish. Anal
13-14 (IV 9-10), commencing below or somewhat in advance of
the middle of dorsal, when aad back extending nearly to the
procurrent caudal rays. Pectoral extending a little: more than 2
of the distance from its base to the base of the ventral. Ventrals
7-rayed, originating at a point equidistant from tip of snout and
bese of caudal or from base of pectoral and origin of anal, extending
4-2 of the distance from their base to the origin of anal. Caudal
slightly emarginate. Caudal peduncle 14 12 as long as deep.
Brownish (in spirit) ; caudal fin with a more or less distinct pair of
dark stripes running from the base to the posterior angles of the
fin.
Gulpa Creek, New South Wales.
1-4, (110-125 mm.) types of the species. Australian Museum.
16. GALAXIAS WEEDONI. (Plate XI. fig. 1.)
Galaxias weedoni Johnston, Proc. Roy. Soc. Tasmania, 1881,
p- 131 (1882).
Galaxias atkinsonii Johnston, |. ¢.
Lower jaw with the lateral teeth slightly or distinctly enlarged
and canine-like. Depth of body 5-64 in the length, length of
head 5. Snout slightly longer than eye, the diameter of which i 18
43-42 in the length of heal interorbital width 21-22. Lower
jaw slightly shorter than the upper; maxillary extending to below
the middle of eye. 9 branchiostegals; 9 gill-rakers on the lower
part of the anterior arch. Dorsal 11-12 (IV 7-8); distance
from origin of dorsal to base of caudal 33-34 in the length of the
fish. Anal 14 (IV-V 9-10), commencing below or in advance
of the middle of dorsal, when laid back nearly reaching the
procurrent caudal rays. Pectoral extending 4-2 of the distance
from its base to the base of ventral. Ventrals 7-rayed, originating
at a point equidistant from tip of snout and base of caudal or
from base of pectoral and origin of anal, extending 4-2 of the
‘distance from their base to the origin of anal. Caudal slightly
emarginate. Caudal peduncle 14 as long as deep. Brownish,
with dark brown spots and vertical bars; a dark bar above the
base of pectoral; fins with a few dark spots.
Tasmania.
1. (110 mm.) Tasmania. R. W. Johnston, Esq.
2-3. (100 and 105 mm.) Australian Mus.
The first specimen was received from Mr. Johnston in 1880,
and it appears to correspond to his Galaxias weedoni from the
River Mersey.
Five small specimens (50-68 mm.) from Lake Laura, received
26*
378 MR. C. TATE REGAN ON THE FISHES [Nov. 28,
from Prof. W. B.* Spencer, agree very well with Johnston’s
description of Galaxias atkinsonit from the River Pieman. They
differ from the adult fish in the more slender body (depth 6-8 in
the length, caudal peduncle 12-1? as long as deep), the smaller
mouth with the jaws equal anteriorly, and the less distinct
markings.
17. GALAXIAS ROSTRATUS.
Galaxias rostratus Klunz. Arch. f. Nat. 1872, p. 41.
Depth of body 84 in the total length, length of head 52.
Snout 14 as long as eye, the diameter of which is 44 in the length
of head and 14 in the interorbital width. Jaws equal anteriorly ;
maxillary extending to below middle of eye. 6 branchiostegals.
Dorsal 11. Anal 14, commencing a little behind the origin of
the dorsal. Pectoral extending much less than $ of the distance
from its base to the base of ventral. Ventrals 7-rayed,
originating at a point equidistant from anterior margin of eye
and base of caudal. A dark spot on the base of the caudal fin.
Mersey River.
Total length 130 mm.
Kvidently allied to G. occidentalis and G. waitii
18. GALAxiAs TRUTTACEUS. (Plate XIII. fig. 4.)
Galaxias truttaceus Cuv. Régne Anim. ii. p. 283 (1817); Cuv.
& Val. Hist. Nat. Poiss. xviii. p. 344, pl. 543 (1846); Richards.
Zool. ‘Erebus’ & ‘Terror,’ Fish. p. 75, pl. xlii. figs. 1-6; Giinth.
Cat. Fish. vi. p. 209 (1866); Macleay, Proc. Linn. Soc. N.S.
Wales, vi. 1881, p. 229; Johnston, Proc. Roy. Soc. Tasmania,
1882, p. 130.
Galaxias ocellatus McCoy, Intern. Exhib. Ess. p. 14 (1866);
Casteln. Proc. Zool. Soc. Victoria, i. 1872, p. 175; Macleay, t. c.
p. 235.
Lower jaw with the lateral teeth more or less distinctly enlarged
and canmne-like. Depth of body 5-6 in the length, length of
of head 42-42. Snout as long as or slightly longer than eye, the
diameter of which is 4-42 in the length of head, interorbital
width 24. Jaws equal anteriorly; maxillary extending to below
anterior + or anterior 3 of eye. 7—9 branchiostegals. 8 or 9 gill-
rakers on the lower part of the anterior arch. Dorsal 10-12
(11I-IV 7-8); distance from origin of dorsal to base of caudal
33-34 in the length of the fish. Anal 14-16 (IV-V 10-12),
commencing below the anterior } of the dorsal, when laid back
usually reaching the procurrent caudal rays. Pectoral extending
3 the distance from its base to the base of ventral. Ventrals
7-rayed, originating at a point equidistant from eye and base of
caudal, extending # of the distance from their base to the origin
of anal. Caudal emarginate. Caudal peduncle a litttle longer
than deep. Olivaceous, with purplish ocellated spots; upper lip
dark ; an oblique dark stripe running back from below the eye ;
1905. ] OF THE FAMILY GALAXIID#, 379
sometimes 2 or 3 dark vertical bars above the base of the pectoral ;
dorsal, anal, and ventral fins sometimes blackish at the tip.
Tasmania; Victoria.
A. Forma typica, with 2 or 3 dark vertical bars above the pectoral
and with the dorsal, anal, and ventral fins blackish at the tip.
1. (105 mm.) Tasmania. Sir J. Richardson.
/2-6. (90-130 mm.) Tasmania. Haslar Coll.
7-8. (110-160 mm.) Tasmania. J. Gould, Esq.
9-11. (107-118 mm.) Tasmania. R. W. Johnston, Esq.
B. Variety without bars above the pectoral, with fins uniformly
pale.
1-2. (112 and 128 mm.) Moorabool R., Victoria. Mr. E. Degen.
According to Johnston (/. ¢.) there are Tasmanian varieties of
this species without bars above the pectoral.
19. Ganaxias AuRATUS. (Plate XIII. fig. 1.)
Galaxias auratus Johnston, Proc. Roy. Soc. Tasmania, 1881,
p. 131 (1882).
Lower jaw with the lateral teeth somewhat enlarged. Depth
of body about 5 in the length, length of head about 4. Snout
scarcely longer than eye, the diameter of which is 41 in the
length of head, interorbital width 22. Jaws equal anteriorly ;
maxillary extending to below anterior 7 of eye. 7-9 branchio-
stegals. 10 gill-rakers on the lower part of the anterior arch.
Dorsal TV 8; distance from origin of dorsal to base of caudal
32 in the length of the fish. Anal ITV 10, commencing below the
middle of the dorsal, when laid back extending to the procurrent
caudal rays. Pectoral extending 3 the distance from its base to
the base of ventral. Ventrals 7-rayed, originating at a point
equidistant from posterior margin of przoperculum and base of
caudal, extending nearly to the vent. Caudalemarginate. Caudal
peduncle as long asdeep. Reddish above, golden on the sides and
beneath ; upper part of head and body with numerous rather large
purplish spots ; fins pale, the dorsal, anal, and ventrals with the free
edge blackish.
Neighbourhood of the Great Lake, Tasmania.
The description above is based on a single specimen measuring
125 mm. in total length, received from Mr. R. W. Johnston in
1880. ‘The species is said by him to be confined to the neighbour-
hood of the Great Lake, at an altitude of about 4000 feet, and to
attain a larger size than any other member of the genus. He
gives the following measurements of a large specimen :—Total
length 92 inches; length, without caudal, 83 inches; length of
head [z.e. including opercular flap] 23 inches; depth of body
nearly 2 inches; length of snout ? inch; interorbital width
1 inch.
The species is especially distinguished from the allied G. trut-
taceus by the larger head and the more posterior position of the
ventrals.
380 MR.:C. TATE REGAN ON THE FISHES [ Nov. 28,
20. GALAXIAS cox. (Plate XII. fig. 2.)
Galaxias coxti Macleay, Proc. Linn. Soc. N. 8. Wales, v. 1880,
p. 49.
Galaxias nigothoruk Lucas, Proc. Roy. Soc. Victoria, (2) iv.
1892, p. 28.
Lower jaw with distinct lateral canines. Depth of body 5-6
in the length, length of head 44-5. Snout as long as or a
little longer than eye, the CHEN OER of which is 4-5 in the
length of “head, interorbital width 2-23. Jaws equal anteriorly ;
maxillary extending nearly to below middle of eye. 7 or 8
branchiostegals. 8-9 gill-rakers on the lower part of the anterior
arch. Dorsal IV 7-9; distance from origin of dorsal to base of
caudal 37-4 in the length of the fish. Anal TV—V 8-10, com-
mencing alow or in advance of the middle of dorsal, when laid
back extending to the base of caudal. Pectoral extending about
1 of the distance from its base to the base of ventral. Ventrals
ie rayed, originating at a point equidistant from eye and base of
caudal or from middle of pectoral and origin of anal, extending
more than 4 of the distance from their base to the origin of Ba
Caudal slightly emarginate. Caudal peduncle as long as ora little
longer than deep. Br ownish, with numerous small dark spots or
vertical streaks; a more or less distinct dark vertical bar above the
base of pectoral; fins usually dusky.
Victoria; New South Wales.
1. (95 mm.) one of the type Nigothoruk, Victoria. Prof, A. Dendy.
of G. nigothoruk.
9-6. (145-180 mm.) Australian Mus.
The specimens receivec: from the Australian Museum, without
name and without locality, evidently correspond to Macleay’s
Galaxias coxti, from Mt. Wilson, New South Wales, and may
probably be regarded as the types of that species.
21. GALAXIAS AFFINIS, sp. n. (Plate X. fig. 1.)
Lower jaw with distinct lateral canines. Depth of body 6-7 in
the length, length of head 44-43. Snout longer than eye, the
diameter of which is 43-54 in the length of head, interorbital
width 23-22. Jaws equal anteriorly; maxillary extending to
below middle of eye. 8 or 9 branchiostegals. 8 or 9 gill-rakers
in the lower part of the anterior arch. Dorsal TV 6-8; distance
from origin of dorsal to base of caudal 32—34 in the length of the
fish. Anal [V-V 8- 9, commencing below the middle “of dorsal,
when laid back not reaching the ca udal. Pectoral extending nearly
2 of the distance from its base to the base of ventral. Ventrals
(-rayed, originating at a point about equidistant from eye and
base of caudal or from anterior part of pectoral and origin of anal,
extending 4 or nearly 2 of the distance from their base to the
origin of anal. Caudal slightly emarginate. Caudal peduncle
1i =i as long as deep. Brownish, with numerous small dark
spots: a, dark vertical bar above the base of pectoral ; fins dusky.
1905. | OF THE FAMILY GALAXIIDA. 381
Tasmania.
This species is very closely allied to G. cowzi, but is distinguished
by the smaller eye, the somewhat shorter ventrals, less deep anal,
and more slender caudal peduncle.
1-4. (120-150 mm.) types of the Lake St. Clair. Prof. W. B. Spencer.
species,
5-6. (73 and 78 mm.) Tasmania. Australian Mus.
22. GALAXIAS ORNATUS.
Galaxias ornatus Casteln. Proc. Zool. Soc. Victoria, li. 1873,
p- 153; Macleay, Proc. Linn. Soc. N. 8. Wales, vi. 1881, p. 237.
Depth of body about 6 in the length, length of head 52. Snout
a little longer than eye, the diameter of which is 5 in the length
of head, interorbital width 23. Lower jaw slightly projecting ;
maxillary extending to below anterior 3 of eye. 8 gill-rakers on
the lower part of the anterior arch. Dorsal III 8; distance from
origin of dorsal to base of caudal 34 in the length of the fish.
Anal III 9, commencing slightly in advance of the posterior end
of the base of dorsal, when laid back not extending to the caudal.
Pectoral extending 2 of the distance from its base to the base of
ventral. Veutrals 7-rayed, originating at a point nearly equi-
distant from tip of snout and base of caudal, extending 2 of the
distance from their base to the origin of anal. Caudal emarginate.
Caudal peduncle 13 as long as deep. Body with numerous irre-
gular dark vertical stripes ; fins immaculate.
Victoria.
The typical example, from Cardinia Creek, measures 105 mm. in
total length ; I have been permitted to examine it by the courtesy
of Prof. L. Vaillant.
23. GALAXtAS oLIDUS. (Plate XI. fig. 3.)
Galaxias olidus Giinth. Cat. Fish. vi. p. 209 (1866).
Galaxias kayi Ramsay & Ogilby, Proc. Linn. Soc. N. 8. Wales,
(2) i. 1886, p. 6.
Teeth in the jaws subequal, without distinct lateral canines.
Depth of body 4-64 in the length, length of head 5-53. Snout
as long as or slightly longer than eye, the diameter of which is
4-42 in the length of head, interorbital width 24-21. Jaws equal
anteriorly ; maxillary extending to below middle of eye. 7 or 8
branchiostegals. 7% or 8 gill-rakers on the lower part of the
anterior arch. Dorsal 10-12 (III-IV 7-9); distance from origin
of dorsal to base of caudal 31-32 in the length of the fish. Anal
11-13 (IV 7-9), commencing behind the middle of the dorsal,
when laid back nearly reaching the procurrent caudal rays.
Pectoral extending from + to a little more than 2 of the distance
from its base to the base of ventral. Ventrals 7-rayed, originating
at a point equidistant from eye and base of caudal or from middle
or posterior part of pectoral and origin of anal, extending 2-3 of
; ome
the distance from their base tothe origin of anal. Caudal slightly
382 MR. C. TATE REGAN ON THE FISHES [ Nov. 28,
emarginate. Caudal peduncle 14-11 as long asdeep. Dark spots
or undulating vertical stripes on the sides of the body.
South Australia.
1-2. (100 and 110 mm.) types of the species. G. Krefft, Esq.
3. (112 mm.) one of the types of G. kayi. Fifth Creek. Australian Mus.
4-5. (75 and 84 mm.) Adelaide. i
6. (74 mm.) S. Australia. 5
24, GALAXIAS FINDLAYI. (Plate XIII. fig. 3.)
Galaxias findlayi Macleay, Proc. Linn. Soc. N.S. Wales, vii.
1882, p. 107; Ogilby, Proc. Linn. Soc. N.S. Wales, xxi. 1896, p. 66.
Teeth in the jaws subequal, without distinct lateral canines.
Depth of body 53-73 in the length, length of head 43-52. Snout
as long as or longer than eye, the diameter of which is 4-5 in the
length of head, interorbital width 24-23. Jaws equal anteriorly
or the lower somewhat the shorter; maxillary extending to below
anterior 4 of eye or beyond. 8 to 10 branchiostegals. 7 to 9 gill-
rakers on the lower part of the anterior arch. Dorsal 11-13 —
Joe 7-9); distance from origin of dorsal to base of caudal
34-32 in the length of the fish. Anal 13-14 (III-V 8-10), com-
mening below the posterior 4 of the dorsal, when laid back not
extending to the caudal. Pectoral extending 2 of the distance
from its base to the base of ventral. Ventrals 7- -rayed, originating
at a point equidistant from eye or cheek and base of caudal or
from posterior part of pectoral and origin of anal, extending 3 the
distance from their base to the origin of anal. Caudal slichtly
emarginate. Caudal peduncle 14-2 as long as deep. Sides of
body with dark spots, blotches, or vertical bars.
Victoria ; New South Wales.
1-2. (75 and 78 mm.) Mt. Kosciusko. J. Douglas Ogilby, Esq.
3-7. (40-80 mm.) Australian Alps. Australian Mus.
8-9. (81 and 83 mm.) Richmond R. By
10-11. (42 and 57 mm.) Colo Vale. 33
12-13. (66 and 68 mm.) 9)
Galaxias planiceps and G. bong-bong Macleay, Proc. Linn. Soc.
N.S. Wales, vi. 1881, p. 233, respectively from Bathurst and
from Moss Vale and Bong-Bong, are probably not distinct from
this species.
25. GALAXIAS SCHOMBURGKII.
Galaxias schomburgkit Peters, Monatsh. Ak. Berlin, 1868,
p. 455.
Depth of body 63 in the total length, length of head 53. Eye
occupying the second fourth of the length of the head. Dorsal oF
Anal 10, commencing scarcely before the posterior end of the
dorsal. Dacios! extending more than 4 of the distance from its
base to the base of Faull,
Adelaide.
Total length 50 mm.
Probably allied to G. olidus.
1905. | OF THE FAMILY GALAXIID. 383
26. GALAXIAS DISSIMILIS, sp. nl.
Teeth in the jaws subequal, without distinct lateral canines.
Depth of body 6 in the length, length of head 33. Snout much
longer than eye, the diameter of which is 5 in the length of head,
interorbital width 31. Jaws equal anteriorly ; maxillary extending
to below anterior } of eye. 8 or 9 branchiostegals. 13 gill-rakers
on the lower part of the anterior arch. Dorsal 13; distance from
origin of dorsal to base of caudal 24 in the length of the fish;
length of base of dorsal equal to its distance from the caudal.
Anal 9, commencing below the last 2 or 3 rays of dorsal, when
laid back not reaching the caudal. Pectoral extending § of the
distance from its base to the base of ventral. Ventrals 6-rayed,
commencing below the origin of dorsal, extending nearly to the
origin of anal. Caudal slightly emarginate. Caudal peduncle
12 as long as deep. Uniform brownish (in spirit). '
? New South Wales.
1. (75 mm.) type of the species. Australian Mus.
NEOCHANNA.
Neochanna Ginth. Ann. Mag. Nat. Hist. (3) xx. 1867, p. 305.
Differs from Galaxias in having no ventral fins, the teeth in the
jaws obtuse and somewhat compressed, and the palate toothless.
54 vertebree.
A single species from New Zealand.
NEOCHANNA APODA.
Neochanna apoda Giinth. t. ¢. p. 306, pl. vil.; Hutton, Fish.
N. Zeal. p. 61, pl. x. fig. 97 (1872).
Depth of body 7-8 in the length, length of head 5-52. Dia-
meter of eye 6-8 in the length of head, interorbital width 23-25.
Jaws equal anteriorly ; maxillary extending to below the eye.
7 branchiostegals. 8 gill-rakers on the lower part of the anterior
arch. Dorsal 16-19; distance from origin of dorsal to base of
caudal 32-34 in the length of the fish. Anal 16-19, opposite to
the dorsal and similar to it, both fins subcontinuous with the
caudal. Pectoral about 2 the length of head. Caudal rounded.
Yellowish, marbled or barred with dark brown ; fins sometimes
with small dark spots.
New Zealand.
1. (135 mm.) type of the species. New Zealand. Sir G. Grey.
2. (114 mm.) Hokatika. Otago Mus.
3-6. (67-88 mm.) ks KE. Hill, Esq.
7, Skeleton. a se
8. (127 mm.) — Sir D. Cooper.
EXPLANATION OF THE PLATES.
PuatE X.
Fig.1. Galaxias affinis, p. 380.
2. ia huttoni (X 2), p. 373.
3. a punetifer (X 12), p. 367.
A. A; lynx, p. 373.
384 MR. J. L. BONHOTE ON THE [ Nov. 28
Prats XI.
Fig.1. Galaxias weedoni, p. 377.
2. i waitii, p. 376.
3. # olidus (type of G. kayi), p. 381.
4. 5 occidentalis, p. 376.
Prate XII.
Fig.l. Galawias attenuatus (type of G. punctatus), p. 368.
2, a coxii, p. 380.
Prater XIII.
Fig.1. Galaxias auratus, p. 379.
2. 3 attenuatus (type of G. krefftiz), p. 368.
3. as findlayi, p. 382.
4. # truttaceus, var., p. 378.
5. The Mammalian Fauna of China.—Part I. Murine.
By J. Lewis Bonnore, M.A., F.L.S.*
[Received October 28, 1905.]
The object of a proposed series of papers, of which this 1s
the first, is to brig up to date our existing knowledge of the
Mammalian Fauna of China, at present scattered throughout
various papers, which, except Mons. Milne-Edwards’s ‘ Recherches
Mammiferes,’ are short.
The material used has been chiefly that contained in the
British Museum, which, apart from a portion of Swinhoe’s col-
lection, contains large collections made by Messrs. Styan, Rickett,
and La Touche, as well as several smaller collections, amongst
which we may mention a small consignment very carefully
collected by Mr. E. B. Howell.
IT have to thank the late Dr. E. Oustalet for his kind courtesy
and the facilities afforded me for a careful examination of Pére
David’s types in the Paris Museum.
Many imperfections due to lack of specimens and exact data
are bound to occur, but it is hoped that these papers may prove
useful as a foundation on which future workers may build, and
with this object in view the synonymy throughout has been made
as full and accurate as possible.
List of Chinese Murine.
Mus edwardsi Thos.
Mus coxingi Swinh.
Mus confucianus A. M.-E.
Mus huang, sp. n.
Mus ling, sp. n.
Mus latouchet Thos.
7. Mus flavipectus A. M.-Edw.
* [The complete account of the new species described in this communication
appears here; but since the names and preliminary diagnoses were published in the
* Abstract,’ the species is distinguished by the name being underlined.—Eprror. |
POT HE Oo PO
1905. | MAMMALS OF CHINA. 385
8. Idus losea Swinh.
9. Mus griseipectus A. M.-H.
10. Mus norvegicus Erxl.
11. Mus humiliatus A. M.-H.
12. Mus musculus Linn.
13. Micromys sylvaticus chevriert A. M.-H.
14. Micromys sylvaticus draco Bary.-Hamilton.
15. Micromys minutus pygmeus A. M.-K.
16. Micromys agrarius manchuricus Thos.
17. Micromys agrarius ningpoensis Swinh.
Mus EpwArRpst Thos.
Mus edwardsi Thos. P. Z. 8. 1882, p. 587, pl. xliv.; Thos.
P. Z. 8. 1898, p. 773; Bonh. Fasc. Malayenses, Zool. vol. 1.
pp. 33 & 36 (1903).
This species was originally described from four examples sent
to Paris by Pere David. The type is in the B.M. 82.6.16.1,
the other three examples being in Paris and dated October 1872.
This is a very large Rat belonging to the jerdoni group, of
which it is typical of the subgroup bearing itsname. The British
Museum now possesses a fine series of these Rats from Kuatun
in N.W. Fokien. They seem to be very uniform and show
remarkably little variation.
The general colour is yellowish grey, some specimens being
much yellower than others. Hach hair is slate-grey at its base
and fulvous for the distal half, and interspersed among these hairs
are long slender spines with dark tips as well as long black
bristles. On the flanks, owing to the absence of the black bristles,
the fulvous colour of the fur proper is more visible.
The under parts are pure white. The tail is equal in length to
the head and body, markedly bicolor, and covered with short
hairs, while the last two or three inches are pure white. The
feet are uniform dark brown with white margins and toes.
Whiskers very long and entirely black with the exception of a
few shorter white ones.
The skull partakes of the usual characters associated with the
jerdont group, é. g., long, narrow, flat, and with small bulle. The
supraorbital ridges are well defined over the orbits and slightly
flattened so as to produce a comparatively broad upper surface ;
they end somewhat abruptly about halfway across the parietals.
Below, owing to the smallness of the bulle, the basioccipital
presents a broad surface and the external condyles are well
developed.
The dimensions (as given by Thomas and rendered into milli-
metres) are as follows :—Head and body 300; tail 289; hind
foot 57; ear 24.
Skull. Greatest breadth 57 mm.; basilar length 44; palatal
length 24:5; diastema 15; incisive foramina 10; length of nasals
22°5; zygomatic breadth 26; interorbital breadth 9°5; breadth
of brain-case 22; length of molar series (alveoli) 11.
386 MR. J. L. BONHOTE ON THE [ Nov. 28,
Habitat. Only recorded from W. and N.W. Fokien.
The first specimens of these Rats were all obtained high up on
the mountains among rocky ground, in the erevices of which it
lives. Beyond this, nothing is known of its habits. It has only
been taken in W. and N.W. Fokien.
Mus coxinert Swinhoe.
Mus coninga Swinhoe, P. Z. 8. 1864, pp. 185, 382.
Mus coxinga Swinhoe, P. Z. 8. 1870, p. 637; Thos. Ann. Mus.
Gen. 1892, p. 939 (footnote).
Mus coxingi Swinhoe, Bonh. Fase. Malay., Zool. vol. i. pp. 33
& 36 (1908),
Mus coninga (ander which name it was originally described by
Swinhoe) is undoubtedly a Rat of the jerdoni type (rajah sub-
group), and not the jerdoni subgroup as noted by me. The typical
form, as described by Swinhoe, has the upper parts reddish brown,
sprinkled with stiff black bristles, especially on the back, where
the fur is also often a little darker. Under parts pure white;
feet white; tail bicolor, white at the tip.
The skulls at my disposal are too fragmentary to allow of a
description.
Dimensions (from skin). Head and body 208 mm. ; tail 180;
hind foot 36.
Skull. Palatallength 19 mm.; diastema 11; incisive foramina 7;
length of nasals 17; interorbital breadth 6:5; length of molar
series (alveoli) 8 mm.
Habitat. Formosa.
Swinhoe noted many varieties of this species as occurring in
Formosa; these doubtless represent forms belonging to the
different subgroups of the jerdoni group, but unfortunately the
only specimens I have been able to examine are a portion of
Swinhoe’s series of which the skullsare all defective. It is there-
fore impossible to distinguish any of these varieties by name; but
the true coxingi may be distinguished by its white feet, the white
tip to its tail, and the fact that the fur is thickly beset with
spines.
Mus conructanus A. M.-E,
Mus confucianus A, M.-Edwards, Nouv. Arch. du Mus. vii.
p. 93 (1871); id. Rech. Mamm. p. 286, pl. xli. fig. 2 (1874); Thos.
P. Z. 8. 1898, p. 773 (partim); Bonh. Fasc. Malay., Zool. vol. i.
p. 33.
General colour above dark brown (clay, Ridgw.), shading to
pale buff or yellowish on the flanks. Fur slate-grey at the
base with pale fulvous tip, interspersed amongst which are long
black bristles. The pale tips predominate over the black so as
to give the animal the appearance noted above. Occasionally these
bristles are semi-spinous, and in one or two examples the fur is
exceedingly harsh and spiny; but as a rule it is quite soft to the
1905. | MAMMALS OF CHINA. 387
touch, as stated by M. Milne-Edwards in the original description.
Under parts pure milk-white, sharply contrasted with that of the
upper parts. Feet whitish, but the colour of the upper parts
runs down the centre of their upper surface to a varying extent.
Tail moderately long and bicoloured, clothed with short hairs; its
terminal portion is usually, but not invariably white. The skull
is that of a typical Mus of the jerdoni group, being long and
narrow, somewhat flattened and with small bull.
Dimensions (in flesh). Head and body 164 mm.; tail 192;
hind foot 39; ear 18.
Skull (average dimensions). Greatest length 36 mm.; basilar
length 27:5; palatal length 15; diastema 9°75; incisive fora-
mina 6°6; length of nasals 13°6; zygomatic breadth 16; inter-
orbital breadth 6; greatest breadth of brain-case 14; length of
molar series (alveol1) 6.
Habitat. The type was received from Pére David ‘from the
mountains of Moupin, in the province of Szechuen, W. China.
There are also specimens in the Museum from H. Kiangsi, from
Kuatun and Ching Fen Ling in N.W. Fokien, and from Nankin,
all forming a very uniform series showing hardly any variation.
It is as a rule generally found in the mountainous country,
occasionally entering the houses in winter; and it may be easily
recognised, for its dull brown colour and pure white under parts,
sharply divided from the colour of the back, form a combination
of characters found in no other Rat from that part of the world.
Some of the spiny individuals very closely resemble Mus nivet-
venter from the Himalayas, of which it is probably the Chinese
representative.
Mus HUANG.
Mus confucianus A.M.-E., O. Thos. P.Z.8. 1898, p. 773 (partim).
Mus huang Bonh. Abstr. P. Z.8. No. 23, p. 19, Dec. 5, 1905.
Size as in the last-mentioned species. General colour rufous
(ochraceous-rufous, Ridgw.), darker along the dorsal area. The
underfur is slate-coloured at its base with a rufous tip, thickly
intermixed, especially on the back, with black bristles or spines.
On the flanks the bristles become much less numerous and many
of them have rufous tips. The colour of the head resembles that
of the upper parts. The feet are whitish, with the rufous colour
running down the centre of their upper surface. Under parts
pure white, the line of demarcation being sharply defined. Tail
rather longer than the head and body, clothed with short hairs
and bicoloration. Ears moderately long and sparsely covered
with very close, short, dark brown hairs.
The skull very closely resembles that of MW. confucianus in size
and general appearance, but may be recognised by the supra-
orbital ridges being continued right across to the posterior margin
of the parietal.
Dimensions (of type from skin). Head and body 155 mm.;
tail 188; hind foot 30; ear (approx.) 16.
388 MR. J. L. BONHOTE ON THE [ Nov. 28,
Skull (of type). Greatest length 87 mm.; basilar length 27 ;
palatal length 15; diastema 9°5; incisive foramina 7; length of
nasals 14; interorbital breadth 6; greatest breadth of brain-
case 14; leneth of molar series (alveoli) 6.
Type. B. M. 89.11.1.16. dad. Collected on the 24th April, 1898,
at Kuatun, N.W. Fokien, by Mr. J. D. La Touche.
Habitat. Kuatun. The Museum also contains a specimen
indistinguishable from the type from the Ngau-tchi-lea Mts.,
Hainan.
This species is evidently the representative of the true J/us
jerdoni, although it is more spiny than the other members of
that subgroup hitherto described. Its nearest ally is J/us rapit,
mihi, from Borneo, to which it bears a very close resemblance.
From Jus confucianus it may be easily distinguished hy its bright
coloration, the absence of any white tip to the tail, and also the
very much shorter hairs with which the tail is clothed.
I have called this species from its Chinese name “ Huang mao
shu,” meaning yellow-haired rat.
Mus LING.
Mus confucianus A. M.-E., O. Thos. P.Z.8. 1898, p. 773 (partim).
Mus ling Bonh. Abstr. P. Z.8. No. 23, p. 19, Dee. 5, 1905.
Size smaller and paler, otherwise closely resembling JZus huang.
The amount of spininess varies considerably, some individuals
being very thickly beset, while in others the fur is uniformly soft.
The tail is covered with short hairs and bicoloured as the J/us
huang, but in the young and in some adult individuals we find a
tendency to a anicolon ous tail. The general colour is fulvous
(ochraceous-buff, Ridgw.).
Skull. Except for its smaller size, the skull does not differ
markedly from that of J/us huang. The ridges referred to in
that species may be traced as far back as the posterior margin of
the parietal, but ave not so strongly marked. Several skulls,
however, are intermediate in size between those of this species
and those of Jus huang, but this Rat may in all cases be distin-
guished externally by its paler colour and shorter tail; while m
no case does any single measurement overlap that of the smallest
M. huang.
Dimensions (of type from skin). Head and body 132 mm. ;
tail 157; hind foot 27; ear 15.
Skull (of type). Greatest length 33 mm. ; basilar Jeng 25 ;
palatal length 14; diastema 8°5 ; incisive foramina 5:5 ; length of
nasals 12 ; zygomatic breadth 14; interorbital breadth 5°5 :
greatest breadth of brain-case 14; length of molar series (alveoli)
55.
Type. B.M. 98.3.7.8. Collected by Mr. C. B. Rickett in
December 1897, at Ching Fen Ling, N.W. Fokien.
Habitat. Ching Fen Ling, N.W. Fokien; it also occurs at
Kuatun in the same province.
This species is the representative of the eremoriventer subgroup.
1905. ] MAMMALS OF GHINA,. 389
In external appearance it resembles Mus eremoriventer Mill. very
closely; the bicoloured tail, however, serves as an easily dis-
tinguishable feature, but that it is very nearly related is shown
by the tendeney in the young and even some adults to the uni-
colorous tail. The immature pelage is, as a rule, soft and
destitute of bristles, and resembles in colour true J/. confucianus.
This species seems to be most abundant at Ching Fen Ling,
but it also occurs at Kuatun.
Mus LAroucHet Thos.
Mus latouchei Thos. Ann. & Mag. N. H. ser. 6, vol. xx. p. 113
189%); 1d. BaZSi 1898; para; “Bonh. Fasc. Mal: ay., Zoology,
vol. i. p. 84 (1908).
General colour of the upper parts clear grizzled grey. Fur
light at its base, with a greyish-brown Sulote uma portion and
white tip, thickly intermixed with soft spines similar in colour
but lacking the white tip. Under parts pure white, the hairs
being white to their bases. Hands and feet white along their
margins and on the digits, brownish in the centre. Tail dark,
covered with short hairs, white at the tip im some individuals.
Ears large, rounded and almost naked.
The skull most nearly resembles that of Mus bowersi, from
which it differs, according to Mr. Thomas, in haying the line of
the fronto-premaxillary and fronto-nasal suture running straight
from side to side, instead of being bowed backwards, and the supra-
orbital rims more developed. The incisors are broad and pale
yellow.
Dimensions (of type from skin), Head and body 310 mm. ;
tail 290; hind foot 60.
Skull. Greatest length 58 mm.; basilar length 48; palatilar
length 28; diastema 17; length of incisive foramina 11; length
of nasals 23°5; interorbital breadth 8; breadth of brain-case 22 ;
length of molar series 10.
Habitat. The type came from Kuatun, as do all the series of
specimens that have hitherto been obtained, although Mr. Thomas
mentions a specimen in the Paris Museum from Pere David.
It is evidently a scarce Rat, and little seems to be known of its
habits, but according to Mr. La Touche it inhabits the forest
country. Its uniform grizzled-grey colour and large size are
sufficient to distinguish it from all other Chinese rats.
Mus ruAvirecrus A. M.-E.
Mus ? Swinhoe, P. Z. 8. 1864, p. 382. no, 26.
Mus canna Swinhoe, P. Z.8. 1870, p. 636.
Mus alexandrinus Geoftr., Swinhoe, P. Z. 8. 1870, p. 635.
Mus flavipectus A. M.-E, Nouv. Arch. du Mus. vol. vii. p. 93
(1871); id. Rech. Mamm. p. 289, pl. 42. fig. 1 (1874); Bonh.
Fase. Malay. ., Zoology, vol. i. pp. 35 & 37.
Mus owangthome A. M.-K. Nouv. Arch. du Mus, vol, vii. p. 93
(1871); id. Rech. Mamm. p. 290, pl. 40. fig. 3 (1874).
=
PA
a
390 MR, J. L. BONHOTE ON THE [Nov. 28,
Mus plumbews A. M.-E. Rech. Mamm., p. 138, pl. 43. fig. 2
1874).
ee ratius flavipectus A. M.-K., Thos. P. Z.S. 1898, p. 772.
This species is the representative of the rufescens-group of
Mus rattws, which inhabits China. It is of moderate size, having
the tail rather shorter than the head and body. Fur soft and
destitute of spines. General colour above uniform yellowish
brown, slightly lighter on the flanks. Hairs slate-coloured at
their base, with ochreous tips, and intermixed among these are pure
black hairs of a finer texture. Under parts varying from dirty
yellowish to yellowish-white, often, but not invariably, showing
traces of a white mark on the breast. The hind feet are whitish
and the hands dark brown margined with white. Tail unicoloured
and covered with hairs.
Skull. The skull is that of a fairly typical J/us rufescens, and,
except in its slightly smaller size, is indistinguishable from the
Tndian form*.
Dimensions. Head and body 200 mm.; tail 160; hind foot 31 ;
ear 18.
Skull 7. Greatest length 41 mm.; basilar length 36-5; palatilar
length 20; diastema 11°5; length of incisive foramina 8; length
of nasals 15; zygomatic breadth 20; interorbital breadth 6;
breadth of brain-case 15:5; length of molar series 7.
Habitat. The type of this species came from Moupin in
W. Szechuen, but it also occurs at Kuatun in N.W. Fokien,
Kiou Kiang in Kiangsi, and Foochow, so that it is probably
widely distributed throughout the country. It also occurs in
Formosa.
This and Jus griseipectus are the common Rats of China. The
difference in the colour of the under parts, as denoted in their
specific names, will form to some extent a distinguishing character,
although the under parts in flavipectus often become very light,
and in old specimens of griseipectus may show a yellowish tinge.
However, I am inclined to think this character unreliable, and
a much better test is the greater size of griseipectus, as shown by
the length of the hind foot and skull-measurements. In grisez-
pectus, moreover, the tail, although it can hardly be called
“bicolor,” is distinctly lighter on its under surface, and this seems
to be the only reliable external characteristic at all ages.
In the description of WM. flavipectus in the Rech. Mamm.,
M. Milne-Edwards adds a footnote to say that J. germaini from
Pulo Condor closely resembles this species, especially im its
coloration. Although approximately correct, it may be well to
notice that J. germaini may be distinguished by its size, which
* For careful figure of the skull of JZ. rufescens, see paper by the author,
Fasc. Malayenses, Zoology, vol. i. pl. iv. fig. 3 (1903).
+ The measurements, which are the same as those taken in my former paper, are
now called after Mr. O. Thomas’s scheme for cranial measurements, published
Proc. Biol. Soc. Wash. vol. xviii. p. 191 (1905), the alterations (in name only) being
basilar and palatilar for basal and palatal.
1905. } MAMMALS OF CHINA. 391
is greater than that of MW. griseipectus. The ears are longer, and.
the colour of the under parts, which is white, differs from that of
both I, jlavipectus and MW. griseipectus by the fact that the hairs
are white to their bases and not slate-coloured.
When working out Pére David’s collection from Moupin,
M. Milne-Edwards described a species under the name of
M. owangthome, stating that it was distinguished by a pure white
cross on the breast. It was described from a single specimen,
which, by the kindness of Dr. Oustalet, I had the privilege of
examining when in Paris, and I am of opinion that it is merely
a 4-grown example of this species. The white cross is not so
conspicuous as one would be led to infer from the description,
and is merely a well-marked development of the white breast-
mark which is found in many individuals of otherwise typical
Jlavipectus.
Another species from the collection of Pére David was described
by M. Milne-Edwards under the name J, plumbeus, and figured
in the Rech. Mamm. This specimen I have also had an oppor-
tunity of examining, and the coloration depicted in the plate is
much too blue. There is a specimen in the British Museum
which agrees tolerably well with the description and type of
M. plumbeus, but on examination of the skull it proves to be a
very young individual, probably belonging to I. flavipectus.
The latter is the only specimen I have seen that shows white
incisors, a characteristic of IZ. plumbeus. Under these circum-
stances, and as the skull of the type of JZ. plumbeus cannot be
examined, as it has not been removed from the skin, we must, in
the absence of further evidence, consider pluwmbeus as founded on
an immature flavipectus.
MUS LOSEA Swinhoe.
Mus flavescens E\liot, Swinhoe, P. Z. 8. 1864, p. 186.
Mus rufescens Gray, Swinhoe, P.Z.S. 1870, p. 636.
Mus losea Swinhoe, P. Z. 8. 1870, p- 637.
This species may best be described as a small formi of J/. flavi-
pectus, to which it closely approaches in coloration. The under
parts are, however, as a rule greyer. The tail is unicoloured and
very finely annulated (the ammuli being 14 to the em. as against
12 in flavipectws), and covered with minute and almost invisible
sete.
The ear is elongated, being longer by 2 mm. than HELGA
avipectus of the same size.
The skull, except in being + the size, is otherwise ble
tinguishable.
Dimensions (from skin), Head and body 150 mm.,; tail 123;
ear 18; hind foot 26.
Skull. Greatest length 32 mm.; basilar length 26; palatilar
length 15; diastema 8; incisive foramina 6°5; length of nasals
PA2 zygomatic readlth 15; interorbital breadth 5; length of
molar series 6°5; breadth of brain-case 14.
Proc. Zoot. Sno 100, Wott, Je INO, ZO WUE = 27
392 MR, J. L. BONHOTE ON 'THE [ Nov. 28,
Habitat. This species was originally described from Tamsuy in
Formosa. But there is also a specimen collected by Mr. Swinhoe
at. Amoy, and other specimens in the Museum from W. Fokien.
This is undoubtedly a small form of J. flavipectus, distin-
guishable, apart from its size, by the more elongated ear and finer
annulations to the tail.
It is possible that the original losea from Formosa may prove
to be different from the form inhabiting the mainland; and this
is the more likely, as in the paper describing the original losea
Mr. Swinhoe referred to the specimen from Amoy as Mus rufescens.
For the present, however, owing to lack of material, | have no
alternative but to consider them all as Josea.
Mus eriserpecrus A. M.-E.
Mus indicus Geoftr., Swinhoe, P. Z.S. 1870, p. 635.
Mus griseipectus A. M.-EK. Nouv. Arch. Mus. 1871, p. 93;
id. Rech. Mamm. p. 290, pl. 42. fig. 2 (1874).
Similar to I. flavipectus, but slightly larger. Tail about
equal in length to the head and body. Fur soft and destitute of
spines. General colour above yellowish brown; fur slate-grey at
base, with yellowish tips, and thickly interspersed among these
are longer thin black hairs, which predominate along the median
flovsal area. Upper surfaces of the feet and hands white. Under
parts white or greyish, the fur being dark at its base as in the
upper parts.
Skull. The skull, except in being slightly larger, closely re-
sembles that of IZ. favipectus, and calls for no special comment.
Dimensions. Head and body 196 mm.; tail 160; hind foot 33 ;
ear 22.
Skull. Greatest length 45 mm.; basilar length 36; palatilar
length 22; diastema 13; length of incisive foramina 8; length
of nasals 17; zygomatic breadth 21:5; interorbital breadth 7;
breadth of brain-case 18; length of molar series 8.
Habitat. Sze-chuen (type-locality); also found in W. Fokien.
There is but little further to add with regard to this species.
It is most likely to be confused with J. flavipectus, but the
characters distinguishing it from that species have already been
given. There is, however, another small character which it may
be as well to notice. In J/. flavipectus the hands on their upper
surfaces are brown margined with white, while in all the specimens
of griseipectus that I have examined the upper surfaces of the
hands are uniformly white.
Mus norvecicus Erxl.
Mus decumanus Pall., Swinhoe, P. Z.8. 1864, pp. 186, 382; id.
op. cit, 1870, pp. 233, 635.
Mus humiliatus A. M.-E., Thos. P. Z. 8. 1898, p. 772
{partim).
1905. | MAMMALS OF CHINA. 393
The common Norway Rat occurs not infrequently in China,
as shown by several examples in the British Museum. Apart
from the skull-characters, which are quite distinctive, it may be
recognised from griseipectus, which it resembles most closely
externally, by its larger size (hind foot 36 mm.) and stouter tail.
Mus numitiatus (A. M.-E.).
Mus humiliatus A. M.-E., Ann. Sci. Nat. vii. p. 375 (1867);
id, Rech. Mamm. p. 137, pl. 41. fig. 1 (1874); Rhoads, Proc. Acad.
Nat. Sci. Philad. 1898, p. 121; Thos. P. Z. 8. 1898, p. 772.
Another member of the Mus rattus group but smaller. General
colour above yellowish-brown. Fur slate at its base, but yellowish
brown (cinnamon, Ridgw.) for the greater part of its length,
becoming paler on the flanks ; intermixed with the fur are a few
long soft black hairs, but they are so scattered as to have but little
effect on the general colour. The hands and feet are white, and
the under parts uniform grey. The tail is short, tapering, and
bicoloured, well clothed with short hairs that are brown on the
upper and white on the lower surface. The ears small and
rounded and covered with fine hairs.
The skull differs from that of IZ. griseipectus in being broader
and shorter. ‘The supraorbital ridges are not so well marked and
do not run back so far, disappearing about halfway across the
parietals.
Dimensions (taken in flesh: Nankin *), Head and body
145 mm.; tail 115; hind foot 30; ear 16:5.
Skull (of co-type). Greatest length 35mm.; basilar length 29;
palatilar length 17; diastema 7; length of incisive foramina
6; length of nasals 12; zygomatic breadth 18; interorbital
breadth 6 ; breadth of brain-case 15; length of molar series 7.
Habitat. Pekin and neighbourhood (type); Nankin and W.
Fokien.
The chief distinctive feature of this Rat is its light colour, caused
by the almost entire absence of the longer black hairs found in so
many species, and besides this its smaller size and short tail form
a combination of characters enabling it to be easily recognised. It
is apparently a scarce animal, as only one specimen has reached the
British Museum during the last 23 years, and it is entirely absent
from the collections of Messrs. Styan, Rickett, and La Touche.
Mr. Howell has, however, just sent over a small collection, which
contains a mature female, from the city of Nankin, this specimen
agreeing closely in all respects with the type.
A specimen received originally from the Paris Museum as
belonging to this species, and collected by Pére David in W. Fokien,
is undoubtedly Mus novegicus, and it was this example that led
Mr. Thomas to suggest J/us humiliatus as the possible wild stock
of Mus norvegicus.
* The skull-measurements of this specimen practically coincide with those of the
co-type.
21*
394 MR. J, L, BONHOTE ON THE [ Nov. 28,
Key to the larger Chinese Species of Mus.
(Hind-foot measurement of the smallest, 26 mm.).
A. Colour of under parts sharply divided from that of upper Pah ts.
a. Size large. Hind foot 57 mm. ........ Serene . WM, edwardsi.
b. Smaller. Hind foot not exceeding 36 mm.
Gye Meet swihites 5. sce ee Ree cee een et rere s Sac AP Re PCO AGT:
6;. Feet coloured.
a>. General colour dull brown (clay, Ridgw.). Hind
footrSQ amis F ptr eee aces ck bcs chamdo teense M. confucianus.
6. General colour brighter ee nugus R.).
Hind foot 30 mm. seen cvoceone Lhe PONG):
Smaller and paler, Hind foot 27mm. ........... Me ling.
B. Colour of under parts not sharply divided from that of upper
parts.
a. Tail bicolor. Hands white.
a,- Tail clothed with minute sete. Hind foot 33 mm.... I. griseipectus.
bj. ees clothed with hairs.
. Large. Hind foot 36 mm.. sasigeeacos tte . M. norvegicus.
Smaller. Hind foot 30 mm. seein . M. humiliatus.
b. eT fol Hands brown with white margins.
hed of under parts with slate-coloured bases.
. Size large. Hind foot 31 mm.. bare . WM. flavipectus.
i. Smaller. Hind foot 26 mm.. M. losea.
. Fur of under Dai white throughout. “Hind foot
60 mm.. Slsen nintgbopess Atacstene anatee tia tees . MW. latouchet.
Mus muscuuus L.
Mus musculus L., Swinhoe, P. Z. 8. 1864, p. 382, and 1870,
p. 637.
The common House-Mouse does not seem to be very abundant
in China, though there are several specimens in the Museum from
widely separated localities in that country.
A description of so well known a species would be superfluous,.
and there is no other mouse with which it could well be
confused.
Dimensions (from spirit-specimen). Head and body 77 mm.;
tail 80; hind foot 17.
Micromys Dehne.
Micromys (type of genus Micromys agilis, Dehne, Hofléssnitz,
1841), revived by O, Thomas, Ann. Mag, N. H. ser. 7, vol. xv. p. 491
(May 1905).
Mr. Thomas has used Jdicromys as the generic name of: several
species of the smaller mice hitherto included under the universal
genus “ Maus.” The Chinese forms belonging to it are :—
Mus sylvaticus chevrieri.
3 draco.
Mus minutus pygmeus.
Mus agrarius manchuricus.
A _ ningpoensis,
The distinctive character of this genus is that the posterior
1905. } MAMMALS OF CHINA, 395
lamin of the first and second upper molars have each an
additional internal cusp beyond the number present in Mus, so
that, counting along the inner side of the tooth-row, there are three
cusps on both the first and second molars.
MICROMYS SYLYATICUS CHEVRIERI (A. M.-E.).
Mus chevriert A. Milne-Edwards, Rech. Mamm. p. 288, pl. xl.
fig. 2 (1874); E. Biichner, Mamm. Przewalski, p. 92 (1889).
Mus sylwaticus chevrieri (A. M.-E.), Barrett-Hamilton, P. Z.S8.
1900, p. 418.
Major Barrett- Hamilton, in the paper noticed above, restricts the
name chevrieri to that form of Wicromys sylvaticus represented
by tlie typical series from Moupin in Tibet.
The general colour is pale fawn, grizzled with brownish on the
back. The under parts and feet are pure white. Tail about equal
in length to the head and body, bicoloured and scantily clothed
with hair.
Dimensions. Head and body 100 mm.; tail 90; hind foot
21°5 mm.
Habitat. Moupin, Tibet. A single specimen in the British
Museum from 8. Shensi is probably referable to this species.
So little is known of this species that it is impossible to add
anything in reference to its habits, &c.
MiCROMYS SYLVATICUS DRACO (B.-H.).
Mus chevriert A. M.-E., Thos. P. Z. 8. 1898, p. 773.
Mus , Sp. no. 27, Swinhoe, P. Z. 8. 1864, p. 382.
Mus sylvaticus draco Barrett-Hamilton, P. Z. 8. 1900, p. 418.
Mus badius Blyth, Swinhoe, P. Z. 8. 1870, p. 233.
This form of Mus sylvaticus described by Major Barrett- Hamilton
may be distinguished from Jicromys chevrieri by its duller colour
and its slightly smaller size. The general colour is pale fulvous
(hair-brown, Ridgw.), darker along the median dorsal area owing to
many of the hairs having black tips. Feet and under parts pure
white. Tail well clothed with short hair, dark above and light
below. The bases of the hairs on all parts of the body are slate-
coloured.
According to the original describer, the skull is *‘ narrower and
slightly smaller than that of the adult of the subspecies intermedius
(of Britain and portions of Western Europe), and having the
anterior portions of the frontals more attenuated and the nasal
region proportionately more slender than in the latter sub-
species.”
Dimensions. Head and body 91 mm.; tail 95; hind foot 20.
Skull. Greatest length 26mm.; basilar length 21; palatilar length
11; diastema 7; iength of incisive foramina 5 ; length of nasals 10;
interorbital breadth 5; breadth of brain-case 11; length of molar
series 4.
396 MR. J. L. BONHOTE ON THE [ Nov. 28,
Habitat. Kuatun, N.W. Fokien.
The typical series, all from Kuatun, are the only ones at present
known.
Micromys MiINuUTUS Pyemmus (A. M.-E.).
Mus pygmeus A. M.-Edw. Rech. Mamm. p. 291, pl. xliii. fig. 1
(1874); Thos. P. Z. 8. 1898, p. 775.
Mus minutus pygmeus B.-Hamilton, Ann. & Mag. N. H.
ser. 7, vol. iii. p. 343 (1899).
This is the Chinese representative of our European Harvest-
Mouse, from which it differs in its rather longer tail and darker
colour. The general colour above is of a uniform olive-brown,
rather more rufous on the hind-quarters. The under parts are
greyish white. Hands and feet scantily clothed with brownish
hair. Tail equal in length or longer than the head and body,
clothed with minute and almost invisible sete.
The skull, which is typical of the genus, has a moderately broad
brain-case, but is rather short in the muzzle. The bulle are
large for the size of the skull, and project sharply downwards, com-
pressing the basioccipital at its anterior portion.
Dimensions of a dried skin from Kuatun. Head and body
58 mm.; tail 61; hind foot 14*.
Skull. Greatest length 19 mm.; basilar length 17; palatilar
length 8; diastema5; length of incisive foramina 3°6; length of
nasals 6; interorbital breadth 3°7; breadth of brain-case 9 ;
length of molar series 3:8.
Habitat. Sze-chuen. Specimens in the British Museum from
Kuatun and Shanghai.
Nothing further is known of the distribution or habits of this
species. The Japanese Harvest-Mouse recently described by
Mr. Thomas is more rufous and resembles the Kuropean one more
closely than the Chinese.
MiICROMYS AGRARIUS MANCHURICUS (Thos.).
Mus agrarius mantchuricus Thos. P. Z. 8. 1898, p. 774.
This is the Northern Chinese form of Wus agrarius, from
typical examples of which it differs only to a slight extent. It 1s
slightly larger and more rufous in its general tone of colour. The
dark median dorsal stripe is black and very clear cut, and starting
from the crown reaches to the root of the tail. Under parts grey
with a tinge of rufous along the middle line. Tail dark brown
above, lighter below, well covered with short hairs.
The skull does not materially differ from that of J/. agrarius
typicus.
Dimensions (of type after Thos.). Head and body 116 mm. ;
tail 78; hind foot 19; ear 14.
* The measurements of the type as given by M. M.-Edwards are: head and body
73, tail 53, ear 5, hind foot 18; but on the discrepancies between the tail and hind-
foot measurements see O. Thomas, loc. cit. supra.
1905. ] MAMMALS OF CHINA. 397
Skull. Greatest length 27 mm. ; palatilar length 12 ; diastema 8 ;
length of incisive foramina 6; length of nasals 10; interorbital
breadth 4; breadth of brain-case 11; length of molar series
(alveoli) 4.
Habitat. The type comes from near the Corean border of
Manchuria. The British Museum contains a further specimen
from S. Shensi procured by Pére David, which has been referred
to this race.
MICROMYS AGRARIUS NINGPOENSIS Swinh.
Mus ningpoensis Swinh. P. Z.8. 1870, p. 637 et 1872, p. 818.
Mus harti Thos. P. Z. 8. 1898, p. 774.
Very similar to UW. a. manchuricus, but lacking the rufous
tinge on the back, which in the present species is replaced by
fulvous. General colour above fulvous throughout, uniformly
grizzled with black. In some cases a well-defined dark stripe is
apparent down the back, and in most specimens a trace of a dark
stripe is discernible. Under parts white, sharply defined from the
colour of the upper parts. Tail brown above, lighter below, and
covered with short hairs.
The skull does not appreciably differ from that of J. agrariws
typicus.
Dimensions (of type converted from inches given in Swinhoe’s
description). Head and body 81 mm.; tail 68; hind foot
(measured from type) 20.
Another example, ¢ (in flesh, coll. E. B. Howell, no. 69).
Head and body 111 mm.; tail 78; hind foot 20; ear 14.
Skull. Greatest length 26 mm.; basilar length 21-5; palatilar
length 11; diastema 7; length of incisive foramina 5 ; length of
nasals 10; zygomatic breadth 12; interorbital breadth 4°7 ;
breadth of brain-case 11:5; length of molar series 4.
Type. Collected by Mr. Swinhoe. Now in the Berlin Museum.
Habitat. Ningpo. The British Museum contains specimens also
from Nankin, Hanchow, and Kuatun.
T have had to sink, under Swinhoe’s name, Mr. Thomas’s dJZus
harti, as there can be no doubt as to itsidentity with nimgpoensis.
Since the description of Mus harti was written, a fine series has
been received from the neighbourhood of Nankin, collected by
Mr. Howell. It appears that although the dorsal stripe is asa rule
faint and indistinct, it is in some cases deep black and very well
marked, while in other individuals no trace of it can be found.
Herr Matschie (in litt.) states that in the type of ningpoensis
there is no trace of the dorsal stripe, and the same is the case
with the type of J. harta.
Little is known of its habits; Mr. Howell seems to have
trapped most of his specimens on open ground in the vicinity of
water.
398 MR. MARTIN JACOBY ON NEW SPECIES | Nov. 28,
6. Descriptions of new Species of Phytophagous Coleoptera
of the Genera Homopheta, Asphera, and Oe¢edionychis.
By Martin Jacosy, F.E.S.
[Received May 13, 1905. ]
(Plates XIV. & XV.*)
In the ‘ Proceedings’ for 1894 (p. 609) I have given the descrip-
tions of many species belonging to the group of bladder-clawed
Halticine, which until then were simply Catalogue names as
published by Clark. The number of further species which I have
received since enables me to publish here a considerable addition
to my former paper; where Clark’s names have been retained for the
same species I have stated this, but by far the greater portion of
my species were not known to Clark. The genera Oedionychis and
Asphera as at present understood almost rival in species the
Galerucid genus Diabrotica, and it is frequently very doubtful to
which of the two genera a species should be referred. Von
Harold has tried to point out the differences between Oedionychis,
Asphera, and the allied genera (Coleopterol. Hefte, xv. p. 91), and
lays the principal stress on the more or less elongate first jomt of
the posterior tarsi in Asphera in contradistinction to the corre-
sponding very short joint in Oedionychis, which in most. cases
holds good, but in many instances there are intermediate degrees
as well as in the more or less inflated claws, so that it is uncertain
to which genus these species should be referred; these are,
however, rather exceptional, and vy. Harold’s definition must be
accepted for want of a better one. All the species described here
are contained in my collection.
HOMOPH@TA CLAVAREAUT, Sp. 0.
Black, a frontal spot and the clypeus flavous; thorax fulvous,
impunctate ; elytra nearly impunctate, fulvous, a broad transverse
band at the base and another narrower one below the middle,
black.
Length 9 millim,
Head black, very shining, with some punctures near the eyes
the latter widely separated, with a flavous transverse spot at the
intermediate space, frontal elevations narrow, likewise flavous as
well as the clypeus; antenne extending beyond the middle of the
elytra, black, the first joint fulvous below, third and fourth joints
equal; thorax twice as broad as long, the sides feebly rounded,
with narrow thickened margins, the anterior angles strongly pro-
duced and thickened, the surface fulvous, impunctate, rather
convex; scutellum black; elytra with narrow, reflexed margins,
microscopically finely punctured, fulvous, with a rather broad
basal band occupying about one-fourth of the length of the elytra,
its posterior edge oblique, widest at the suture, another narrower
* For explanation of the Plates, see p. 460.
1905. | OF PHYTOPHAGOUS COLEOPTERA, 401
punctate, frontal elevations broad, feebly raised, clypeus broad
and thick; eyes widely separated, not very prominent; antennee
long and slender, black, third and following joints very elongate,
nearly equal; thorax about twice as broad as long, the sides
widened, the lateral margins strongly rounded, the anterior angles
strongly produced and pointed, the surface impunctate, the lateral
sulci broad but shallow, testaceous, the middle of the disc black;
scutellum black; elytra with strongly reflexed lateral margins,
the posterior portion convex and widened, the surface impunctate,
testaceous; posterior femora less thickened than usual, the
metatarsus very elongate; claw-joint scarcely, if at all, swollen ;
prosternum very narrow.
Hab. Bogota.
This Asphera differs in more than one respect from the other
members of the genus: the slender antenne, widened sides of the
thorax, and the but moderately thickened posterior femora are not
found in any other species, to my knowledge, and agree rather
with the genus Aspicela, but the perfectly normal shape of the
mesosternum prevents the insect from being included in that
genus. I know of only a single specimen.
ASPHARA HILARIS, sp. n.
Entirely pale testaceous ; eyes rather large, antenne pale fulvous
or testaceous, thorax with gradually flattened sides, elytra not
perceptibly punctured, metatarsus of the posterior legs elongate,
claws swollen.
Length 7-8 millim.
Head impunctate, testaceous, shining ; the eyes proportionately
closely approached and rather large; antenne extending to the
middle of the elytra, obscure fulvous; thorax with feebly rounded
sides, slightly narrowed anteriorly, the anterior margin concave,
anterior angles thickened but only very slightly produced, the sides
gradually flattened, the disc impunctate; elytra with a very shallow
depression below the base, with broadly reflexed lateral margins,
the surface entirely impunctate, shining; under side coloured as
the upper surface, legs slightly darker; the metatarsus of the
posterior legs nearly as long as the following joints together, claw-
joints distinctly swollen.
Hab. Espirito Santo, Brazil.
An apparently rather common species of unicolorous appearance,
which may be known by the gradually flattened sides of the thorax
and the more than usually thickened claws; the elongate meta-
tarsus shows, however, the species to belong to Asphera. A. pallida
Jac. is a much larger and broader species, with a black head.
ASPHZRA ALBIFRONS, sp. n.
Testaceous, the antenne black (apical three joints sometimes
pale), the breast piceous, the head whitish-testaceous, thorax with
the anterior and posterior margins black at the middle, elytra
finely punctured.
402 MR. MARTIN JACOBY ON NEW SPECIES | Nov. 28,
Length 7 millim.
Head entirely impunctate, very light testaceous; eyes well
separated, moderately large, frontal elevations narrowly transverse ;
antenne slender, black, the apical two joints sometimes pale, the
third and fourth equal; thorax with broadly rounded and flattened
sides, the sulci strongly marked, the dise impunctate, testaceous,
with the anterior and posterior margins black at the middle, the
anterior angles not mucronate but slightly produced; scutellum
more or less fuscous; elytra rather convex, very closely and finely
punctured ; the breast, tibize, and tarsi more or less piceous; the
metatarsus distinctly elongate, the claw-joint strongly swollen.
Hab. Bolivia.
This species may easily be mistaken for one of the varieties of
Oedionychis albipennis Jac., but it is of a more convex shape, the
eyes are much more widely separated, the intermediate space is
very light-coloured and entirely impunctate, and the metatarsus
of the posterior legs is distinctly more elongate.
ASPHHERA TARSATA, Sp. n. (Plate XIV. fig. 10.)
Head, antenne, and thorax, under side and legs black; thorax
with broadly flattened sides, impunctate ; elytra obscure testaceous,
finely and closely punctured; metatarsus of the posterior legs
elongate and slender, claw-joint strongly swollen.
Length 8 millim.
Head .impunctate, black, frontal tubercles very strongly
developed, trigonate, carina convex; antenne black, the lower three
jomts shining, the others pubescent, the intermediate joints
slightly widened, third and fourth joints equal; thorax with strongly
rounded and broadly flattened sides, anterior margins blunt and
slightly produced outwards, more or less testaceous, the rest of the
surface black; scutellum black; elytra convex, widened towards
the middle, with broadly reflexed margins, the base without
depression, closely, finely, but distinctly granulate-punctate ; under
side and legs black.
Hab. Peru.
The more than usual elongate and slender metatarsus and
the strongly swollen claw-joint and system of coloration well
distinguish this species, of which I possess a single specimen.
ASPH.ERA NASALIS, Sp. bh.
Black, the head and the sides of the thorax anteriorly pale
testaceous, the anterior angles mucronate ; elytra testaceous, finely
and closely punctured ; carima of the head very broad.
Length 74 millim.
Head pale testaceous, shining, impunctate; eyes widely separated,
frontal elevations broadly oblique, carina very broad and convex ;
antenne long and slender, black, third and fourth joints very
elongate, equal; thorax more than twice as broad as long, the
sides broadly flattened and rounded, the anterior angles mucro-
1905. ] OF PHYTOPHAGOUS COLEOPTERA, 403
nate, the surface impunctate, more or less black, the anterior
angles broadly testaceous; scutellum black; elytra testaceous,
finely and closely punctured ; under side and legs black ; the meta-
tarsus as long as the following two joints together, claw-joint
strongly inflated.
Hab. Peru.
Very closely allied in coloration to A. tarsata; but the head
pale, the antenne slender, without widened and pubescent joints,
and the metatarsus much shorter. Of this species I possess three
specimens. The species is also closely allied to A. altifrons, but is
much larger, and the anterior angles of the thorax are mucronate,
the under side and legs are black. From both species the broad and
blunt carina will distinguish the present one; it is more pro-
nounced than in any other species I am acquainted with.
ASPH#RA AMABILIS, sp. n.
Black ; thorax short, transverse, impunctate ; elytra testaceous,
extremely finely and closely punctured, the apical margins black.
Var. Elytra unicolorous testaceous.
Length 5 millim.
Of posteriorly slightly widened shape ; the head black, shining,
impunctate, the vertex sometimes marked with a testaceous spot,
deeply transversely grooved between the eyes, the latter large;
palpi testaceous ; antennee black, the third and fourth joints equal ;
thorax short and transverse, the lateral margins rounded, the sides
broadly flattened, this portion well separated from the disc, the
latter impunctate, black, shining, the anterior angles produced
outwards into a small tooth ; scutellum broad, black ; elytra slightly
wider at the base than the thorax, convex, gradually widened
posteriorly and without basal depression, testaceous, extremely
closely and finely punctured, the extreme apical margins black ;
under side and legs black, the metatarsus of the posterior legs as
long as the following two joints together, claw-joint rather
strongly swollen.
Hab. Peru.
The black head and thorax and the proportionately short shape
of the latter well distinguish this species, of which I possess
three specimens, two of which have the apex of the elytra black
to a small extent and the vertex marked by a small testaceous
spot; in the other specimen the spot and the black apex of the
elytra are absent.
Llytra with metallic transverse bands.
ASPH/ERA CARILLOENSIS, Sp. 0.
7 2
Testaceous ; the head, breast, and the legs black; antennz long,
fulvous ; thorax impunctate, anterior angles bluntly produced;
elytra nearly white, impunctate, a transverse band at the base and
another ‘narrower one, slightly oblique, metallic dark blue, both
bands abbreviated at the sides.
404 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
Length 6 millim.
Head impunctate, black ; eyes distant, frontal elevations oblique,
rather broad; clypeus very narrow, strongly thickened, carma
very convex; antenne long and slender, fulvous, third and following
joints slender, equal or nearly so; thorax about twice as broad as
long, the lateral margins feebly rounded, the anterior angles
bluntly produced, the lateral sulei deep and broad, the surface
impunctate, pale flavous; scutellum triangular, black; elytra with
narrow but strongly reflexed lateral margins, yellowish-white,
with two transverse blue bands not extending to the lateral
margins, the first extending to about one-third of the length of
the elytra, with its posterior edge nearly straight, the second band
below the middle, of only half the width and of obliquely down-
ward direction; breastand legs black, abdomen testaceous ; meta-
tarsus elongate, claw-joint very moderately swollen.
Hab. Carillo, Costa Rica.
The black head, fulvous antenne, and the shape of the elytral
bands principally distinguish this Asphera; the elytra have the
basal portion rather distinctly raised, but the intrahumeral
depression is but moderately deep. I have three exactly similar
specimens before me.
From 4. nigrofasciata Jac., likewise from Costa Rica, the
present species may be separated by the fulvous colour of the
antenne, the blue, not black, elytral bands, the much more
narrow, reflexed margins of the elytra, and the rather smaller
general size and more widened shape.
ASPHERA ZONULATA, sp. n. (Plate XIV. fig. 7.)
Black below, antenne and legs more or less piceous, above
flavous ; thorax impunctate, the anterior angles produced ; elytra
very finely punctured, with four metallic green transverse bands,
much widened towards the suture, which is likewise metallic
green.
Length 7 millim.
Of medially widened shape ; the head move or less piceous at the
vertex, the lower portion fulvous ; eyes moderately large, with a
few punctures near their inner margins; clypeus in shape of a
transverse ridge; antenne nearly black, the third joint smaller
than the fourth; thorax with strongly rounded lateral margins,
the anterior angles produced into a small tooth, the sides broadly
and deeply sulcate, the surface impunctate, flavous, obsoletely
transversely grooved near the base; scutellum black; elytra con-
vex, broadly margined, widest at the middle, very finely punctured
throughout, flavous, with four bright green metallic bands, not
extending to the margins—of these, the one at the base is the
widest and has its posterior margin obliquely rounded, it extends
as far as the shoulders, the second band at the middle is connected
with the first along the suture by a rather broad stripe of green,
its ends are greatly narrowed, the third band below the ‘middle is
of similar shape, but the fourth near the apex is of a shorter and
1905. | OF PHYTOPHAGOUS COLEOPTERA. 405
broader form, the suture connects all these lower bands by a
narrow metallic green stripe; metatarsus elongate, claw-joint
strongly swollen.
Hab. Peru.
Different in the number and shape of its elytral bands from
any other species ; two exactly similar specimens are contained in
my collection.
ASPHERA VERNALIS, Sp. n.
Piceous, the lower part of the face and the thorax flavous, sides
of the latter broadly flattened, disc impunctate; elytra flavous or
pale fulvous, with two transverse violaceous bands, one at the
base, the other below the middle, not extending to the sides or
apex.
Length 6-63 millim.
Head with a few punctures near the eyes; the vertex nearly
black, the frontal tubercles and the clypeus flavous; antennz
piceous or black, the lower three joints obscure fulvous ; thorax
slightly narrowed anteriorly, the sides with a rather broad flattened
margin, the anterior angles dentiform, the disc impunctate,
yellowish-white ; scutellum black ; elytra impunctate, flavous, the
basal transverse blue or violaceous band nearly extending to the
middle, the lower band of equal width, not extending to the
apex, both bands are limited laterally by the broadly reflexed
lateral margins, the flavous band which separates the darker ones
at the middle is of about half the width (in a longitudinal
sense) than the blue bands; breast and legs piceous, the base of
the femora rather lighter; abdomen flavous; claw-joint scarcely
thickened.
Hab. Br. Guiana.
This is another species with transverse blue bands of which so
many are known, yet there is none which agrees entirely with the
presentone. 4. wmula Illig. is described as over 44 lines in length,
the thorax as having the sides obsoletely flattened, while in this
species it 1s very distinctly marked ; the colour of the head is given
as testaceous and the median pale band as broad, while in A. vernalis
this band is of only haif the width of that of the dark bands
These remarks also apply to 4. ornata lig. A. ewrialis Kvichs.
has the posterior band much narrower and the pale division
broader; in A. limitata Har. the posterior blue band is still
narrower, and there are other differences besides.
ASPHRA SEPARATA, Sp. 1.
Black; thorax fulvous, impunctate; elytra pale testaceous,
impunctate, a broad transverse band at the base, not extending to
the lateral margins, and another band at the apex, dark violaceous.
Length 6 millim,
Head black, shining, impunctate; eyes large, elongate, frontal
elevations very broad but feebly raised, clypeus with an acute
central ridge ; antenne black, the third and fourth joints equal,
406 MR. MARTIN JACOBY ON NEW SPECIES | Nov. 28,
intermediate joint slightly widened ; thorax with nearly straight
sides, slightly narrowed anteriorly, anterior angles thickened and
produced into a short point, the sides flattened but gradually so,
without deep accompanying groove, the disc impunctate, fulvous
or flavous, anterior margin rather deeply concave; scutellum
black; elytra gradualiy and slightly widened posteriorly, with a
short but rather deep sutural depression below the base, im-
punctate, pale testaceous, with two metallic dark purplish bands,
the first subquadrate at the base, nearly extending to the middle
but not to the lateral margins, its posterior edge straight, the
posterior angles rounded, the second band occupies the entire
apex and has its anterior angles rounded, these bands are separated
by the testaceous ground-colour in shape of a transverse band of
nearly similar size as the dark ones; under side and legs black,
apex of abdomen flavous; claw-joint not strongly thickened.
Hab. Peru.
Principally distinguished by the position and shape of the
posterior band in connection with the flattened sides of the thorax.
ASPHAERA GLABRIPENNIS, Sp. Nn.
Obscure testaceous ; the thorax with gradually flattened sides,
impunctate ; elytra impunctate, with a metallic bright green sub-
quadrate spot at the base and another one near the apex;
posterior femora with the apex black.
Length 7-10 millim.
Of elongate and flattened shape, of a rather dirty testaceous ; the
head finely punctured at the sides as well as the space in front of
the eyes, the frontal elevations broad, clypeus rather strongly
raised; antennz long and slender, obscure testaceous, the terminal
joints very elongate ; thorax with gradually flattened sides, nar-
rowed anteriorly, the anterior margin deeply concave, the sides
nearly straight, anterior angles in shape of a small tooth, the
surface impunctate; scutellum testaceous; elytra entirely im-
punctate, with two brilliant metallic green bands or patches, the
first at the base, not extending to the sutural or lateral margin
and downwards to about one-third the length of the elytra, the
other band of more rounded shape near the apex, not extending to
either margin ; below finely pubescent ; the apex of the posterior
femora black ; claw-joint moderately swollen.
Hab. Marcapata, Peru.
T would have referred this species to 4. chapuisi Har., but the
author gives the colour as rufo-testaceous and the elytra as
finely punctured, but even with a strong lens I cannot discover
any punctuation.
ASPHRA FUNEREA, Sp. N.
Black; thorax whitish or obscure testaceous, the flattened sides
well separated; elytra very minutely punctured, coloured like
the thorax, a broad transverse band at the base and another still
1905. ] OF PHYTOPHAGOUS COLEOPTERA, 407
broader band below the middle and interrupted at the outer
portion, obscure brownish-zneous.
Length 6—7 millim.
Head sparingly punctured at the vertex, the latter piceous or
blackish ; eyes very large, each as broad as the dividing space ;
antennee long and slender, black, the lower joints sometimes
testaceous at the base, very elongate with the exception of the
second one; thorax with flattened and well-separated sides, the
anterior margin but little concave, the angles produced outwards
into a truncate tooth, the surface impunctate, pale testaceous ;
seutellum broad, black ; elytra with distinct basal depression, very
finely punctured, with narrow reflexed lateral margins, pale
testaceous or whitish, with two broad dark brown bands with
greenish gloss, the first at the base, not extending to the lateral
margins, the other band of much longer shape, not extending to
the sides or apex of the elytra, at its outer edge it is semidivided
by a narrow stripe of the ground-colour; under side piceous or
black; metatarsus as long as the following two joints together,
claw-joint distinctly swollen.
Hab. Peru.
There are two specimens of this species before me, which is well
distinguished by the produced, truncate, anterior thoracic angles
and the markings of the elytra; the ground-colour of the latter is
in one specimen of a pinkish-white tint, in the other obscure
testaceous, the dark bands are divided at the middle by the
narrow transverse stripe of the ground-colour.
ASPHHRA BREVICOLLIS, sp. n.
Piceous, legs black, the head and antennze fulvous; thorax
scarcely twice as broad as long, flavous, impunctate; elytra
impunctate, flavous, a broad transverse band at the base and
a transverse spot below the middle metallic green.
Length 7 millim.
Head impunctate, fulvous; frontal elevations broad, divided by
a deep groove and bounded behind by a narrow, more shallow
suleus; clypeus strongly raised in shape of a broad triangular
ridge ; eyes widely separated ; antenne extending to the middle of
the elytra, dark fulvous, the third joint shorter than the fourth ;
thorax scarcely twice as broad as long, the sides obliquely narrowed
anteriorly, the lateral sulci rather narrow, the anterior angles
thickened and strongly produced, the surface impunctate, flavous ;
seutellum black; elytra slightly widened towards the middle,
distinctly depressed below the base, flavous, with two bright
metallic-green transverse bands, the first at the base extending
downwards to about one-third the length of the elytra, the other
in shape of a large slightly oblique spot, below the middle, neither
of the bands extending to the lateral margins ; breast and abdomen
piceous, legs black; metatarsus elongate, claw-joint but slightly
swollen.
Hab. Peru.
Proc. Zoou. Soc.—1905, Vou. 11. No XXVIII. 28
408 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
The comparatively small width of the thorax and the widely
separated elytral green bands, in connection with the fulvous head
and antenne, distinguish this species, which is evidently closely
allied to A. oblecta Baly; but the head has no punctures nor
hairs, the thorax is certainly not ‘more than twice as broad
as long,” and the elytra are not furnished with hairs at the apical
margins.
ASPHERA DIMIDIATICORNIS, Sp. 0.
Flavous, head piceous, the intermediate joints of the antenne
black; thorax flavous, impunctate; elytra not perceptibly punc-
tured, pale flavous, a transverse band at the base and a broader
one below the middle metallic green; legs fulvous.
Length 6 millim.
Head impunctate, the vertex piceous; frontal elevations strongly
raised, pyriform; clypeus flavous, semicircular, with an acute
central ridge; eyes very large, the diameter of each larger than
the dividing space; antenne long and slender, the lower and the
apical three joints fulvous, the rest black, third and fourth joints
very elongate, equal, apical joints shorter ; thorax twice as broad
as long, slightly narrowed anteriorly, the anterior angles pointed
but not produced, lateral margins evenly rounded, preceded by a
broad suleation, the surface impunctate, flavous; scutellum fulvous;
elytra widened at the middle, yellowish-white, with two broad
transverse metallic-green bands, not extending to the lateral
margins, the first extending from the base to nearly the middle,
the second immediately below the latter and abbreviated at some
distance from the apex, both bands are of nearly subquadrate
shape; the breast and the legs pale fulvous, abdomen flavous, the
tarsi obscure piceous; the metatarsus moderately elongate, claw-
joint strongly swollen.
Hab. Yeuador.
Distinguished by the colour of the head and the antenne, the
large eyes and broad elytral bands, pale legs, &e.
ASPHERA DEJEANI, Sp. Nn.
Black; thorax impunctate, testaceous, the entire disc black ;
elytra impunctate, testaceous, a broad band at the base and
another below the middle, not extending to the lateral margins,
metallic blue; claw-joint scarcely swollen.
Length 8 millim.
Head with some punctures near the eyes, black, frontal elevations
strongly raised, narrow and transverse; antenne extending beyond
the middle of the elytra, black, all the joints elongate and slender,
the third and fourth equal; thorax twice as broad as long, the
lateral margins scarcely rounded, the anterior angles more than
usually produced and pointed (in one specimen tc a much smaller
extent), anterior margin concave, the sides broadly but not deeply
sulcate, testaceous as well as the extreme base, the rest of the
surface occupied by a transverse black band; scutellum black ;
1905. ] OF PHYTOPHAGOUS COLEOPTERA. 409
elytra with the basal portion rather convex, impunctate, metallic
blue, the lateral margins and a rather narrow transverse band at
the middle testaceous, epipleure of the latter colour; below and
the legs black; metatarsus rather elongate, claw-joint scarcely
swollen.
Hab. Peru.
The black band of the thorax and the strongly dentate and pro-
duced anterior angles of the latter, together with the nearly simple
claw-joint, principally characterise this species.
Lilytra metallic, with flavous margins.
ASPHHRA ALBICINCTA, sp.n. (Plate XIV. fig. 4.)
Black, thorax pale flavous, impunctate; elytra metallic blue, the
disc foveolate and rugose, the lateral margins yellowish-white ;
abdomen flavous.
Length 9-10 millim.
Of ovately-elongate shape, rounded below the middle; the head
black, with some few punctures near the eyes, longitudinally
grooved between the latter; antennz extending to the middle of
the elytra, black, the third, fourth, and fifth joints equal, the
following ones shorter; thorax with gradually flattened sides,
the anterior margin deeply concave, anterior angles slightly
produced into a small tooth, thickened, the disc entirely im-
punctate, pale yellowish ; scutellum black; elytra bright metallic
blue or purplish, variolose-punctate, the interstices strongly
wrinkled or rugose, the lateral margins to the apex whitish ;
breast and legs black; metatarsus elongate, claw-joint slightly
swollen; abdomen flavous.
Hab. Peru.
Of the same coloration as Asphera (Aspicela) albomarginata
Latr., and of nearly similar sculpturing, but a true Asphera (like
the last-named species) on account of the metasternum not being
truncate anteriorly ; in Latreille’s insect the thorax is margined
with black and the elytral fovez are larger and less numerous.
Hlytra variously coloured, with transverse pale bands or
with spots.
ASPH HRA BISBIPLAGIATA, Sp. Nn.
Obscure fulvous orfuscous, the head and the antennz black ;
thorax yellowish white; elytra impunctate, each with two white
bands, one transversely shaped at the middle, the other more
rounded near the apex.
Length 7 millim.
Head with some deep punctures near the eyes, the vertex
nearly black, the frontal elevations bounded behind by a very deep
transverse groove; base of the antenne flavous, the basal two
joints piceous, the others black ; thorax with the anterior margin
straight, the sides not flattened, but the lateral margins gradually
28*
410 MR, MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
and very strongly thickened at the anterior angles, the latter
produced but not dentiform, the surface impunctate, nearly
white ; scutellum dark brown; elytra of the same colour or dark
fuscous, shining, impunctate, each with two white markings, the
first at the middle in shape of a transverse band not quite extend-
ing to either margin, the second of rounded shape, near the apex ;
the breast piceous ; the legs dark fulvous; the abdomen testaceous
or flavous; claw-joint rather strongly swollen ; prosternum very
narrow and parallel.
Hab. Colombia.
In some specimens the ground-colour of the elytra is much
paler. The absence of a thoracic flattening of the sides and
the position and colour of the elytral markings distinguish this
species.
ASPHERA BIPLAGIATA, Sp. 0.
Black, thorax and the femora flavous ; elytra nearly impunctate,
the iateral margins, a large discoidal patch, and the apex flavous ;
apex of the posterior femora black.
Length 5-6 millim.
Head black, with one or two punctures near the eyes ; antennee
black, the lower two joints flavous below, third and following
joints nearly equal; thorax nearly twice as broad as long, the
sides rounded anteriorly, with a broad flattened sulcus, the anterior
angles thickened but not produced, the surface impunctate, flavous ;
scutellum black; elytra impunctate ; under side, the apex of the
posterior femora, and the tibize and tarsi black, rest of the femora
flavous.
Hab. Brazil.
This Asphera vesembles almost exactly A. episcopalis Ml. in the
elytral pattern, which consists of a transverse black band at the
base and another near the apex connected by a very narrow
sutural stripe, the disc in shape of a large oval patch and the apex
as well as the lateral margins being flavous. The differences
which separate this species are: the entirely black head, without the
whitish frontal tubercles; the anterior angles of the thorax, which
are not produced ; the position of the posterior elytral band, which
is placed much lower down than in the above-named species; and
the colour of the legs. I have received several specimens from the
La Plata Museum without a special locality.
ASPH&RA ERICHSONI, Sp. 0.
Black; thorax testaceous, the sides straight, the surface
impunctate; elytra nearly black, the lateral margins and an
extremely narrow transverse straight band at the middle flavous.
Length 6 millim. :
Head with a few punctures above the eyes, black, the frontal
elevations very broad and flat, scarcely raised, the base of the
antenne flavous; the antenne very long and slender, black,
the fourth joint longer than the third ; thorax only about one-
1905. | OF PHYTOPHAGOUS COLEOPTERA. 411
half broader than long, slightly narrowed anteriorly, the sides
nearly straight, with an extremely narrow thickened margin, only
obsoletely flattened in front of it, the anterior angles slightly
mucronate, the surface entirely impunctate, pale flavous or
testaceous ; scutellum black; elytra not perceptibly punctured,
black, very shining, nearly parallel, the lateral margins narrowly
and an equally narrow transverse band at the middle, flavous;
under side and legs black; the metatarsus elongate, the claw-joint
but slightly swollen.
Hab. Peru.
The comparatively long thorax, the nearly straight and but
slightly flattened sides, in connection with the very narrow and
straight elytral pale band at the middle, well distinguish this
species from others similarly marked.
ASPHARA MACULICOLLIS, sp. n.
Black, the antenne obscure fulvous; thorax pale testaceous
with a transverse piceous band, the sides straight; elytra entirely
impunctate, metallic green, the lateral margins and a transverse
narrow band at the middle flavous ; claw-joint distinctly swollen.
Length 5 millim.
Smaller than the preceding species; the elytra more widened at
the middle, with a broader lateral reflexed margin; the head with
a single puncture close to the eyes, black at the vertex, the lower
portion stained with flavous, the frontal elevations cond tri1-
gonate, divided by a deep narrow groove; clypeus strongly
raised ; antenne dark fulvous, the third and fourth joints very
elongate, the following joints shorter; thorax with nearly straight
lateral margins, the sides flattened, the anterior angles mucronate;
the disc impunctate, whitish, with a narrow transverse piceous
band; scutellum black; elytra with broad flattened lateral
margins, impunctate, metallic green, the flattened sides and a
transverse narrow band at the middle pale yellowish; below
and the legs black; metatarsus elongate; claw-joint distinctly
thickened.
Hab. Peru, Marcapata.
Separated by the sculpture and colouring of the head and that
of the antenne, the thoracic transverse band, and colour of the
elytra. The general size is smaller than that of the allied species.
A. nobilitata Fab. is of different coloration, although the elytral
pattern is similarand the claw-joint is scarcely swollen. A. disco-
fasciata Baly is another closely allied species, but has differently
coloured antenne, rounded sides of the thorax, finely punctured
elytra, and their transverse band broad, not narrow.
ASPHERA APICALIS, sp. 1.
Black or piceous, the basal joints of the antenne and the
clypeus flavous; thorax impunctate, fulvous or flavous; elytra
greenish-zneous or purplish, impunctate, the lateral margins,
a transverse band at the middle, a spot near the scutellum,
412 MR. MARTIN JACOBY ON NEW SPECIES [N ov. 28,
another one below the middle, and a short oblique stripe near the
apex flavous.
Var. a. The elytral transverse band and the spots absent.
Var. 6, Hlytra as in the type, but the spots absent.
Var. c. The transverse band indicated by a sutural and lateral
spot; the other spots wanting.
Var, d. Like var. c, but the apical stripe as well as the spots
wanting.
Length 7 millim.
Head entirely impunctate, with the exception of one or two
punctures near the eyes, the frontal elevations broadly transverse;
clypeus flavous, with an acutely raised central ridge; antenne
dark fulvous, extending slightly below the middle of the elytra,
the third and fourth joints equal; thorax strongly transverse, the
lateral margins rounded, the anterior angles thickened but not
dentiform, the sides with a longitudinal groove, flattened, the
surface impunctate, fulvous or flavous, posterior margin nearly
straight ; scutellum black; elytra impunctate, but the paler
markings with minute fuscous spots, the ground-colour metallic
greenish cupreous, the lateral margins, elytral epipleure, a narrow
transverse band at the middle, a small spot near the scutellum,
another below the middle near the suture, and a short oblique
streak near the apex at the sides flavous; underside piceous ; the
anterior legs more or less pale, the metatarsus of the posterior
legs as long as the following two joints; claws rather strongly
swollen.
Hab. Peru, Prov. Huallaga; also Bolivia.
The type of this species, from which I have drawn the above
description, is not difficult to distinguish from others, on account
of the elytral markings, and is principally separated by the sub-
apical short flavous streak which is connected with the similarly
coloured lateral stripe. Some of the varieties, however, are
without this mark, and consequently resemble several other
similarly coloured species; there is, however, nearly always the
indication of the transverse band in shape of a small flavous
sutural spot at the middle and a corresponding one opposite at
the margins; the thorax has the sides well defined by a deep
longitudinal groove, and the claw-joint is more strongly swollen
than in many other species of the genus.
Of var. d two specimens are before me. In these the elytral
spots and band ave absent, but, as usual, the sutural remnant of
the band is present, and instead of the subapical short streak
there is a widening of the flavous lateral margin at the cor-
responding place, thus indicating the typical mark. Oedionychis
dipus Ill. is of exactly similar coloration, but is a true Oedionychis
with a short posterior metatarsus.
ASPHHRA ELEGANTULA, sp.n. (Plate XIV. fig. 6.)
Black; clypeus and the thorax flavous, the latter impunctate ;
elytra bright metallic blue, impunctate; a narvow transverse band
1905. | OF PHYTOPHAGOUS COLEOPTERA. 413
at the middle and another near the apex, as well as the lateral
margins, flavous.
Length 8-9 millim.
Head black, shining, with a few deep punctures near the eyes ;
the latter large, widely separated ; clypeus acutely triangularly
raised, flavous; labrum black, with a row of punctures ; antenne
long and slender, black ; thorax short and strongly transverse, the
sides feebly rounded anteriorly, straight at the base, the anterior
angles thickened and produced, the sides broadly flattened, with a
thickened margin, the flat portion well defined from the convex
surface, the latter impunctate, obsoletely transversely depressed or
grooved near the base; scutellum broad, black; elytra with a
distinct depression below the base, not perceptibly punctured,
bright metallic blue ; the lateral margins, the epipleur, and two
narrow transverse bands flavous—of these the first is placed at the
middle and extends quite to the suture, the second one is situated
very near the apex, not quite extending to the suture and
of slightly upward direction; metatarsus elongate, claw-joint
moderately thickened ; the anterior femora more or less stained
with flavous at the extreme base.
Hab. Peru, Prov. Huallaga (G. A. Baer).
Of this handsome species I have received several Specimens from
M. Clavareau, of Brussels. I know no other species with similar
shaped and same number of bands.
Llytra blue.
ASPHARA TIBIALIS, Sp. N.
Pale flavous, the head, antenne, tibize, and tarsi black ; thorax
impunctate ; elytra metallic blue, impunctate.
Length 7 millim.
Head entirely impunctate, black; clypeus acutely raised, tri-
angular, slightly stained with flavous, palpi robust; antenne
extending below the middle of the elytra, black, third joint
slightly shorter than the fourth; ; thorax with the sides gradually
flattened, with narrow thickened margins, the anterior angles
thickened but not dentiform and scarcely produced, the disc
impunctate, flavous ; scutellum black; elytra with a shallow trans-
verse depression below the base, entirely impunctate, dark metallic
blue, below flavous; the tibie and tarsi black, extreme base of the
posterior tibiz flavous; claw-joint moderately thickened.
Hab. Amazons,
Of this species, distinguished by its system of coloration, five
specimens are contained in my collection.
Elytra with longitudinal fulvous bands.
ASPHHRA FERRUGINEO-VITTATA, Sp. nh.
Elongate, subparallel, testaceous ; thorax with strongly rounded
and broadly flattened sides, impunctate; elytra with a narrow
414 MR. MARTIN JACOBY ON NEW SPECIES | Noy. 28,
sutural and an equally narrow discoidal longitudinal band,
ferrugineous.
Length 6 millim.
Head impunctate or with a few fine punctures ; eyes large, the
diameter of each as wide as the intermediate space, frontal
elevations subquadrate, carina short and blunt; antenne scarcely
extending to the middle of the elytra, pale fulvous, basal joint
robust and elongate, third joint slightly shorter than fourth,
terminal joints shorter than the intermediate ones ; thorax short,
the sides broadly suleate, anterior angles with a short tooth, the
dise impunctate, with an obsolete transverse sulcus near the base ;
elytra nearly parallel, somewhat flattened, finely and closely
punctured, testaceous, the suture very narrowly ferrugineous ;
a similar, slightly and inwardly curved band extends from the
shoulders to near the apex; metatarsus as long as the following
two joints together, claw-joint strongly swollen; prosternum
linear.
Hab. Bolivia.
The elytral dark bands are very narrow and of equal width
and the discoidal one is of slightly curved shape. ‘The species, on
account of the distinctly elongate metatarsus of the posterior
legs, cannot be mistaken for a similarly coloured species of
Ocdionychis.
Elyira otherwise marked.
ASPH#RA LACERATA, Sp. N.
Elongate and parallel, black ; thorax dark fulvous, impunctate,
the anterior angles produced and blunt; elytra finely rugose
anteriorly, impunctate, black, a round patch at the base, a small
one at the shoulders, a transverse subdivided patch at the middle,
and another at the apex, testaceous.
Length 9 millim.
Head black, impunctate, the frontal elevations broad and flat ;
clypeus in shape of a strongly raised triangular ridge; eyes widely
separated; antenne black, long, the third and following joints
equal; thorax transversely subquadrate, convex, of equal width,
the lateral margins nearly straight, accompanied by very deep and
narrow sulci, the anterior angles blunt and produced forwards,
the dise impuncate, dark fulvous; scutellum black; elytra with
narrow but deeply reflexed lateral margins, furnished with fine
rugosities anteriorly but without punctuation, each elytron with
four testaceous or pale flavous patches, which are separated by
narrow transverse black bands before and below the middle, at
the latter place the band sends off a spur towards the suture,
thereby subdividing the preceding flavous portion ; all the margins
of the elytra as well as a humeral stripe and the epipleure are
likewise black; of the same colour are the under side and the legs.
Hab. Peru.
IT have only a single specimen of this somewhat peculiar species
before me; whether the fine elytral rugosities to be seen at the
1905. ] OF PHYTOPHAGOUS COLEOPTERA. 415
anterior portion of the elytra are normal or accidental, I am
unable to say. The design of the elytra resembles that of Homo-
phota 8-guttata Fab., but in that insect the vertex of the head has
the characteristic white or flavous patch and the clypeus is of
similar coloration ; the elytra are smooth, and the intermediate
flavous patch is never subdivided; in the Peru species the meta-
tarsus is moderately elongate and the claw-joint rather strongly
swollen.
ASPHERA NITIDISSIMA, sp. n. (Plate XIV. fig. 5.)
Broadly ovate, black; clypeus fulvous; thorax strongly trans-
verse, fulvous, anterior angles toothed; elytra strongly convex,
minutely punctured, bright “metallic green, the lateral and apical
Inargins and a narrow transverse band at the middle flavous or
fulvous.
Length 10 millim.
Head impunctate, blackish; frontal elevations transverse,
bounded by a deep groove behind; clypeus fulvous, acutely cari-
nate at the middle; diameter of each eye of less width than the
dividing space; antennz long and slender, extending below the
middle of the elytra, black, the third joint shorter than the fourth;
thorax more than twice as broad as long, the lateral margins
strongly rounded, deeply and broadly sulcate, the anterior angles
strongly produced into a blunt tooth, the disc impunctate, fulvous,
sometimes marked with two small fulvous spots ; scutellum black ;
elytra broad, convex and widened posteriorly, deeply suleate
within the shoulders and with another shallow depression below
the base, very minutely punctured, very bright metallic green, this
colour divided at the middle by a narrow transverse fulvous band
which joins the similarly coloured lateral margins; under side and
legs black; the metatarsus of the posterior legs as long as the
following two joints together; claw-joint strongly swollen.
Hab. Pachitea, Peru.
Larger and more broadly ovate than the other similarly coloured
species of the genus; the antenne slender and proportionately
long; the thorax strongly toothed; the metatarsus somewhat
intermediate between that of Ocdiong ychis and the present genus
as a rule, but as long as the following two joints together.
ASPHARA VIRIDICOLLIS, sp. nN.
Black; thorax bright green, impunctate, the sides gradually
flattened; elytra black or eneous, deeply foveolate, the lateral
and apical margins green.
Length 7 millim.
Of medially slightly widened shape ; the head black, impunctate,
frontal elevations broad and convex ; clypeus triangularly widened,
not ridge-shaped; antenne black, the third and fourth joints
equal; thorax not more than twice as broad as long, rather
widened at the sides, the lateral margins feebly rounded, anterior
margin concave, its angles moderately produced, not toothed, the
A16 MR. MARTIN JACOBY ON NEW SPECIES | Nov. 28,
disc impunctate, gradually flattened at the sides, bright green,
shining; scutellum black, trigonate; elytra broadly margined,
with elongate deep fovez, placed in about six longitudinal rows,
the interstices strongly reticulate and confluent, the lateral
margins rather broadly green,. furnished with single hairs near
the apex, rest of the surface shining black or bronze; under side
and legs black; metatarsus elongate; claw-joint but slightly
swollen.
Hab. Yeuador.
At once distinguished from A. inequalis Krichs. by the green
thorax and sides of the elytra and by the entirely black breast and
abdomen. I know of no similarly coloured species.
ASPHHRA TESSELLATA, sp. n. (Plate XIV. fig. 8.)
Black, head spotted with flavous ; thorax impunctate, flavous,
with a transverse black band; elytra extremely minutely pune-
tured, flavous, two elongate spots at the base, a narrow transverse
band below the middle, and a spot near the apex black.
Length 8 millim.
Head impunctate, black, the eyes surrounded by a flavous
band, frontal elevations narrow, strongly raised, lower portion of
face pale fulvous, labrum piceous; antenne black, rather short,
the basal joint fulvous below, third and fourth joints equal;
thorax twice as broad as long, slightly arched, the sides flattened,
with a narrow thickened margin which gradually widens an-
teriorly, the angles strongly thickened and produced, the disc
impunctate, flavous, with a transverse black band, the anterior
edge of which is concave and irregular in outline; scutellum
black; elytra extremely minutely and closely punctured, flavous,
the base with two elongate black spots, a short transverse black
band placed much below the middle and another triangular spot
near the apex complete the design of each elytron; under side
and legs black; metatarsus of the posterior legs as long as the
following two joints together, claw-joint strongly swollen.
Hab. Brazil.
I know only a single specimen of this well-marked and distinct
species, without precise locality.
ASPHZRA VARIEGATA, Sp. 0.
Black; the clypeus, thorax, and abdomen flavous; elytra
metallic green or obscure purplish, impunctate; a round spot.
near the scutellum, a transverse band near the apex, and the
lateral margins flavous.
Var. a. Elytra with a narrow transverse band at the middle
and another one near the apex, as well as the lateral margins,
flavous, the basal spot absent.
Var. 6. Elytra with a single band near the apex and the
margins flavous.
Length 7-72 millim.
Head impunctate, the vertex black, the clypeus flavous, frontal
1905. | OF PHYLOPHAGOUS COLEOPTERA. ALT
elevations rather broad and flat, transverse ; clypeus in shape of
an acutely raised triangular ridge; antenne rather long and
slender, black, the third and fourth joints equal; thorax about
twice and a half broader than long, flavous, the lateral margins
straight at the base, feebly rounded anteriorly, narrowly thickened,
the anterior angles produced forwards and strongly thickened,
the sides deeply sulcate, the dise impunctate, obsoletely trans-
versely sulcate near the base; scutellum black; elytra with the
basal portion rather strongly raised, impunctate, flavous, marked
with bands of metallic green or purplish in various ways; the
breast and legs black, the base of the femora more or iess and
the abdomen flavous.
Hab. Peru.
This is evidently a most variable species as regards coloration,
but I have little doubt that ail the forms represent but one
species, as not the slightest structural difference seems to be
present. In one form the elytra (if the testaceous colour.is taken
for that of the ground, which is justified by the similarly coloured
epipleure) have the anterior two-thirds occupied by a metallic
band, including a flavous spot near the scutellum and another
narrow transver se band near the apex extending upwards along
the suture, the lateral and apical margins remaining flavous ; in
var. @ the metallic colour is interrupted by a narrow transverse
band at the middle and another below the latter near the apex ;
in var. 6 there 1s only a single rather broad band near the apex
and connected with the flavous lateral margins; the abdomen in
all these forms remains flavous; the metatarsus of the posterior
legs is as long as the following two joints together, and the
claw-joint is strongly swollen.
A. variegata resembles a great deal A. apicalis, but is always
larger, and the apical elytral flavous band is not placed so near
the apex as in the last-named species, and the antennz are black
and the abdomen flavous.
ASPHERA BASIMACULATA, sp. 1.
Oblong, nearly parallel, testaceous, the intermediate joints of
the antenne piceous; eyes rather closely approached ; sides of
thorax nearly straight, impunctate; elytra impunctate, each with
two elongate short stripes at the base and a small spot (sometimes
absent) near the apex.
Length 4 millim.
Head impunctate, frontal elevations subquadrate, eyes large
and rather closely approached; antennz slender, extending to
the middle of the elytra, the lower four and the apical three
joints testaceous, the others black or piceous, basal joint thickened
and elongate, third and fourth equal, terminal joints shorter ;
thorax scarcely twice as broad as -long, gradually narrowed
anteriorly, the lateral margins straight, anterior angles pointed
in shape of a small tooth, the sides strongly flattened, the disc
impunctate, basal margin somewhat thickened and accompanied
418 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
by a more or less distinct sulcus; scutellum broad, testaceous ;
elytra nearly parallel, minutely punctured, testaceous, each elytron
with two short black stripes, one placed on the shoulders, tlie
other near the scutellum, occupying about a fifth of the length of
the elytra, near the apex at the sides is another small piceous or
black spot which is sometimes obsolete or wanting; metatarsus
of the posterior legs rather elongate.
Hab. Peru: Prov. Huallaga, Rio Mixiollo (Baer).
ASPH#ERA DIVISA, sp. n. (Plate XIV. fig. 9.)
Fulvous, the antenne, the breast, and the abdomen black ; head,
thorax, and elytra impunctate, the last fulvous, their apical half
metallic purplish-violaceous.
Length 8 millim.
Head with a single deep puncture and a few finer punctures
near the eyes, fulvous : frontal elevations very broad and wide;
clypeus acutely 1 raised ; labrum black; elytra long and slender,
black, the basal joint ‘Briones thorax narrowed anteriorly, the
sides gradually flattened, the anterior angles produced into a short
tooth, the disc entirely impunctate, fulvous; elytra widened
towards the middle, with broad reflexed margins, the anterior
half fulvous, the other portion metallic violaceous or purplish, the
anterior edge of this colour rounded at the sides, also extending to
the epipleure; breast, abdomen, the anterior and intermediate
tibie and tarsi and the posterior legs black, the femora of the
anterior and intermediate legs fulvous; claw-joint but slightly
swollen.
Hab, Marcapata, Peru.
The purplish colour of the posterior portion of the elytra some-
times extends rather higher upwards than the middle; I know of
no other similarly marked species of Asphera.
ASPHERA FUSCOFASCIATA, Sp. Nn.
Head, the antenne, the underside, and legs obscure piceous;
thorax yellowish white, with five obsolete fuscous spots ; elytra im-
punctate, pale yellowish, with four transverse fuscous bands, the
first divided into two spots.
Length 8-9 millim.
Head impunctate, piceous, the clypeus flavous; antenne with
the lower seven joints piceous or dark fulvous (the others wanting),
the third joint slightly shorter than the fourth ; thorax without a
distinct flattening of the sides, but with the lateral margins
thickened as well as the anterior angles which are produced
forward, the surface impunctate, nearly white, the disc with five
obsolete, more or less confluent fuscous spots, of which the three
at the middle are better defined and placed triangularly ; scutellum
fuscous ; elytra entirely impunctate, of yellowish-white ground-
colour, with four transverse fuscous bands, one at the base and
separated into two spots, the second near the middle, the third
below the latter, and the fourth at the apex, all these bands are
1905. | OF PHYTOPHAGOUS COLEOPTERA. 419
surrounded and separated by very narrow spaces or bands of the
ground-colour ; under side and legs pale piceous; claw-joint
moderately swollen.
Hab. Bolivia; also Brazil.
Of this species I have seen a great many specimens of most
variable coloration, some of which have the elytral bands very
dark in regard to the basal and subapical ones, and the inter-
mediate bands pale or absent altogether and entire or divided into
two spots as described here. Jt is possible that the species is
identical with 4. albida Schauf.
Genus OEDIONYCHIS.
Elytra entirely pale-coloured or nearly so.
OEDIONYCHIS ROTUNDICOLLIS, Sp. n.
Broadly ovate, subdepressed, pale testaceous ; antenne and the
posterior femora obscure piceous ; sides of thorax strongly rounded,
broadly flattened, impunctate ; elytra extremely minutely
punctured.
Length 8 millim.
Head impunctate, frontal elevations transverse ; antenne pale
piceous, the third joint slightly shorter than the fourth and
following joints; thorax about twice and a half broader than
long, the sides strongly rounded and broadly flattened, the
anterior angles strongly pointed but scarcely dentiform, the
surface impunctate; elytra broadly ovate, the margins narrowly
reflexed, the base with a very shallow depression, the surface
scarcely perceptibly punctured ; posterior femora pale piceous.
Hab. Espirito Santo, Brazil.
The sides of the thorax in this species are more rounded than
in any of the unicolorous members of the genus with which I am
acquainted ; the elytra are likewise of more broadly rounded shape
than usual.
OEDIONYCHIS PARAGUAYENSIS, Sp. .
Short and convex, testaceous; apical joints of the antennz
black ; thorax densely and strongly punctured, the sides not
deeply flattened ; elytra punctured like the thorax.
Length 7 millim.
Head somewhat closely punctured, frontal elevations oblique,
carina short and broad ; antenne scarcely extending to the middle
of the elytra, the lower three joints testaceous, the others black,
third and following joints nearly equal, rather elongate; thorax
twice as broad as long, the lateral margins feebly but evenly
rounded, the anterior angles produced outwards into a small
tooth, the surface rugosely and rather strongly punctured, the
sides gradually and rather shallowly flattened ; scutellum black ;
elytra rather strongly convex below the middle, sculptured like
the thorax ; legs short and robust. ,
420 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
Hab. Pavaguay.
Of this species, very well distinguished by the almost rugose
entire upper surface, I know of only a single specimen.
OEDIONYCHIS NIGROSUTURALIS, Sp. 1.
Black ; thorax finely and sparingly punctured, testaceous ;
elytra strongly convex, closely and strongly punctured, testaceous,
the extreme sutural margins black; abdomen fulvous.
Length 9 millim.
Head entirely black, with a few punctures near the eyes;
clypeus strongly convex between the antenne, the latter short,
not extending to the middle of the elytra, black, the lower two
joints obscurely stained with piceous, third joint distinctly shorter
than the fourth; thorax rather more than twice as broad as long,
the lateral margins strongly rounded, anterior angles not produced
but thickened, sides deeply but narrowly sulcate, the disc very
sparingly and finely punctured, testaceous; scutellum black ;
elytra rather strongly convex below the middle (when viewed
sideways), with very narrow, thickened, reflexed margins, very
closely and comparatively strongly punctured, the suture very
narrowly black; breast and legs black ; abdomen fulvous.
Hab. Braaal.
T know of only a single, apparently female specimen of this
species, which is distinguished by the strongly punctured, convex
elytra and black suture, as well as by the colour of the head and
under side.
OEDIONYCHIS PICIFRONS, sp. n. (Clark Catal.).
Testaceous, the vertex of the head and the antenne pale
piceous ; thorax impunctate; elytra very finely and closely
punctured ; posterior femora pale fulvous.
Length 6} millim.
Of somewhat flattened, oblong shape, the head impunctate, the
vertex very pale piceous, frontal elevations strongly raised,
trigonate ; clypeus triangularly carinate; eyes large, widely
separated ; antenne extending to the middle of the elytra, pale
piceous, third and fourth joints equal; thorax with the sides
rather strongly rounded and broadly flattened, the anterior
angles thickened but only slightly produced, the surface im-
punctate ; scutellum pale piceous ; elytra slightly widened
towards the middle, narrowly margined, extremely finely and
rather closely punctured, the shoulders very prominent and deeply
longitudinally suleate within, the depressions more strongly
punctured, pale testaceous ; under side and legs coloured like the
upper surface, the posterior femora pale fulvous or piceous.
Hab. Brazil.
Of more oblong shape, less broadly rounded than most of the
unicolorous species, very pale testaceous, with the exception of the
head, antennz, and the posterior femora; the sides of the thorax
rather strongly rounded, the shoulders very prominent.
ail 905. ] OF PHYTOPHAGOUS COLEGPTERA. 421
OEDIONYCHIS MILLEPORA, Sp. 0.
Under side and legs dark brown ; the head black at the vertex,
testaceous lower down ; antennze (the basal joints excepted) black ;
thorax testaceous, impunctate ; scutellum black; elytra testaceous,
closely and finely punctured.
Length 4-43 millim.
Head rather strongly punctured at the sides of the vertex, the
latter bluish-black ; clypeus testaceous, strongly carinate at the
middle, the anterior portion forming a transverse ridge; antennze
black, the lower three joints more or less stained with flavous,
third and fourth joints equal, terminal joints rather short and
stout; thorax short and transverse, nearly similar to that of
O. obscuripennis Jac., with a narrow transverse sulcus each side
of the basal margin, the disc impunctate; scutellum black; elytra
of the same shape and punctuation as in 0. obscuripennis : ; pro-
sternum very narrow and elongate, also carinate, fulvous ; under
side and legs piceous.
Hab. Colombia ; also Mexico.
The testaceous colour of the anterior portion of the head, the
distinctly punctured vertex, and the colour of the antenne and
under side separate this species from the preceding one, and the
partly testaceous head from O. obscuripennis.
OEDIONYCHIS DISTINCTA, Sp. n.
Convex, widened posteriorly, testaceous; terminal joints of
antenne black ; thorax with strongly rounded and deeply suleate
sides, impunctate ; elytra deeply, closely and strongly punctured,
more finely and closely so towards the apex.
Length 8 millim.
Head with a few deep punctures at the vertex, deeply and
broadly suleate between the eyes, the latter widely separated,
frontal tubercles rather obsolete ; carina broad anteriorly ; clypeus
perpendicularly deflexed, bounded by an acute ridge above ;
antenn robust, black, the lower four joints eS OEES, third
joint shorter than the fourth, the following joints also less
elongate than the fourth one; thorax not more than twice as
broad as long, rather wider at the sides (longitudinally), the latter
strongly rounded, with broadly flattened sulci, the anterior angles
slightly mucronate, the anterior margin deeply concave at the
middle, the disc impunetate ; 5 elytra. strongly widened at the
middle and convex, the reflexed margins not very broad, the
surface deeply and closely punctured aniesion ly, intermixed ‘with
some smaller punctures, the posterior portion extremely closely
and more finely punctured ; metatarsus of hind legs very short
claw-joint very strongly inflated.
Hab. Colombia.
More strongly punctured and convex than most of the allied
species, the thorax of characteristic shape, and the antenne with
pale basal joints.
422 MR. MARTIN JACOBY ON NEW SPECIES | Noy. 28,
OEDIONYCHIS APICICORNIS, Sp. Nh.
Elongate, nearly parallel, testaceous ; antennz black, the basal
joint testaceous, the apical one fulvous; thorax impunctate, the
sides rounded, the anterior angles scarcely mucronate; elytra
extremely minutely punctured.
Length 5 millim.
Head impunctate, the eyes very large, frontal elevations broad,
not strongly raised; clypeus deeply deflexed, not prominent ;
antenne not quite extending to the middle of the elytra, black,
the basal joint testaceous, the last one fulvous, third joint shorter
than the fourth; thorax twice as broad as long, of even width,
the lateral margins moderately strongly rounded, the anterior
angles scarcely produced or mucronate, the sides deeply sulcate,
the surface impunctate; scutellum testaceous; elytra slightly
widened towards the middle, narrowly margined, extremely
minutely and closely punctured; metatarsus short; claw-joint
strongly swollen.
Hab. Bolivia.
Closely allied to O. pallescens but larger and the antenne and
legs of different coloration. O. paupera Illig. is described as
being only 3 millim. in length and with an elongate first joint of
the posterior tarsi, which show that the species is an Asphera.
OEDIONYCHIS SORDIDA, sp. nh.
Black, the head strongly punctured; thorax flavous, with
rounded sides and mucronate anterior angles, impunctate; elytra
finely punctured, flavous, the basal portion obscure fulvous;
scutellum black.
Length 73 millim.
Broadly elongate, nearly parallel; the head bluish black, strongly
and closely punctured, deeply transversely depressed between the
eyes, the latter widely separated ; antenne rather short, black,
the lower three joints shining, the rest pubescent, basal joint short
and thick, third and fourth joints subequal, the last of wider
shape, the following joints rather robust, cylindrical, slightly
shorter; thorax twice as broad as long, of equal width, the sides
deeply suleate, the lateral margins rounded, the anterior margin
produced outwards in shape of a small tooth, the surface flavous,
impunctate ; scutellum black; elytra slightly wider at the base
than the thorax, with narrow reflexed margins, nearly parallel,
finely but distinctly and very closely punctured; under side and
legs black ; prosternum longitudinally carinate.
Hab. Santa Catharina, Brazil.
There are two specimens of this insect before me, which,
although they show some differences, | must refer to the same
species. In one the head has only a few punctures and the
extreme basal margin of the elytra is stained with black, the
colour of the elytra is also entirely pale fulvous; but in structure
the two specimens agree entirely. The species is closely allied to
1905. | OF PHYTOPHAGOUS COLEOPTERA. 423
O. navicularis, but is of more elongate and less convex shape and
is much larger; the thorax is longer and less transverse,
OBDIONYCHIS ECUADORIENSIS, Sp. 0.
Broadly ovate, the head, antenne, and the under side black;
thorax flavous, impunctate; elytra obscure pale fulvous with
slight purplish shade, extremely finely punctured.
Length 8 millim.
Head with a few fine punctures near the eyes, finely granulate,
black, the frontal elevations pyriform, divided by a deep groove;
clypeus flavous; eyes very large, but not closely approached ;
antenne black, the basal three joints more or less testaceous
above, third joint slightly shorter than the fourth ; thorax with
strongly rounded and broadly flattened sides, the anterior angles
acute but scarcely produced, the dise rather convex, flavous,
impunctate ; scutellum triangular, fulvous ; elytra widened
towards the middle, with broadly reflexed margins, the latter
pale; the disc obscure fulvous with a slight purplish tint, very
finely and closely punctured; under side and legs black or
piceous; metatarsus very short, claw-joint strongly swollen.
Hab. “Ecuador.
This is a species of peculiarly dull appearance, unless this is
caused by discoloration, The two specimens before me are, how-
ever, entirely similar in this respect, the shape is rather broadly
ovate, and the elytral margins are proportionately broad,
OEDIONYCHIS RHODINA, sp. 0.
Oblong, nearly parallel, black; thorax rather short, testaceous,
impunctate, the sides gradually flattened; elytra without promi-
nent shoulders, testaceous, impunctate.
Length 7-73 millim.
Head impunctate, black; frontal tubercles broad, ill-defined ;
eyes widely separated, with a few punctures placed between them;
clypeus very short, strongly deflexed ; antennz not extending to
the middle of the elytra, black, the third and following joints
equal, terminal joints elongate; thorax rather short, the sides
rounded anteriorly, the anterior margin concave, anterior angles
produced into a short, blunt tooth, the disc impunctate, shining,
testaceous, the sides flattened, but this portion limited within by
a shallow sulcus only; scutellum more or less piceous at the base;
elytra slightly wider at the base than the thorax, rather elongate,
feebly widened only towards the middle, the shoulders but slightly
prominent and bounded within by a shallow depression only, the
surface nearly impunctate ; below and the legs black,
Hab. Espirito Santo, Brazil.
A rather larger species, and principally differing in the less
strongly flattened sides of the thorax, the oblong shape of the
elytra and their less prominent shoulders and almost impunctate
surface.
Proc, Zoou, Sec.—1905, Vou. II, No, X XIX, 29
424 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
OEDIONYCHIS PALLESCENS, Sp. 0.
Pale flavous, the antenne (the basal joints excepted), the knees,
and the anterior and intermediate tibie and tarsi black; thorax
impunctate; elytra exceedingly minutely punctured.
Length 4—43 millim.
Head impunctate, deeply grooved between the eyes, the latter
very large but well separated, frontal elevations transverse,
strongly raised, carina linear, palpi flavous; antenne extending
to the middle of the elytra, black, the lower three joints flavous,
third joint very slightly shorter than the fourth; thorax one half
broader than long, slightly narrowed anteriorly, the sides narrowly
flattened, the lateral margins rounded, anterior angles produced
inte a small tooth, the dise impunctate ; elytra slightly widened
towards the middle, narrowly margined, the base not depressed,
the surface very minutely and closely punctured; the knees, the
anterior and intermediate tibie and tarsi black (but not always) ;
the rest of the legs and the under side flavous, the posterior femora
sometimes with a piceous spot near the apex.
Hab, Peru.
Principally distinguished by the colour of the legs and its
small size.
OEDIONYCHIS INCONSPICUA, Sp. n.
Testaceous, the intermediate joints of the antennz black; eyes
closely approached ; thorax impunctate; elytra finely and closely
punctured.
Length 5 millim.
Head impunctate, deeply grooved between the eyes, the latter
very large, each broader than the space dividing them ; clypeus
short and thick; antennze not extending to the middle of the
elytra, black, the lower three and the apical two joints testaceous,
third and fourth joints equal; thorax twice as broad as long, the
sides rounded, broadly flattened, the anterior angles slightly
produced but blunt, the surface impunctate ; elytra rather convex,
nearly parallel, extremely minutely punctured; below and the
legs testaceous, the breast more or less pale piceous; first joint of
the posterior tarsi as long as the following two joints together,
claws strongly swollen.
Hab. Amazons.
Larger than O. pallescens; the antenne of different colour, the
eyes larger and more closely approached, the metatarsus of the
posterior legs rather longer than usual, but not so pronounced as
in Asphera, and the thorax typical of the genus. There are four
specimens before me.
OEDIONYCHIS HERBACEA, Sp. n.
Black, head finely punctured ; thorax testaceous, the sides
strongly rounded, finely wrinkled; elytra convex, testaceous,
strongly and closely punctured, the extreme basal and sutural
margins black; abdomen testaceous.
1905. ] OF PHYTOPHAGOUS COLEOPTERA. 425
Length 8 millim.
Of strongly convex, posteriorly widened shape, the head dis-
tinctly punctured at the vertex and near the eyes, black, the
middle of the base with a short longitudinal groove, frontal
tubercles narrow and transverse: antenne black, not extending
to the middle of the elytra, the lower three joints testaceous
below, short, the third joint slightly shorter than the fourth;
thorax strongly transverse, the lateral margins strongly rounded,
the anterior angles thickened but not dentiform, the sides rather
broadly flattened, the disc minutely aciculate and extremely finely
punctured ; scutellum black; elytra strongly convex, rather
suddenly deflexed below the middle, closely, evenly and strongly
punctured, the sides below the shoulders somewhat flattened, the
margins only slightly thickened, not reflexed, the extreme basal
and sutural margins black ; abdomen obscure testaceous ; rest of
the under surface and the legs black,
Hab. Sao Pauioc, Brazil.
Amongst the nearly unicolorous species the present one is well
distinguished by the shape and sculpture of the thorax and
elytra and by the coloration. O. balyi Cl, has a differently
shaped thorax and finely wrinkled elytra,
O®DIONYCHIS NIGROTIBIALIS, Sp. nh,
Head pale fulvous, the antennx, the anterior and intermediate
tibiz, and the tarsi black; thorax flavous; elytra fulvous, nearly
impunctate; under side and legs testaceous.
Length 6 millim.
Oblong-ovate; the head pale fulvous, with a few punctures near
the eyes; labrum piceous; antennz black, the third and fourth
joints equal, terminal joints shorter and thicker; thorax rather
strongly convex, the siles rounded and broadly flattened, the
anterior angles thickened, slightly truncate, not produced, the
surface very shining, impunctate, flavous; scutellum black ; elytra
dark fulvous, impunctate, with the exception of a short double
row of punctures below the shoulders; below pale fulvous, the
anterior and intermediate tibiz and all the tarsi black, posterior
tibiee fulvous.
Hab, St. Catharina, Brazil.
Of rather convex and oval shape, and distinguished by the
flavous thorax and the colour of the legs.
OEDIONYCHIS CONSIMILIS, sp. n. (Clark Catal.).
Black, the elypeus testaceous; thorax with broadly flattened
sides, impunctate, testaceous; scutellum black; elytra very finely,
partly obsoletely punctured, testaceous.
Length 8 millim,
Of posteriorly slightly widened shape; the head black, with a
few punctures placed in a row in front of the eyes; clypeus tes-
taceous, the carina very prominent; antennz black, the lower two
Pag
426 MR. MARTIN JACOBY ON NEW SPECIES [Nov. 28,
joints more or less flavous below, the third joint distinctly shorter
than the fourth; thorax with the sides broadly flattened, the
anterior angles pointed but not produced, the disc impunctate,
testaceous, the lateral margins feebly rounded anteriorly; scu-
tellum black; elytra convex, without basal depressions, with
narrow reflexed margins, closely and very finely punctured, tes-
taceous; under side and legs black, the abdomen more or less
flavous at each side.
Hab. Peru.
Very closely allied to O. plebeja Klug, but in that species the
head is punctured at the vertex and the eyes are margined with
testaceous, the elytra are more strongly punctured, and the
“habitat” of the species is Brazil. I have preserved Clark’s
catalogue name for the present species, of which specimens are
also contained in the British Museum. 0. obscuripennis Jac., also
from Peru, is likewise very closely allied, but is a smaller insect,
of different shape, with the anterior angles of the thorax mucro-
nate and a much more flattened carina of the clypeus.
OEDIONYCHIS NIGRIMANA, Sp. Nn.
Black; thorax short’ and strongly transverse, impunctate ;
elytra finely punctured, pale greyish-testaceous.
Length 5 millim.
Of medially gradually widened shape, moderately convex ; the
head entirely impunctate, black, the frontal elevations transverse,
contiguous, carina acute, convex; antennz black, the third and
fourth joints equal (the rest wanting); thorax short, of equal
width, more than twice as broad as long, the lateral margins
rounded, the sides broadly flattened, the anterior angles neither
thickened nor produced, the surface impunctate, black, very
shining; scutellum black; elytra gradually widened towards the
middle, finely and closely punctured, pale greyish-testaceous,
below and the legs black ; metatarsus moderately short, claw-joint
very strongly inflated ; prosternum proportionately broad.
Hab. Peru.
Of similar coloration to O. turpis Jac., but much smaller, the
head and thorax entirely black and the elytra without apical
black spot,
OEDIONYCHIS ALBIPENNIS Jac.
Since this species was described (P. Z. 8. 1894, p. 609) I have
received a good many more specimens from the Amazon regions,
which prove that the insect is extremely variable in regard to size
as well as to coloration. The type was described from nearly
unicolorous specimens; those now before me show the following
elytral markings :—
a. Two spots at the basal margin; a longitudinal streak near
the side, very broad at its commencement, strongly pointed
at the apex.
1905. ] OF PHYTOPHAGOUS COLEOPTERA, 497
6. The basal spots absent ; each elytron with a narrow, oblique
band from the middle of the base to the lateral margin
below the middle.
ec. The extreme basal margin, connected with a narrow sub-
lateral longitudinal stripe, black.
d, Elytra with two basal small spots and another at the middle.
In all these forms the anterior and posterior margins of the
thorax are more or less black, and frequently this colour occupies
the entire middle of the disc, leaving only the sides testaceous ;
the eyes are closely approached, and the head at the vertex is
generally finely punctured and wrinkled, but sometimes im-
punctate ; the metatarsus of the hind legs is scarcely typical of
Oedionychis, being rather more elongate, but not to such an extent
as to include the species in Asphera. The form with three black
spots can scarcely be distinguished from O. humeralis Fab., but in
that species all the specimens I have seen have a unicolorous
testaceous thorax, without any markings, and no black basal
elytral margin. All the specimens before me (16) come from the
Amazon regions.
Llytra pale, with spots and bands combined.
OEDIONYCHIS PARALLINA, Sp. Nn.
Head and breast black ; thorax testaceous, impunctate ; elytra
extremely minutely punctured, flavous, two spots at the base, two
others below the middle, and a transverse band at the latter place
black ; legs testaceous, apex of the posterior femora black,
Length 6-7 millim.
Of posteriorly slightly widened shape, rather flattened ; the head
black, the vertex minutely granulate and punctured, frontal
elevations very broad, trigonate, eyes extremely large, carina
acute ; palpi flavous ; antenne rather robust, the basal four and the
apical three joints flavous, the rest black, third and following
joints nearly equal; thorax more than twice as broad as long, the
sides gradually but broadty flattened, the posterior margin straight,
the anterior angles not produced, the disc impunctate, testaceous ;
scutellum black; elytra extremely minutely and closely, almost
confluently punctured, testaceous, the shoulders with an elongate
black spot, another round spot near the scutellum ; a transverse
narrow band at the middle and two spots near the apex, placed
transversely, likewise black; breast black; abdomen and legs
testaceous, the posterior femora black at the apex.
Hab. Brazil.
Easily known by the pattern of the elytra and system of
coloration. The male insect is of considerably smaller size and
much narrower.
OEDIONYCHIS COLOMBIANA, Sp. n.
Piceous, above testaceous, the apical joints of the antenn» and
428 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
the breast piceous; thorax impunctate; elytra subdepressed,
extremely closely and finely punctured, the basal margin, a narrow
transverse band below the middle, and two spots near the scutellum
dark brown.
Length 7 millim.
Head impunctate, testaceous, the frontal elevations rather
feeble ; eyes large, the intermediate space not wider than the width
of each eye; antennz with the basal three or four joints and the
apical one testaceous, the rest blackish; thorax short and trans-
verse, the sides broadly flattened, the anterior angles dentiform ;
the disc impunctate, testaceous, feebly transversely suleate near
the base ; scutellum testaceous; elytra widened towards the apex,
rather flat, extremely finely and closely punctured, testaceous, the
extreme basal margin, a small spot near the scutellum, and a
narrow transverse, slightly convex band, immediately below the
middle, piceous or dark fulvous; legs testaceous; breast and
abdomen piceous.
Hab. Pichinché, Colombia (Rosenberg).
Of this species I have five exactly similar specimens before me.
The design of the elytra differs from that of any other species
Tam acquainted with except O. tenwicineta Jac., which is a dif-
ferently shaped insect, with a different thorax, very narrow elytral
bands, and of black colour. This species is also known from Mexico.
OEDIONYCHIS DIVERSA, Sp. 1.
Testaceous, the apical joints of the antenn (except the last)
and the breast black; thorax impunctate ; elytra elongate, finely
punctured, each with two spots at the base, one at the middle, and
a transverse band near the apex, black.
Var. The apical band divided into two spots.
Length 5 millim.
Head impunctate, deeply foveolate between the eyes, the latter
very large; antennz with the lower five and the apical joint testa-
ceous, the others black, third and fourth joints equal, elongate,
the terminal joints rather shorter; thorax about twice and a half
broader than long, the sides broadly flattened, the lateral margins
strongly rounded anteriorly, the anterior angles thickened but
not produced, the surface impunctate, rather convex; scutellum
black; elytra elongate, nearly parallel, very minutely punctured,
testaceous, a small spot on the shoulders, another nearthe scutellum,
a third at the middle, and a transverse band near the apex, not
quite extending to either margin, black; legs and abdomen testa-
ceous, breast black.
Hab. St. Catharina, Rio Janeiro, Brazil.
A somewhat elongate species, principally distinguished from
those with similar elytral spots by the additional black subapical
band and the black breast, colour of the antenne, &e.
OEDIONYCHIS BISBINOTATA, sp. n. (Plate XV. fig. 8.)
' Flavous, the apical joints of the antenne black; thorax im-
1905. | OF PHYLOPHAGOUS COLEOPTERA. 429
punctate, with two small black spots; elytra minutely punctured
at the base only, a spot on the shoulders, another near the
scutellum, and the posterior half black.
Var. The thoracic and elytral spots absent.
Length 6 millim.
Head impunctate, flavous; eyes large, each as broad as the
intermediate space, frontal elevations transverse; antennze with
the lower joints flavous, the terminal ones more or less black ;
thorax twice as broad as long, the sides rounded, narrowed in
front and broadly flattened, anterior angles pointed, slightly pro-
duced, the surface impunctate, flavous, with two small back spots
near the base; elytra nearly impunctate, except near the base,
where there are a few minute punctures, flavous, a spot near the
scutellum and one on the shoulders, as well as almost the whole
posterior portion, black, but this colour not quite extending to the
apex; under side and legs flavous; prosternum convex between
the cox; metatarsus very short, claw-joint strongly swollen.
Hab. Peru.
Of this species I possess two specimens, in one of which some
obsolete additional thoracic spots are present and the elytral ones
absent, the shape of the posterior black portion is regular; in the
other the anterior edge is deeply sinuate, but other differences I
cannot find.
OEDIONYCHIS VARIATA, Sp. 0.
Obscure piceous below, above testaceous ; thorax impunctate:
elytra subdepressed, extremely minutely punctured, the basal
margin, a spot on the shoulders, another oblique spot near the
scutellum, a transverse narrow band at the middle, and another
spot near the apex, black.
Length 7 millim.
Head impunctate, the frontal elevations feebly raised, carina
short and convex; antenne fulvous, the third joint shorter than
the fourth (2) or equal (¢); thorax with broadly flattened sides,
the lateral margins nearly straight, obliquely narrowed anteriorly,
the dise rather flat, impunctate, testaceous, the anterior angles
in shape of a small tooth; elytra evenly rounded and widened
at the middle, broadly margined, scarcely perceptibly punc-
tured, testaceous, the extreme basal margin, connected with
an elongate spot which covers the shoulders, an oblique comma-
like spot near the scutellum, a narrow transverse band (somewhat
angulate near the lateral margin) at the middle, and another
transverse spot near the apex, black ; below and the legs testaceous.
Hab. Bolivia.
Well distinguished by the shape and the position of the elytral
spots.
OEDIONYCHIS INGRATA, Sp. n.
Testaceous, the apical joints of the antennz piceous; thorax
430 MR, MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
impunctate, the anterior angles not produced; elytra finely
punctured anteriorly, a sutural pear-shaped spot below the
scutellum and a transverse band below the middle bluish-black ;
breast black.
Length 5 millim.
Head impunctate, deeply foveolate between the eyes, the latter
rather closely approached ; antenne with the lower four joints
fulvous, the rest piceous, the joints comparatively short ; thorax
about twice as broad as long, the sides feebly rounded and
narrowed anteriorly, the anterior angles thickened and not pro-
duced, the sides broadly flattened, the dise impunctate; scutellum
black ; elytra very finely punctured, except near the base and
within the humeral depression, where the punctuation is stronger,
the ground-colour testaceous, a sutural spot below the scutellum
and an irregular narrow transverse band below the middle bluish-
black, sometimes piceous; the breast black, the abdomen and legs
testaceous.
Hab. Espirito Santo, Brazil.
Two exactly similarly coloured specimens of this species are
before me; the design of the elytra differs from that of any other
Oedionychis, and the general size of the insect is comparatively
small,
OEDIONYCHIS VENEZUELENSIS, Sp. Nn.
Flavous, the apical joints of the antennz piceous; head with
two black bands; thorax fulvous, impunctate; elytra extremely
minutely punctured, with a spot at the shoulders, another near
the scutellum, a transverse band before and another below the
middle, black.
Length 6 millim.
Of somewhat flattened, posteriorly slightly widened shape ; the
head with a few punctures near the eyes, the latter very large, the
diameter of each distinctly wider than the intermediate space;
the vertex flavous, with a black stripe at each side, the space
between the antennz strongly convex in shape of a ridge, black ;
the palpi flavous; antennz slender, the lower three joints flavous,
the others blackish, third joint slightly shorter than the fourth ;
thorax not more than twice as broad as long, the sides nearly
straight and slightly narrowed anteriorly, broadly flattened, the
anterior angles thickened but scarcely produced, the dise impunc-
tate, fulvous, the flattened portion flavous, the base with an
obsolete transverse sulcus ; scutellum flavous ; elytra scarcely per-
ceptibly punctured, flavous, the shoulders with a short, thick
black spot, another one of more elongate shape is placed near the
scutellum, a transverse, medially constricted black band is situated
before and a second one below the middle; the under side and
legs are flavous; metatarsus and claw-joint typical.
Hab. Venezuela.
Differs in the coloration of the head and the position of the
elytral markings from any other species.
1905. | OF PHYTOPHAGOUS COLEOPTERA. 431
OEDIONYCHIS CENTROMACULATA, sp. n. (Plate XV. fig. 2.)
Testaceous or fulvous; antenne (the apical joints excepted)
black; thorax impunctate ; elytra minutely punctured, a trans-
verse band at the base, another below the middle, obscure fulvous,
the intermediate space with four small black spots.
Length 6—7 millim.
Head impunctate, with a deep fovea between the eyes, the
latter large, closely approached ; antenne black, the lower three
or four and the apical two joints fulvous, third and fourth joints
equal, the following joints rather shorter; thorax with rather
strongly rounded sides, the latter broadly flattened, anterior angles
mucronate, the dise impunctate, obscure fulvous ; elytra widened
at the middle, distinctly margined, extremely finely punctured at
the base, fulvous, this colour divided at the middle by a narrow
testaceous transverse band in which four black spots are placed
transversely ; under side and legs testaceous ; prosternum in the
male strongly convex anteriorly.
Hab. St. Catharina, Brazil.
Quite distinct in its system of coloration from any other species.
Two specimens are before me.
OEDIONYCHIS ARCUATOFASCIATA, sp. n. (Plate XV. fig. 7.)
Ovate, subdepressed, greenish testaceous; thorax impunctate,
with rounded sides; elytra scarcely perceptibly punctured, the
basal margin, a narrow semicircular band at the base, a spot at
the lateral and another near the sutural margins below the middle,
black.
Length 5 millim,
Head impunctate, eyes large, frontal tubercles subquadrate,
short, carina acute; antenne extending to the middle of the
elytra, testaceous, the third and fourth joints equal, terminal joint
rather more robust ; thorax quite twice as broad as long, of equal
width, the sides moderately rounded, the lateral sulci deep, rather
narrow, the base with another obsolete transverse groove, the
surface impunctate ; scutellum black ; elytra widened towards the
middle, rather flattened, pale greenish testaceous, with a few
minute punctures (only visible under a strong lens), the extreme
basal margin as far as the shoulders and a transverse semicircular
narrow band below the base black; this band extends upwards
along the suture to the scutellum, it is suddenly constricted at its
middle and does not extend to the lateral margins, near the latter
is another black spot, below the middle and a little lower a second
one is placed near the suture ; under side and legs testaceous.
Hab. Chilpancingo, Mexico.
I formerly looked upon this species as a variety of O. 13-macu-
lata Jac., but a further careful examination has convinced me that
it really represents another form, as the colour of the antenne,
shape and number of the elytral spots are different and exactly
similar in the two specimens before me; this species is also of a
less rounded and smaller shape.
432 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
Elytra blue or black, without markings.
OEDIONYCHIS SUBCOSTATA, Sp. nN.
Metallic blue, the head and thorax reddish-fulvous, the latter
finely punctate; elytra dark blue, rather opaque, closely and
strongly rugose-punctate, with a single, very obsolete costa near
the sides.
Length 7 millim.
Head impunctate, reddish-fulvous ; frontal elevations strongly
raised, transverse, carina linear, very convex; antenne with the
lower two joints fulvous, the following four black, the rest wanting,
third joint shorter than the fourth ; thorax transversely convex,
about twice as broad as long, the sides broadly flattened, rounded
in front, the anterior angles produced outwards into a small
tooth, the dise with a rather distinct transverse groove near the
base, minutely punctured when seen under a strong lens; scutel-
lum black; elytra dark blue, rugosely punctured throughout, a
slightly raised narrow line extends from within the shoulders to
below the middle; under side and legs dark metallic blue, smooth
and shining.
Hab. Brazil.
OEDIONYCHIS MOTSCHULSKYT, Sp. Nn.
Head at the vertex, the antenne (the apical joints excepted),
the under side, and the tibiz and tarsi black; thorax and femora
flavous; elytra metallic violaceous, finely and closely punctured.
Length 5 millim.
Head e tirely impunctate, black, shining; the eyes widely
separated ; frontal elevations transverse, very strongly raised ;
clypeus triangular, flavous as well as the labrum ; antenne slender,
extending to the middle of the elytra, black, the apical three joints
fulvous, third and fourth joints equal; thorax nearly three times
broader than long, flavous, the sides rounded, deeply sulcate, the
anterior angles very shghtly produced outwards into a blunt tooth,
the surface entirely impunctate, obsoletely transversely sulcate
near the base; scutellum black; elytra with a feeble impression
below the base, convex, nearly parallel, very narrowly margined,
finely and very closely punctured, metallic violaceous blue; legs
flavous, the breast, abdomen, the apex of the posterior femora, and
the tibie and tarsi black.
Hab. Peru.
The colour of the head, antenne, and legs, and the rather narrow
parallel shape of this species separate it from those of nearly
similar coloration.
OEDIONYCHIS INDIGOSOMA, sp. n.
Head and thorax fulvous, nearly impunctate; elytra dark blue,
closely and strongly semirugose punctate; below and the legs
bluish black.
Length 7 millim.
1905. | OF PHYTOPHAGOUS COLEOPTERA. 433
Head fulvous, impunctate, eyes widely separated; antenne
black, the basal two joints obscure fulvous, terminal joints
shortened, third and fourth equal; thorax twice as broad as long,
the sides rounded anteriorly, the middle of the disc rather convex,
the anterior angles produced outwards into a small tooth, the sides
broadly flattened and subrugose, the surface impunctate, obsoletely
transversely sulcate near the base; scutellum black; elytra not
perceptibly depressed below the base, dark blue, not very shining,
closely and distinctly rugose punctate throughout; below and the
legs bluish black; prosternum comparatively broad, flavous.
Hab. Petropolis, Brazil.
A well-distinguished species on account of the colour and
sculpture of the elytra.
Llytra dark, with flavous spots, patches, or bands.
OEDIONYCHIS INTERSIGNATA, sp. n. (Clark Catal.).
Black, thorax flavous; elytra closely and strongly punctured,
violaceous or blue, a transverse band or broad patch at the middle,
the apex and the lateral margins (partly) flavous.
Length 7 millim.
Head piceous or black, impunctate, eyes very large, as wide as
the intraocular space, frontal elevations strongly raised, pyriform,
carina acute; antenne black, the lower three joints fulvous below,
third and fourth joints equal; thorax quite twice as broad as long,
the sides rounded, broadly flattened within, the anterior angles in
shape of a very small tooth, the surface impunctate, flavous ;
scutellum black; elytra strongly and closely punctured, blue,
violaceous or purplish, with a transverse flavous patch at the
middle and a smaller one at the apex, the lateral margins
anteriorly and posteriorly likewise flavous as well as the elytral
epipleure ; underside and legs black.
Hab. Espirito Santo, Brazil.
A rather variable species as regards the flavous markings of
the elytra, but distinguished by the comparatively strong punc-
tuation; the central flavous band scarcely extends to the suture,
nor does the apical one, but both unite with the flavous lateral
margins.
OEDIONYCHIS RUSTICA, Sp. n.
Testaceous, the intermediate joints of the antennz black; thorax
impunctate; elytra extremely closely and finely punctured, a
transverse band at the base, another of oblique shape near the
apex, and the intermediate portion of the suture fulvous, more or
less edged with piceous.
Length 5 millim.
Head impunctate, eyes very large and rather closely approached ;
frontal elevations broad, subquadrate, divided by a narrow groove;
antenne extending beyond the middle of the elytra, the five lower
and the terminal two joints fulvous, the others blackish; thorax
434 MR. MARTIN JACOBY ON NEW SPECIES [Nov. 28,
short and transverse, the sides rounded and broadly flattened, the
anterior angles acute but not dentiform, the surface entirely
impunctate, testaceous; scutellum piceous; elytra with broadly
flattened margins, slightly widened at the middle, finely and closely
punctured, testaceous, with two broad fulvous transverse bands—
one at the base, deeply concave at its lower margin and connected
by a sutural stripe with the second band near the apex of obliquely
subquadrate shape, both bands are interrupted at some distance
from the lateral margins and are more or less distinctly edged
with piceous, the basal margin especially so; under side and legs
testaceous.
Hab. Argentine R. and Brazil.
Not unlike O. pustulata Jac. in coloration, but the antennz
differently coloured, the thorax without a fulvous spot, and the
elytral bands of different shape.
OEDIONYCHIS CATHARINA, Sp. n.
Dark fulvous below, antenne black; thorax flavous, impunctate ;
head and scutellum dark fulvous; elytra rather strongly and
closely punctured, dark fulvous, a large discoidal ovate patch on
each, flavous.
Length 6 millim.
Of rather elongate and parallel shape; the head impunctate,
fulvous, deeply grooved between the eyes, the latter large, frontal
elevations broad, transverse; carina blunt and thick; antenne
robust, black, third joint distinctly shorter than the fourth; thorax
strongly transverse, the lateral margins distinctly rounded, the
anterior angles but slightly produced outwards, scarcely toothed,
lateral sulci broad and deep, the surface impunctate, flavous;
elytra with narrow reflexed margins, fulvous, distinctly punctured,
the dise occupied by a large flavous ovate patch, with its nar-
rowest portion near the suture ; under side and legs dark fulvous,
the tibize and tarsi blackish ; metatarsus very short, claw-joint
strongly inflated.
Hab. St. Catharina, Brazil.
Of somewhat similar coloration to O. 4-pustulata Jac. from the
same locality, but the thorax without fulvous spot, the antennz
entirely black, with more elongate joints, and the whole apex of
the elytra fulvous; the thoracic sulci in the present species also
are wider and deeper.
OEDIONYCHIS OCELLATA, sp.n. (Plate XV. fig. 10.)
Black, thorax testaceous, with three black spots; elytra closely
and strongly punctured, each elytron with six small flavous
spots (1.2.2.1).
Length 5 millim.
Head not perceptibly punctured, the middle black, the sides and
the anterior portion testaceous, frontal tubercles short and broad,
strongly raised, carina broad; antenne rather short and robust,
black, the lower three joints more or less flavous, third joint more
1905. | OF PHYTOPHAGOUS COLEOPTERA, 435
slender and slightly longer than the fourth, the following joints
thickened ; thorax strongly transverse, the sides rounded, broadly
flattened, anterior angles mucronate. the surface with a few minute
punctures, testaceous, with three small black spots placed trans-
versely; scutellum black; elytra with strongly but narrowly
reflexed margins, rather strongly and very closely punctured, with
a very feeble depression below the base, black, each elytron with
six round flavous spots—of these, one is placed at the middle, just
below the basal margin, two at the middle, placed transversely,
two immediately below, and one at the apex; under side and legs
black.
flab. Paraguay.
A rather small and well-marked species, of which I possess a
single specimen only.
Hlytra with elongate spots or longitudinal black or
Jlavous bands.
OEDIONYCHIS HUMBOLDTI, sp. n.
Testaceous, the head and the breast black, sides of the thorax
straight, the latter impunctate; elytra closely and finely punctured,
two elongate spots at the base and two below the middle of each
elytron black,
Length 6 millim.
Head black or nearly so, impunctate, the frontal elevations
broad, trigonate, clypeus perpendicularly deflexed ; antennee
robust, fulvous, the third joint smaller than the fourth; thorax
narrowed in front, one-half broader than long, the sides straight,
broadly flattened, the anterior angles produced into a small tooth,
the surface impunctate, testaceous ; scutellum testaceous; elytra
nearly parallel, closely and distinctly, although finely punctured,
testaceous, each elytron with two more or less elongate black spots
at the base and two others below the middle—of the basal spots,
one is placed on the shoulders and extends nearly down to the
middle, the other shorter one is placed near the suture; the
posterior spots are almost joined, the outer one being of more
elongate shape than the mner; under side and legs testaceous,
breast black.
Hab. Bolivia.
This Oedionychis is well distinguished by the straight lateral
margins of the thorax, which are obliquely narrowed anteriorly,
and by the four elytral spots. In one specimen the latter are
represented by short and narrow stripes.
OEDIONYCHIS WATERHOUSEI (MS, Clark), sp. n.
Black, the clypeus flavous; head strongly punctured; thorax
flavous, impunctate; elytra finely and closely punctured, bluish
black, the lateral margins narrowly and a broad discoidal band,
joined at the apex to the margin, flavous.
Length 6 millim.
436 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
Head piceous or black, the vertex coarsely punctured, the
clypeus flavous; antennz black, the third and fourth joints very
nearly equal; thorax strongly transverse, the sides strongly but
not broadly flattened, the lateral margins rounded in front,
anterior angles dentiform, the surface impunctate, flavous, with a
very obsolete transverse sulcus near the base; scutellum black ;
elytra finely and closely punctured, bluish black, the discoidal
flavous stripe of double the width of the similarly coloured
lateral margins and connected with the latter at the apex; under
side and legs black; elytral epipleurze with a very narrow inner
dark margin.
Hab. Brazil.
This banded species is more nearly allied to O. figurata Chev.
than to any other, and may be known by the dark head, antenne,
and legs, the broad discoidal elytral flavous stripe, which has
somewhat irregular outlines, and by the inner dark margin of the
elytral epipleure. ‘The species, if these details be kept in view,
cannot be mistaken for any of those of which v. Harold has given
an analytical table (Berlin. ent. Zeitschr. 1881).
OEDIONYCHIS EXCLAMATIONIS, sp. n. (Plate XV. fig. 3.)
Testaceous, the intermediate joints of the antenne black;
thorax impunctate; elytra minutely punctured, two elongate
spots at the base and a longitudinal stripe at the sides, strongly
thickened at the upper end, black.
Length 7 millim.
Head impunctate; the eyes large, each as wide as the inter-
vening space; carina short and convex, narrow ; antenne tes-
taceous, the sixth to the ninth joints blackish, third smaller than
the fourth joint ; thorax more than twice as broad as long, the
sides strongly rounded and broadly flattened, the anterior angles
produced into a small tooth, the surface impunctate; elytra not
wider at the base than the thorax, with narrow reflexed lateral
margins, extremely finely and closely punctured, testaceous, the
base with two black longitudinal short stripes, the sides near the
margins with another longer narrow black stripe, which ends
anteriorly rather abruptly in a club or knob directed towards
the suture; under side and legs testaceous.
Hab. Brazil.
I know of only a single specimen of this rather peculiarly
marked species, the exact locality of which is unknown to me.
OEDIONYCHIS INTERRUPTO-VITTATA, sp. n. (Plate XV. fig. 6.)
Testaceous, the head and the intermediate joints of the antenne
black ; thorax impunctate, the anterior angles mucronate ; elytra
finely punctured, testaceous, each elytron with two more or less
interrupted longitudinal black stripes ; the breast black.
Length 6 millim.
Of flattened shape; the head impunctate, black, deeply foveolate
between the eyes, the latter large, their diameter as wide as the
1905. | OF PHYTOPHAGOUS COLEOPTERA. 437
dividing space; labrum fulvous; antennz with the lower four and
the apical three joints fulvous, the others black, third and follow-
ing joints nearly equal, elongate; thorax with strongly rounded
and flattened sides, the anterior angles mucronate and produced
forward, the dise impunctate, testaceous, obsoletely transversely
grooved near the base ; elytra finely and closely punctured, rather
flattened, narrowly marginate, each elytron with two narrow
longitudinal stripes—one near the suture, the other near the
lateral margins, below the middle beth, or one, of the stripes are
interrupted, so that only one or two elongate spots remain near
the apex ; under side and legs testaceous, the breast black.
Hab. St. Catharina, Brazil.
In one of the specimens the inner black elytral stripe only is
interrupted ; in the other this is the case with both stripes, there
is also an indication of another stripe in shape of a minute spot
between the others, placed at the middle. Amongst the species
with elytral longitudinal bands the present one is well distin-
guished by the colour of the head, antennz, and the shape of the
elytral stripes, which resemble signs of exclamation.
Elytra pale, with transverse black or blue bands or spots.
OEDIONYCHIS BISTRIFASCIATA, Sp. 0.
Black or piceous, antenne dark fulvous, clypeus flavous ; thorax
impunctate, flavous; elytra finely and closely punctured, flavous,
each with three transverse dark blue bands, the first subquadrate
and emarginate or subdivided at the base.
Length 53 millim.
Of rather elongate shape; the head bluish black, with some
strong punctures near the eyes; clypeus and labrum flavous, the
eyes likewise margined more or less with the same colour ; antennz
extending to nearly the middle of the elytra, dark fulvous, the
basal two joints more or less stained with black above, third and
fourth joints equal, terminal joints slightly thickened; thorax
rather more than twice as broad as long, the sides strongly but
not very broadly flattened, the lateral margins rounded anteriorly,
anterior angles produced into a short blunt tooth, the surface
impunctate or with a few very minute punctures, obsoletely
transversely grooved near the base, flavous; scutellum black ;
elytra finely and closely but distinctly punctured, with three
transverse blue or purplish bands—the first at the base the largest,
of subquadrate shape, its basal margin with a narrow incision,
the second band immediately below the middle, half the width of
the first band, the third near the apex, short and of subquadrate
shape, none of these bands extends to either margin; below and
the legs black or piceous.
Hab. Peru.
In one of the specimens before me the basal band is also rather
deeply emarginate near the suture at the sides as well as at the
base.
438 MR. MARTIN JACOBY ON NEW SPECIES [Noy. 28,
OEDIONYCHIS INFORMIS (MS. Clark), sp. n.
Testaceous, the head, breast, and abdomen (partly) black ;
thorax impunctate, scutellum black; elytra minutely punctured
each with three transverse black bands ; legs testaceous, the apex
of the posterior femora and the base of the tibie black.
Length 6 millim.
Head narrow, dark piceous, impunctate, eyes large; two basal
joints of the antennee testaceous, the others wanting ; thorax with
the lateral margins strongly rounded, the sides very broadly
flattened, anterior angles not produced into a tooth, the dise im-
punctate, testaceous ; scutellum black; elytra with rather broadly
reflexed lateral margins, extremely finely and closely punctured,
testaceous, with three transverse black short bands abbreviated
at each end, the basal one in shape of a large subquadrate patch
placed on the shoulders, the second one, the narrowest, placed at
the middle, and the third near the apex; under side black, the
last three abdominal segments and the legs testaceous, the extreme
apex of the posterior femora and the base of their tibie black.
Hab. Rio de Janeiro.
OEDIONYCHIS GRAYI, Sp. n.
Dark fulvous below; clypeus and thorax flavous, base of the
head black, anterior angles of thorax mucronate, the latter im-
punctate; elytra very finely and closely punctured, flavous, a
broad transverse band at the base and another below the middle,
not extending to the margins, dark violaceous, posterior edge of
the second band rounded.
Length 63 millim.
Head impunctate, the vertex black, frontal tubercles narrowly
transverse, flavous, as well as the clypeus, labrum, and the palpi ;
antenne short, not extending to the middle of the elytra, dark
fulvous, the basal joint thick, subcylindrical, widened at the apex,
the third joint twice as long as the second but shorter than the
fourth joint, the following joints about as long as the third;
thorax narrowed anteriorly, about twice and a half broader than
long, the sides nearly straight, the lateral sulci not deeply
separated from the disc, anterior angles mucronate, the surface
convex, impunctate, flavous; scutellum blackish; elytra rounded
and widened towards the middle, narrowly margined, the shoulders
with a short, moderately deep impression within, the surface finely
but distinctly and very closely punctured, the dark bands very
wide, the dividing spaces narrow, the lateral margins likewise
narrowly flavous, the posterior band rounded at its apical
margin, leaving the suture for a little way upwards and the apex
of the elytra somewhat more broadly flavous; under side and
legs fulvous.
Hab. Amazons (Bates).
The single specimen contained in my collection was obtained by
Bates, but bears no special locality. The species differs from
1905. | OF PHYTOPHAGOUS COLEOPTERA. 439
O. cardinalis in the coloration of the head and the antenne, in
the scarcely rounded sides of the thorax, and in the shape of the
posterior elytral band. The same differences separate the species
from others nearly similarly marked.
This is one of the most difficult sections of the genus, as the
amount of variation in regard to the elytral bands, their shape
and size, can only be ascertained where sufficient material is at
hand ; neither coloration nor sculpture can always be relied upon
in these insects.
OEDIONYCHIS ARCUATA, Sp. D.
Black, the head bluish; clypeus flavous; thorax impunctate,
flavous ; elytra closely and distinctly punctured, flavous, a broad
transverse band at the base, a transverse large spot below the
middle, and the apex metallic blue.
Length 6 millim.
Head bluish black, strongly punctured at the sides above the
eyes, frontal elevations broadly transverse ; clypeus flavous ;
antenne black, third joint scarcely shorter than the fourth,
terminal joints rather robust and short; thorax more than twice
as broad as long, the sides with a deep but not very broad sulcus,
anterior angles strongly thickened but scarcely produced, the
lateral margins rounded anteriorly, straight at the base, the disc
very finely punctured when seen under a strong lens, flavous, the
base with a very obsolete transverse sulcus; scutellum black;
elytra with very narrow reflexed lateral margins, not depressed
below the base, very closely and more or less strongly punctured,
the anterior half of their length occupied by a transverse blue
band not extending to the lateral margins, its posterior edge
concave, immediately below the middle is another large transverse
band which has its anterior margin convex and the posterior one
rounded, the extreme apex of each elytron is likewise metallic
blue; under side and legs black.
Hab. Colombia.
Hvidently closely allied to O. labiata Schauf., but the fourth
joint of the antennz in that species is described as the longest ;
the elytra are described as nearly smooth, and the first transverse
band as being interrupted at the suture; the same is the case
with the second band, which is said to be composed of two spots.
OEDIONYCHIS BIPARTITA, Sp. n.
Broadly ovate, convex, black, the clypeus and the thorax
fulvous, the latter very minutely punctured, the angles mucro
nate; elytra extremely closely and finely punctured, flavous, a
transverse band at the base, another one at the middle, and a
third near the apex, bright metallic green.
Length 7-8 millim.
Head black, impunctate, diameter of each eye about as wide as
the dividing space, clypeus fulvous, frontal elevations narrowly
Proc. Zoou. Soc.—1905, Vou. II. No. XXX. 30
440 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
transverse ; antenne long and slender, black, the lower three
joints more or less piceous below, third joint shorter than the
fourth, intermediate joints slightly widened; thorax more than
twice as broad as long, the sides strongly rounded and deeply
suleate, anterior angles distinctly produced into a tooth, the disc
fulvous, minutely punctured when seen under a very strong lens ;
scutellum black, broad; elytra widened towards the middle, tes-
taceous, with three metallic green transverse bands which do not
extend to the lateral margins; of these bands, which are all con-
nected with each other at the suture, the first is of somewhat
irregular shape and does not extend to a third of the length of
the elytra, its posterior edge is irregularly serrate, the second
band at the middle is broader (in a longitudinal sense) and of
more regular shape, the third band is again narrow and more or
less curved and does not extend to the apex, which remains of the
ground-colour ; below and the legs black, metatarsus of the pos-
terior legs shorter than the following two joints together, claw-
joint strongly swollen.
Hab: Pachitea, Peru.
A handsome species, distinguished by the three bright metallic
green elytral bands.
OEDIONYCHIS ILLUSTRIS, sp.n, (Dej. i. litt.) (Plate XV. fig. 11.)
Testaceous, the legs dark fulvous; thorax short, impunctate ;
elytra convex, scarcely perceptibly punctured, a broad transverse
band at the base, another below the middle, not extending to the
suture, and the apex purplish violaceous.
Length 8 millim.
Head impunctate, the vertex obscure purplish, the rest of the
face testaceous; clypeus strongly raised in shape of a triangular
ridge; eyes large; antennz piceous, the basal joint testaceous
below, third joint shorter than the fourth; thorax short and
transverse, the sides broadly flattened, the anterior angles pro-
duced but scarcely dentiform, the surface impunctate, testaceous ;
scutellum black; elytra widened towards the middle and convex,
extremely minutely punctured, flavous, with two transverse
broad purplish bands—the first at the base, not quite extending
to the middle nor to the lateral margins, the second, in shape of a
transversely subquadrate band, not extending to either margin,
another triangular spot occupies the apex; all these bands are
separated by nearly equal narrow spaces of the flavous ground-
colour, but the basal band extends across the suture; under side
and the base of the anterior and intermediate femora testaceous,
the rest of the legs and the posterior femora dark fulvous.
Hab. Cayenne.
A species of broadly ovate shape and resembling in its markings
O. biteniata Baly, but in that species the second elytral band
extends to the suture, all are of much more narrow shape, and
dull blue instead of metallic purple.
1905.] OF PHYTOPHAGOUS COLEOPTERA. 44)
OEDIONYCHIS ILLIGERI, sp. Ni.
Piceous ; thorax flavous, anterior angles not mucronate ; elytra
closely punctured, flavous, a transverse band at the base, emar-
ginate within the shoulders, a narrower band below the middle,
and a triangular spot near the apex, dark fulvous or piceous.
Var. The posterior elytral markings joined.
Length 5-6 millim.
Of short and ovately rounded shape; the head with some deep
punctures near the eyes, the vertex piceous, clypeus flavous, eyes
well separated, frontal tubercles oblique, rather short; antenne
short, fulvous or black, the third, fourth, and fifth joints equal ;
thorax strongly transverse, more than twice as broad as long, the
sides broadly suleate, rounded in front, the anterior angles not
mucronate but thickened, the surface impunctate, flavous; elytra
finely and closely punctured, with three transverse dark fulvous
bands—the first at the base, nearly extending to the middle and
notched at its anterior margin within the shoulders, the second
narrower band below the middle and immediately followed by a
triangular spot; neither of the bands extends to the lateral or
sutural margins, and they are sometimes tinged with an seneous
gloss; metatarsus very short, claw-joint strongly swollen.
Hab. Trinidad.
I possess four specimens of this species, which is of rather
small size, and may be known by the shape of the anterior elytral
band, which in all cases is notched at the base, and by the
position of the posterior bands, which sometimes form but a
single broad one.
OEDIONYCHIS DISSEPTA Erichs.
This is evidently a very variable species in size as well as in
the markings of the elytra. EHrichson has described two varieties,
but I have before me others. In the type the elytra have a
broad transverse, nearly black band at the base and another one
near the apex; this latter band is often reduced to an oval spot,
or may be absent altogether; in another form which I received
from Marcapata, Peru, together with typical specimens, the
thorax has two blackish spots at the middle; then there is a
third variety, in which the bands are very much broader and
only separated by a very narrow transverse flavous band at the
middle. No other structural differences are visible, in spite of a
very careful examination, nor do the male genitalia of these
varieties show any difference whatever. In all the specimens the
clypeus, thorax, and the lateral elytral margins remain flavous,
the punctuation is extremely fine, the sides of the thorax are
nearly straight and are produced anteriorly into a small tooth.
O. signifera Baly and O. 5-maculata Jac., likewise from Peru and
Bolivia, seem to be nothing but other varieties in which the
elytral markings are reduced to spots; they cannot otherwise be
30%
442 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
distinguished. M. Clavareau, of Brussels, has sent me specimens
obtained in the Province Huallaga, Peru, which again differ in
having the elytral band of a golden coppery tint and fulvous head
and antenne. I am, however, unable to see anything more in
these differences than one of colour.
OEDIONYCHIS IMPERIALIS, sp. 0.
Pale piceous below, the head, antenne, and thorax pale fulvous ;
elytra very closely and finely punctured, purplish-violaceous, the
lateral and apical margins and a narrow transverse band at the
middle flavous.
Length 9 millim.
Head flavous, impunctate; the frontal elevations broad, con-
tiguous; clypeus strongly raised into a triangular ridge, the
anterior edge of which is very prominent; antenne pale fulvous,
the third joint one-half shorter than the fourth (the terminal
two joints wanting); thorax more than twice as broad as long,
the lateral margins strongly rounded anteriorly, the anterior
angles thickened but not dentiform, the sides broadly flattened,
the surface minutely and rather closely punctured, pale flavous ;
scutellum obscure fulvous; elytra widened towards the middle,
convex, with narrow reflexed lateral margins, the shoulders
prominent, the surface extremely closely and finely punctured
throughout, purplish violaceous, a narrow straight transverse
band at the middle and the lateral and apical margins (the latter
slightly more widely so) flavous; under side and legs pale piceous.
Hab. Yurimaguas, Peru.
This species differs from O. steinheili Jac. (Proc. Zool. Soc. 1880,
p- 179) in the pale-coloured antennze, in the differently shaped
anterior angles of the thorax, and in the narrow and straight,
flavous band of the elytra; the larger size and colour of the
elytra separate the species from other nearly similarly marked
species, as well as from O. bifasciata Baly, which has also differently
coloured antenne and a black apex to the posterior femora.
OEDIONYCHIS OCCIPITALIS, Sp. n.
Testaceous, the base of the head and the terminal joints of the
antenne black; thorax impunctate; elytra microscopically punc-
tured, testaceous, a transverse band at the base connected at the
suture with another broad band below the middle, black; the breast,
abdomen, and the posterior tibize more or less piceous or black.
Var. a. The elytral bands not connected at the suture.
Var. b. Elytra with a spot near the scutellum and an elongate
larger spot below the middle, black.
Var. c. Elytra entirely testaceous.
Length 4—5 millim.
Head impunctate, black at the vertex, the lower portion
testaceous, frontal elevations broad, eyes large; antenne slender,
the lower four or five joints testaceous, the others piceous, third
1905. | OF PHYTOPHAGOUS COLEOPTERA. 443
and fourth joints equal; thorax scarcely more than twice as
broad as long, the sides with well-marked flattened margins,
feebly rounded, anterior angles not produced, the surface im-
punctate, testaceous ; scutellum piceous ; elytra visibly punctured
only when seen under a very strong lens, with narrow flattened
margins, testaceous, with two transverse nearly black bands, the
first at the base, of somewhat triangular shape, and connected at
the suture with another broader band below the middle, not
extending to the apex, neither of the bands extends quite to the
lateral margins; breast and abdomen black, legs testaceous,
Hab. Bolivia.
A small and very variable species, in which the nearly black
vertex of the head seems to be the only constant character so
far as coloration is concerned. The description is based on a
specimen in which the elytral bands are mostly developed ; the
elytra in this form may be described as black, with the lateral
and apical margins, as well as a slightly oblique transverse band
at the middle, testaceous, this band not extending to the suture ;
in this specimen the posterior tibiz and tarsi are black. In the
var. @ the dark bands are smaller and disconnected, and the
posterior one is in shape of an oblong patch on each elytron; in
var. 6 there is only a black spot near the scutellum and an elongate
larger one placed near the suture below the middle ; while in var. ¢
the elytra are entirely unspotted. In all these forms, however,
the base of the head and the underside remain black,
OEDIONYCHIS ZNEA, sp. n. (Clark, MS8.).
Fulvous ; thorax flavous, the sides broadly sulcate; elytra very
convex and strongly widened at the middle, minutely punctured,
a transverse band at the base and another one, narrowed at the
suture and not extending to either margin, violaceous blue.
Length 8 millim.
Head fulvous, impunctate, frontal elevations narrow and trans-
verse, carina acute, eyes not closely approached ; antennee with
the third joint much shorter than the fourth, fulvous (the other
joints wanting); thorax more than twice as broad as long, the
sides strongly rounded and broadly suleate, the anterior angles
slightly mucronate and strongly thickened, posterior margin
sinuate at each side, the disc impunctate, flavous; scutellum
fusco-viclaceous; elytra strongly widened and convex, flavous,
with a broad transverse band at the base not extending to the
lateral margins, of violaceous-blue colour, but more or less dark
fulvous when viewed sideways, another band, rather suddenly
widened at its outer end, is placed below the middle but does not
extend to either margin; the flavous portion separating these bands
is of about the same width as the bands themselves; breast and
the femora dark fulvous, tibie and tarsi flavous; metatarsus very
short, claw-joint strongly swollen.
Hab. Kiga, Amazon (Bates).
The description of this species is based on a specimen named
444 MR. MARTIN JACOBY ON NEW SPECIES [ Noy. 28,
by Clark, and formerly in the Baly collection. The colour of the
elytral bands, their shape, and the more than usually convex and
widened general shape of the insect, distinguish this species.
Whether O. jaculus MIllig. is identical with this or some other
similarly marked species I am unable to say, but Tliger’s
description of the shape of the elytral bands does not agree with
that of the insect before me.
OEDIONYCHIS REGINA, sp. n. (Plate XIV. fig. 12.)
Large and broad, black, the last two joints of the antenne pale
yellow ; thorax impunctate, flavous, with a large black transverse
band; elytra strongly and very closely punctured, metallic dark
green; the lateral margins and a transverse band below the
middle testaceous.
Length 10 millim.
Head bluish-black, impunctate, except near the eyes, the latter
with a flavous spot near the inner margins, widely separated ;
antenne slender, black, the last two joints pale flavous, third
joint slightly shorter than the fourth ; thorax rather more than
twice as broad as long, the sides broadly flattened, evenly rounded,
the anterior angles thickened, very slightly produced outwards,
the disc impunctate, black, the lateral and basal margins flavous ;
scutellum black; elytra widened below the middle, closely and
strongly rugose-punctate, metallic green, the lateral margins
narrowly and a slightly wider transverse band, immediately below
the middle, testaceous ; under side and legs black.
Hab. Espirito Santo, Brazil.
The black thoracie band which extends to the anterior margin,
the colour of the antenne, and the strongly punctured elytra well
distinguish this species from any other.
OEDIONYCHIS DIFFICILIS, sp. n. (Clark, MS8.).
Black, thorax flavous, impunctate ; elytra convex, widened
posteriorly, closely and finely punctured, flavous, a broad trans-
verse band at the base and another band below the middle, with
the lateral and posterior margins rounded, metallic blue, both
bands not extending to the margins.
Length 6-9 millim.
Head impunctate, black, two or three deep punctures are
placed near the eyes, frontal tubercles trigonate, nearly connected ;
antenne rather long, black, the base at their insertion flavous,
third and fourth joints nearly equal; thorax twice as broad as
long, the sides rounded anteriorly, the anterior angles produced
into a small tooth, the disc impunctate, flavous or fulvous ;
scutellum black; elytra widened towards the middle, convex,
finely and closely punctured, flavous, with two transverse dark
blue bands—the first at the base, of regular shape, with its
posterior edge straight and not quite extending to the middle,
the second band below the latter, its anterior margin straight,
but the lateral and apical margins rounded, the last-named some-
1905. | OF PHYTOPHAGOUS COLEOPTERA. 445
times slightly concave near the suture, both bands do not quite
extend to the lateral margins of the elytra; under side and legs
black, the apex of the abdomen sometimes more or less fulvous ;
prosternum longitudinally carinate at the middle.
Hab. Peru.
The characteristic feature of this species, by which it may
be principally distinguished from the many similarly coloured
ones, is the shape of the elytral blue posterior band, of which the
posterior edge is broadly rounded instead of straight; the flavous
band which separates the blue ones at the middle is generally, but
not always, of about the same width as that of the basal dark
band, sometimes broader. O. alacris Erich. and O. promta Erich.
are described with black not blue bands, and the former with
the head rufous, the other with a broad median flavous band ;
other details are not given. ‘The eight specimens before me show
no variation of any importance, but I may add that the posterior
elytral band is in all cases broader (in a longitudinal sense) than
the anterior one.
OEDIONYCHIS COLOMBIANA, Sp. Nn.
Black, the clypeus and the thorax flavous, the latter impunctate ;
elytra with a few punctures near the base, flavous, a broad band at
the base, another at the middle, and the extreme apex metallic
blue; abdomen fulvous.
Length 7 millim.
Head bluish black, impunctate, frontal elevations small, trans-
verse, clypeus flavous, carina short and thick; antenne with the
lower and the terminal three joints dark fulvous, the intermediate
ones piceous, third joint much shorter than the fourth; thorax
impunctate, flavous, the sides deeply sulcate, especially so near the
anterior angles which are thickened but not produced, near the
base is a very shallow transverse sulcation; scutellum black;
elytra extremely finely punctured, with some more distinct
punctures near the suture and within the shoulders, flavous, a
broad transverse band at the base, not extending downwards to
the middle nor to the lateral margins, another band immediately
below the middle but of more rounded shape, and the extreme
apex metallic blue; breast and legs black, the abdomen and the
tarsi more or less fulvous.
Hab. Colombia. (Collection H. Clavareau and my own.)
Closely allied to O. bipunctata Chev. (insularis Jac.), but the
head impunctate, the frontal elevations black, not flavous, and the
elytra extremely finely punctured, the posterior band broader,
not in shape of a round spot.
OEDIONYCHIS SUCCINCTA, sp. 1.
Black, antenne fulvous; thorax flavous, with an eneous short
band at the middle of the anterior margin; elytra flavous, a
broad transverse band at the base and another below the middle
black, nearly impunctate.
446 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
Length 63 millim.
Head impunctate, the vertex black, the clypeus flavous, frontal
elevations scarcely indicated, eyes widely separated, labrum and
palpi flavous; antennz fulvous, the first jomt piceous above,
third joint shorter than the fourth; thorax strongly transverse,
the sides strongly rounded, the anterior angles very prominent
and pointed, the lateral sulci narrow, somewhat interrupted
anteriorly, not well separated from the discoidal portion, the
surface impunctate, flavous, with a transverse short black band
at the middle of the anterior margin; elytra with narrowly
reflexed margins, extremely minutely punctured when seen
under a strong lens, flavous, with two broad transverse black
bands, one at the base, the other below the middle, the latter
band shorter than the basal one (in a longitudinal sense), neither
band extends to the lateral margins and the flavous | space
separating them is narrow and perfectly regular in shape; below
and the legs black.
Hab. Bolivia.
The thoracic spot or band placed at the middle of the anterior
margin and the regular shape and black colour of the elytral
bands distinguish this species, of which I know only a single
specimen.
OEDIONYCHTS WEISEI, Sp. Nh.
Flavous, the base of the head, the antenne, and the breast and
legs black; thorax impunctate; elytra finely and closely punctured,
the basal margin and a transverse narrow band below the middle
dark metallic blue.
Length 8 millim.
Head with a few fine punctures, black, the clypeus flavous; eyes
large, the diameter of each as wide as the intermediate space ;
frontal elevations oblique, strongly raised, bounded by a deep
fovea behind ; antenne scarcely extending to the middie of the
elytra, black, the third and fourth joints equal; thorax twice as
broad as long, somewhat narrowed anteriorly, the lateral margins
strongly rounded, the anterior angles distinctly produced into
a tooth, the sides deeply sulcate, the surface impunctate, except
when seen under a very strong lens, when some minute punctures
are visible, flavous; scutellum black; elytra convex, elongate, but
slightly widened at the middle, very finely and closely punctured,
the extreme base as far as the shoulders and a narrow band below
the middle, not quite extending to the lateral margins, violaceous
blue ; below and the legs black, abdomen fulvous.
Hab. Colombia.
Much larger than O. colombiana; the bands of the elytra blue,
the spot near the scutellum absent, and the thorax of entirely
different shape; the legs black.
OEDIONYCHIS SELECTA, sp. 1.
Pale fulvous; elytra extremely minutely and closely punctured,
1905. | OF PHYTOPHAGOUS COLEOPTERA. 447
a broad transverse band at the base and another below the middle,
connected at the suture, metallic green.
Length 9 millim.
Head fulvous, with a few punctures near the eyes, the clypeus
with a strongly raised, central carina, eyes large; antenne long
and slender, third joint shorter than the fourth; thorax more
than twice as broad as long, the sides strongly rounded, broadly
flattened; the disc very convex, very minutely punctured when
seen under a strong lens, fulvous; scutellum broad, fulvous ;
elytra convex, scarcely widened at the middle, with a shallow
transverse depression below the base, extremely finely punctured,
the punctures of different sizes, with two very broad, transverse,
metallic green bands, the first at the base not extending to the
margins but nearly to the middle, the second band immediately
below the latter, of nearly the same width and not extending to
the apex; these bands are therefore separated by a narrow trans-
verse and straight band of the ground-colour which does not quite
extend to the suture and rounded at its inner termination ;
under side and legs fulvous.
Hab. Amazons.
Of more parallel shape than O. enea, and distinguished from
that and other similarly marked species by the bright metallic-green
bands of the elytra, separated at the middle by a straight narrow
fulvous band which does not extend quite to the suture; in
O. bipartita, which has similarly coloured metallic bands, these are
divided before and below the middle.
OEDIONYCHIS CARDINALIS, sp. n. (Clark, MS.).
Piceous, head and thorax flavous, the latter narrowed in front ;
elytra microscopically punctured, flavous, a broad transverse band
at the base and another of more rounded shape below the middle,
violaceous blue.
Length 10 millim.
The principal differences which separate this species from
many similarly coloured forms are to be found in the large
general size, anteriorly narrowed thorax, and the shape of the
elytral bands; the eyes are well separated, and the head is
sparingly and finely punctured; the frontal elevations and the
carina are proportionately broad ; the antenne have very slender
and elongate joints, the lower three are fulvous, the rest black
(in the British Museum specimen, named by Clark, the antennz
are entirely fulvous). The thorax is less transverse than in many
other species, distinctly narrowed anteriorly, with strongly rounded
sides, the anterior angles are blunt above, but have a short pro-
jection below the margin in front of the eyes; the lateral sulci
are rather broad and shallow; the scutellum is flavous; the
punctuation of the elytra can only be seen with a very strong lens ;
of the blue elytral bands, the first extends nearly to the middle
and has its posterior margin straight or nearly so, in the second
band the anterior and posterior margins are rounded, so that the
448 MR. MARTIN JACOBY ON NEW SPECIES [Nov. 28,
flavous portion separating both bands is slightly widened at the
suture, the extreme lateral margins and a small triangular space
at the apex are of the ground-colour; the under side and legs
are dark fulvous or piceous, and the posterior femora have the
apex broadly stained with blackish. O. steinheili Jac. is a much
broader insect with a differently shaped thorax.
Hab. Amazons.
OEDIONYCHIS FULVOTIBIALIS, Sp. Nn.
Obscure piceous below, the clypeus, antenne, and the tibize
more or less fulvous; thorax flavous, impunctate; elytra closely
and finely punctured, metallic greenish, the lateral margins and a
narrow transverse band at the middle flavous.
Length 53 millim.
Head at the vertex and the frontal elevations greenish,
impunctate, a narrow space round the eyes and the clypeus and
labrum flavous, frontal elevations subquadrate ; eyes large, with a
rather deep, punctured sulcus near the inner margins; carina
short and blunt; antenne fulvous, the third joint slightly shorter
than the fourth ; thorax strongly transverse, the lateral margins
straight at the base, rounded in front, the sides deeply flattened,
anterior angles not prominent but thickened, the disc impunctate,
flavous ; scutellum black; elytra slightly widened at the middle,
very finely punctured except within the shoulders, where there is
a short row of deeper punctures, the lateral margins and a narrow
transverse band at the middle flavous, rest of the surface metallic
dark green, this colour forming two subquadrate patches on each
elytron which extend across the suture; below and the legs piceous,
the apex of the posterior femora and the tibie and tarsi more
or less fulvous ; the metatarsus very short.
Hab. Bolivia.
A rather small species, and at once distinguished by the colour
of the antenne and tibie.
Hlytra with longitudinal bands.
OEDIONYCHIS VITTATIPENNIS, Sp. nh.
Broad and elongate, flavous; apical joints of the antenne black ;
thorax strongly transverse, impunctate; elytra very finely and
extremely closely punctured, flavous, the suture, a subsutural
and a submarginal longitudinal stripe, connected at the apex,
ferrugineous.
Length 10 millim. :
Head impunctate, flavous, eyes large, frontal elevations strongly
raised, trigonate; antenne filiform and slender, black, the lower
three or four joints testaceous, third and fourth joints equal;
thorax twice as broad as long, the sides rounded, broadly flattened,
the anterior angles produced into a small tooth, the surface
impunctate, flavous; elytra with very close and fine but distinct
punctuation, the suture very narrowly and two longitudinal
broader stripes, of which one is placed near the suture,
1905. | OF PHYTOPHAGOUS COLEOPTERA. 449
the other near the margin, reddish-fulvous, these stripes are
united at the apex but do not extend to that portion of the elytra ;
under side and legs pale flavous.
fab. Brazil.
Of this large species three specimens are contained in my
collection. Amongst the longitudinally banded species described
by von Harold in the Berl. ent. Zeit. 1881, there is none which can
be compared in size with this species, and all similarly coloured
forms have but one elytral stripe instead of two. O. teniolata
Har. has the eyes widely separated, a small thorax, and narrow
elytral epipleure, and is much smaller,
OEDIONYCHIS ADJUNCTA, sp. n. (Plate XV. fig. 12.)
Black; thorax impunctate, the margins flavous; elytra im-
punctate, a subsutural vitta, the lateral margins, and a short
transverse band near the apex, connecting the stripes, flavous.
Length 53 millim.
Head broad, black, closely and strongly punctured in front of
the eyes, the latter small, very widely separated; antennze very
short, the joints moniliform ; thorax twice as broad as long, the
lateral margins strongly thickened, narrowly sulcate in front, the
anterior angles thickened, slightly produced, the disc impunctate,
black, all the margins narrowly flavous ; scutellum black; elytra
without any perceptible punctuation, black, with the lateral
margins and a narrow longitudinal stripe at the disc flavous; this
stripe extends from the middle of the base to the apex and
approaches slightly. the suture below the middle, near the apex it
is connected with the flavous margin by another oblique transverse
thin stripe ; below and the legs black.
Hab. Bolivia.
Amongst the species with pale longitudinal stripes, the present
one seems most nearly allied to O. haagi Har. im colour and
pattern, but differs in the entirely impunctate thorax and
elytra.
OEDIONYCHIS DONCKIERI, sp. Nn.
Elongate and parallel, the head fulvous; antennz and breast
more or less black; thorax flavous, impunctate; elytra finely
punctured, obscure flavous, a sutural and a discoidal longitudinal
band black; legs dark fulvous.
Length 7 millim.
Head rugosely punctured above the eyes, fulvous; frontal
elevations strongly raised, broadly trigonate ; clypeus short and
broadly convex between the antenne ; the latter robust, extending
to the middle of the elytra, black, the basal two joints piceous,
third and fourth equal, the terminal joints more elongate; thorax
rather more than twice as broad as long, not or scarcely narrowed
in front, the sides rounded, with a well-marked sulcus, the
anterior angles acute but not produced, the disc transversely
grooved near the base, impunctate, flavous, rather opaque
450 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
scutellum black; elytra of elongate shape, minutely and obsoletely
punctured, flavous ; the suture and a discoidal longitudinal stripe,
both abbreviated near the apex, black; under side obscure blackish,
the legs dark fulvous, the tibie rather darker, prosternum pale.
Hab. Tasco, Mexico.
Of this species, one of the most elongated of the genus, I
received a single specimen from M. Donckier of Paris; the
elytral sutural stripe is of narrower shape than the discoidal one.
Elytra blue or black, with flavous lateral and apical margins.
OEDIONYCHIS CINCTIPENNIS, sp. nh.
The head, breast, and legs black; thorax fulvous, impunctate ;
elytra convex, widened posteriorly, metallic blue, closely and
distinctly punctured, the lateral and apical margins fulvous;
abdomen partly flavous.
Length 7 millim.
Strongly convex and widened posteriorly; the head black with
bluish gloss, with a few punctures near the eyes; antennz black,
the lower three joints fulvous below, third and fourth joints equal ;
thorax with the lateral margins strongly rounded anteriorly, the
sides broadly flattened, the dise convex, impunctate, fulvous ;
scutellum black; elytra widened below the middle, with a short
but deep depression within the shoulders, very closely and rather
strongly punctured, metallic blue, the lateral margins narrowly
and the apex rather more broadly so, fulvous; under side and legs
black, the sides of the abdomen more or less fulvous or flavous.
Hab. Peru.
From other similarly coloured species, the present one is dis-
tinguished by the posteriorly widened shape and the distinct and
close punctuation of the elytra; the latter have in some specimens
a very small fulvous spot placed near the suture at the middle,
the fulvous margin widens slightly and gradually near the apex,
the latter part is also entire, not serrulate as in O. sagulata
Krichs.
OEDIONYCHIS PALLIDICINCTA, Sp. Nn.
Obscure piceous below, the thorax and legs flavous; tibiz and
tarsi and the apex of the posterior femora black ; thorax impunc-
tate; elytra black, entirely impunctate, the extreme lateral and
the apical margins more broadly, flavous.
Length 53 millim.
Of rather flattened shape; the head nearly black, impunctate,
deeply transversely grooved between the eyes, the latter very
large, frontal elevations broad, transverse; antenne rather
robust, black, the lower two joints and the last one fulvous,
third and fourth joints equal; thorax twice as broad as long, the
sides rather rounded, deeply suleate, with strongly reflexed and
thickened margins, the anterior angles not produced, the surface
1905. | OF PHYTOPHAGOUS COLEOPTERA. 451
impunctate, flavous; scutellum black; elytra shining, black or
nearly so, impunctate, the extreme lateral margins and epipleurse
and the apex more broadly flavous ; femora flavous ; the under side,
tibiz and tarsi piceous, the apex of the posterior femora black.
Hab. Espirito Santo, Brazil.
A rather small species, not difficult to distinguish, of which I
possess two specimens.
OEDIONYCHIS SEMIFOVEOLATA, sp. n. (Plate XV. fig. 5.)
Black, the thorax and abdomen flavous ; elytra dark purplish,
the dise with longitudinal rows of elongate fovee, the sides
narrowly and the apex broadly flavous.
Length 9 millim.
Head black, impunctate, frontal elevations rather broad ;
carina acute, black, clypeus flavous at the sides; antenne black,
the basal joint flavous below, third joint shorter than the fourth ;
thorax more than twice as broad as long, narrowed anteriorly, the
sides rounded, with a broad, flattened margin, the anterior angles
produced into a tooth, the surface convex, 1mpunctate; scutellum
black ; elytra dark metallic purplish, margined at the sides and
apex with flavous, at the first named place narrowly so, at the
latter suddenly widened into a broad band the anterior edge of
which is quite straight, the disc impressed with distant, elongate
and partly round greenish fovee, which are placed in rows,
interstices entirely impunctate; under side and legs black, abdomen
flavous.
Hab. Venezuela.
Closely allied to O. porosa Baly, but the elytra of different
sculpture, the fovez isolated and placed in rows, and the abdomen
flavous. A single specimen is contained in my collection.
Jn Duvivier’s Catalogue O. porosa Baly is given as a synonym
of O. variolosa Harold, but this requires confirmation, since the
size of Baly’s species is from 33-4 millim., while Harold gives
11 millim as the length; Duvivier, moreover, has only given a
short diagnosis, which in these closely allied and numerous groups
of insects is quite useless.
OEDIONYCHIS PRETIOSA Baly.
The locality of this species as given by the author is Brazil, not
Siam as stated in Duvivier’s Catalogue, 1885.
OEDIONYCHIS CUBANA Harold.
Coleopter. Hefte, xiii. p. 90: Cuba.
This species is not mentioned in any of the Catalogues.
OEDIONYCHIS FLAVOMARGINATA, sp. n. (Plate XV. fig. 9.)
Black, thorax impunctate, the sides broadly flavous ; elytra
convex, finely and closely punctured, black, the lateral margins
narrowly and the apex more broadly flavous.
Length 6-7 millim.
452 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
Head with some punctures at the vertex, black, the eyes more
or less margined with flavous within and with some distinct
punctures ; antenne not extending to the middle of the elytra,
black, third and fourth joints equal; thorax scarcely twice as
broad as long, the lateral margins straight at the base, rounded in
front, the anterior angles produced into a tooth, the sides broadly
flattened, flavous, the middle of the dise in shape of an anteriorly
narrowed broad band, black, impunctate; elytra rather broad,
very closely and finely but distinctly punctured, black, the later. al
margins narrowly flavous, this colour widened at the apex into a
spot which does not quite mien’ to the suture; under sideand legs
black or piceous.
Hab. Espivito Santo, Brazil.
Distinct in its coloration from any other species of the genus
known to me; two specimens are before me.
Llytra pale, with small black spots.
OEDIONYCHIS BIPUNCTULATA, Sp. N.
Testaceous above, the under side and legs darker; thorax
impunctate, with broadly flattened sides; scutellum piceous;
elytra very finely and closely punctured, each with a small black
spot below the middle.
Length 6 millim.
Vertex of the head stained with piceous, with a central groove
and bilobed in front, frontal tubercles short and broad; clypeus
convex ; antennze with the lower three joints flavous, the follow-
ing four black, the rest wanting ; thorax strongly transverse, of
very even width, the sides straight at the base, rounded anteriorly,
broadly flattened, anterior angles thickened, oblique but scarcely
produced outwards, the disc impunctate, testaceous, obsoletely
depressed in front of the scutellum, the latter triangular, nearly
black; elytra strongly convex, nearly parallel, with a short row of
deeper punctures within the shoulders, the rest very finely and
closely punctured, below the middle a small black spot is placed,
halfway between the lateral and sutural margins ; under side and
femora fulvous; prosternum narrowly elongate, rather convex.
Hab, Prov. Tucuman, Argentine Rep. (0. Bruch).
In the markings of the elytra and general coloration this species
resembles O. complanata Suff., from Ghuiba, but the latter is smaller,
much more depressed in shape, and has impunctate elytra.
OEDIONYCHIS TRILOBA, sp. 0.
Hlongate, testaceous ; head and thorax impunctate, the latter
with two trilobed black spots; elytra not perceptibly punctured,
each elytron with three black spots, two at the base and one at the
middle, the extreme sutural margins from the middle to the apex
black.
Length 6 millim.
1905. | OF PHYfOPHAGOUS COLEOPTERA. 453
Head impunctate, frontal elevations broad, well marked, carina
very convex and prominent, eyes very large; thorax twice as
broad as long, the sides broadly flattened, the lateral margins
rather rounded near the base, gradually narrowed anteriorly,
anterior angles produced into a small tooth, the surface impunctate,
with a transverse depression at the sides near the base, testaceous,
the sides with a trilobate black spot, the middle lobe pointed
upwards; elytra nearly parallel, with a feeble depression below the
base, impunctate, a round black spot on the shoulders, another
near the scutellum, and a third spot of transverse shape at the
middle, as well as the sutural margins from below the base to the
apex, black; under side and legs testaceous.
Hab. Peru.
I know only a single specimen of this species and am not aware
therefore if the markings of the elytra are subject to variation,
which is probably the case. The species has the frontal carina,
however, much more strongly raised than most of its allies, the
elytral spots are comparatively large and deep black; this and
the similarly coloured suture will assist in the recognition of the
species.
OEDIONYCHIS BASINOTATA, sp.n. (Plate XV. fig. 4.)
Piceous, the base of the head and a transverse band at the
thorax bluish-black; elytra strongly and closely punctured, with
four black spots, placed obliquely at the base in a semicrescent.
Length 6 millim.
Head strongly punctured near the eyes, fulvous, the vertex
bluish-black, frontal elevations robust, oblique, carina short and
broad ; eyes large, each as broad as the dividing space; antenne
scarcely extending to the middle of the elytra, black, the lower
three joints more or less flavous below, third joint thinner but as
long as the fourth; thorax twice as broad as long, the lateral
margins straight at the base, rounded anteriorly, the anterior
angles produced into a strong tooth, the sides deeply suleate and
flattened, surface with a few minute punctures, the entire disc
bluish-black, the margins fulvous; scutellum black; elytra not
depressed below the base and scarcely so within the shoulders,
closely and strongly punctured, each with two bluish-black spots
at the base placed transversely, the outer one transverse, the
inner of more elongate shape; below and the legs nearly black ;
metasternum raised anteriorly.
Hab, Paraguay.
This beetle differs in the markings of the elytra from any other
described species.
OEDIONYCHIS MACULATISSIMA, Sp. Nn.
Ovate, convex, dark fulvous below, vertex of head piceous;
antenne and thorax fulvous, the latter with two transverse, black
spots; elytra rather strongly punctured, pale fulvous, with ten
spots each (3.3.2.2).
A454 MR. MARTIN JACOBY ON NEW SPECIES Noy. 28
?
Var. Thorax without spots; elytra greenish-black, the sides
and apex rather broadly fulvous.
Length 6 millim.
Of rather short, broadly ovate and convex shape, the head with
a few punctures near the eyes, the latter large, each as wide as the
intermediate space, the vertex piceous, lower portion fulvous,
frontal tubercles narrowly transverse; antenne extending to the
middle of the elytra, fulvous, the third and fourth joints verynearly
equal, following joints rather stout and not longer than the fourth ;
thorax more than twice as broad as long, of equal width, the sides
rounded anteriorly, straight at the base, anterior angles prominent
with a small tooth, lateral sulci deep and broad, the surface
impunctate, fulvous, with a short transverse black band or spot at
each side; elytra narrowly margined, rather strongly punctured,
fulvous, each with ten black spots, of which three are placed
transversely at the base, three below these before the middle, two
larger ones nearly connected below the middle, and two others well
separated near the apex, there is also another obscure spot placed
at the apex on the suture; under side and legs dark fulvous ;
metatarsus of posterior legs very short, claw-joint strongly swollen.
Hab.. Bolivia.
T cannot identify this species with O. fenestrata Har., to which
it is no doubt closely allied. Von Harold, who gives no details in
regard to the shape of the thorax, describes his species as having
black antenne and under side, as well as similarly coloured legs
and the elytra with 9 spots only; the thorax also is said to have a
single band, not two spots, and the third joint of the antenne to be
distinctly shorter than the fourth: none of these details applies
to the present insect. The variety, which at first sight entirely
differs in coloration, agrees in every structural detail and also in
the colour of the antenne and under side; there is also a widening
of the fulvous band at the sides corresponding with the fulvous
space which separates the spots as in the type, and the greenish-
black colour likewise is the same in the spotted form, although
which of the two may be looked upon as the type is optional.
OEDIONYCHIS DUODECIMNOTATA (Clark, MS.), sp.n. (Plate XIV.
sme, ht) :
Testaceous, the terminal joints of the antennz black; the head
and thorax with two black spots, closely punctured ; elytra very
closely and strongly punctured, the basal margin and five spots on
each elytron black ; under side black, legs testaceous.
Length 10 millim.
Head with a few deep punctures, flavous, shining, the vertex
with two black spots, frontal tubercles bounded behind by a deep
groove, labrum black; antennz slender, testaceous, the terminal
six joints black; thorax with strongly produced anterior angles,
the lateral margins feebly rounded, the dise broadly flattened at
the sides, closely and distinctly punctured, testaceous, with a large
black spot at each side; scutellum black; elytra very broad and
1905. ] OF PHYTOPHAGOUS COLEOPTERA. 455
rather flattened, evenly, closely, and strongly punctured, the basal
margin very narrowly and five spots on each elytron black: of
these, one of transverse shape is placed before the middle, two
obliquely below the middle, and two others near the apical margin ;
breast and abdomen black, the last segment and the legs testaceous,
the posterior femora with a black spot at the apex.
Hab. Brazil.
Allied to O. nigromaculata Sturm, but differing in the black
basal elytral margin and the different position of the spots, also
in the colour of the antenne.
OEDIONYCHIS PERSIMILIS, sp. n.
Elongate, testaceous; thorax impunctate, the anterior angles
mucronate ; scutellum black; elytra not perceptibly punctured,
with five black small spots on each (1.2.1.1).
Length 6 millim.
Head impunctate, the eyes rather widely separated, frontal
tubercles broadly subquadrate, carina short and rather blunt ;
antenne scarcely reaching to the middle of the elytra, testaceous,
the third and following joints nearly equal; thorax more than
twice as broad as long, the sides rounded, the anterior angles
slightly produced outwards into a small tooth, the lateral sulci
deep, the surface impunctate, obsoletely depressed in front of the
seutellum, the latter black; elytra obscure testaceous, each with
five small black spots, of which one is placed on the shoulders, two
before the middle obliquely, the inner one near the suture, the
fourth spot below the middle near the lateral margin, and the fifth
below the sutural spot at some distance from the apex; under side
and legs testaceous, the posterior femora with a black spot at the
upper edge.
Hab. Chilpancingo, Mexico.
Of more elongate shape than QO. 13-maculata, and with five
spots on each elytron, the spots small and placed rather differently.
Both specimens before me are of a very dull obscure testaceous
colour in regard to the elytra, but this may be due to discoloration.
O. atroguttata Jac., from the same locality, is a closely allied species,
but it differs in the shape of the thorax, as well as in the position
of the elytral basal spots and their number.
OEDIONYCHIS SUBDILATATA, Sp. 0.
Ovate, medially widened, black; head and antennz piceous;
thorax pale testaceous or whitish, narrowed anteriorly, impunctate;
elytra broadly margined, impunctate, testaceous, an obscure trans-
verse band at the base, with two black spots and another below the
middle with another larger spot, obscure fulvous.
Length 6-7 millim.
Head impunctate, the vertex black or piceous, frontal elevations
narrowly transverse, eyes rather large; antennz piceous or dark
fulvous, the third and fourth joints equal; thorax with distinctly
rounded sides, gradually narrowed anteriorly, the angles rather
Proc. Zoo. Soc.—1905, Vou. II. No. XXXT. 31
456 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
strongly produced, the sides broadly sulcate, the surface im-
punctate, whitish-testaceous; scutellum black; elytra widened
towards the middle, rather broadly margined, especially so at
their greatest width, not perceptibly punctured, with two broad,
transverse, sometimes very obscure dark bands—one at the base,
containing two black spots, of which one is placed on the shoulders,
the other near the scutellum, the second band below the middle,
thin which a single larger subtriangular black spot is placed ;
der side and legs black ; metatarsus of the posterior legs rather
shorter than the following two joints together ; claw-joint strongly
swollen.
Hab. Bolivia.
The ground-colour of the elytra is but little lighter than the
bands, except when these are well marked: in this case there 1s
only the single spot visible near the scutellum—that is, in a
specimen before me ; in the others the black spots are well marked,
but the bands are obscure.
OEDIONYCHIS ATROPUNCTATA, Sp. Nn.
Testaceous, the breast more or less black; thorax impunctate,
the sides broadly flattened ; elytra finely and closely punctured,
each with five black spots (2.1.2).
Length 5-6 millim.
Head impunctate, with a deep triangular fovea between the
eyes, the latter large, rather closely approached ; frontal elevations
contiguous, distinct; antennz flavous, the 6th, /th, and 8th
joints more or less piceous, 3rd and 4th joints equal; thorax
with broadly flattened sides, the lateral margins rather evenly
rounded, the posterior angles produced into a small tooth, the
surface impunctate; elytra with rather broadly flattened margins,
finely but distinctly and closely punctured ; a spot on the shoulders,
one near the scutellum, a third at the middle, and two others
placed transversely near the apex, black ; under side (the black
breast excepted) and the legs testaceous; last abdominal segment
of the male rather deeply sinuate at each side.
Hab. Brazil.
The number and position of the elytral spots distinguish this
species, of which I received a specimen from Mr. C. Bruch, of the
La Plata Museum; two others I subsequently obtained from
M. Clavareau, who likewise got them from the same gentleman,
without indication of a more exact locality.
OEDIONYCHIS ARGENTINENSIS, sp. hh.
Black; above testaceous, the apical joints of the antennz
fuscous, the knees and the tarsi black; thorax impunctate; elytra
finely punctured, somewhat flattened, each elytron with six small
black spots (2.2.2) placed transversely, the last two pairs oblique.
Length 43-5 millim.
1905. | OF PHYTOPHAGOUS COLEOPTERA. 457
Head entirely impunctate, broad, the eyes small and round ;
frontal elevations strongly raised, subquadrate ; labrum piceous ;
antenne long and slender, the lower four joints pale, the others
piceous, third and fourth joints elongate, equal, terminal joints
shorter, robust and thickened; thorax about twice as broad
as long, the sides broadly flattened, posterior margin perfectly
straight, the surface impunctate, testaceous; elytra finely and
closely punctured—of the spots, two are placed transversely at the
base, one on the shoulders, the other near the scutellum, two at
the middle, with the outer one lower than the other, and two of
exactly similar position near the apex; breast and abdomen, as
well as the knees of all the legs and the tarsi, black; claws
strongly swollen.
Hab. Buenos Ayres.
This is another of the small black-spotted species, of which
I received two specimens from Mr. C. Bruch, of the La Plata
Museum ; the position and number of the spots and the colour of
the legs separate the species from O. atropwnctata and others.
OEDIONYCHIS NIGROPUNCTATA, Sp. N.
Black, the sides of the thorax broadly testaceous, the surface
impunctate; elytra extremely minutely punctured, testaceous,
the sutural margins, three small spots at the base, a spot near the
suture at the middle, and another below the latter, of each
elytron black.
Length 7 millim.
Of posteriorly slightly widened shape; the head with a few
punctures at the vertex, the latter black; the space in front
of the eyes testaceous, these widely separated; frontal ele-
vations indistinct; clypeus triangularly pointed between the
antenne; labrum obscure testaceous; antenne extending just
below the base of the elytra, black, the third joint slightly shorter
than the fourth, this and the following joints robust and propor-
tionately short, subquadrately cylindrical ; thorax twice as broad
as long, the lateral margins strongly rounded, the anterior angles
produced forwards, the sides broadly sulcate, the disc impunctate,
black, in shape of a transverse irregular band, the sides broadly
testaceous ; scutellum black; elytra extremely minutely and
closely punctured, testaceous, with three small black spots placed
on the basal margin (one at the shoulders and two at the middle)
and another larger subsutural spot immediately before, as well as
a smaller one below, the middle of each elytron; besides these
spots, the dise is stained with irregular fuscous patches, which
are specially pronounced near the suture ; under side and legs
black.
Hab. Bolivia.
A rather peculiarly marked species, of which I know only a
single specimen. The elytral fuscous patches are probably due to
discoloration.
31*
458 MR. MARTIN JACOBY ON NEW SPECIES [ Nov. 28,
OEDIONYCHIS TORQUATA, Sp. 0.
Testaceous, the terminal joints of the antennze and the breast
piceous; head strongly punctured; thorax impunctate ; elytra
distinctly punctured, with three small black spots, two at the base
and one at the middle of each elytron.
Length 6 millim.
Rather flattened above, the head very strongly and deeply
punctured; frontal elevations transverse, strongly raised, nearly
contiguous; carina short and rather broad; antennee testaceous,
the terminal joints more or less piceous, third and fourth joints
equal, apical joints shorter; thorax twice as broad as long, the
sides rounded and broadly flattened, anterior angles not produced
outwards, the surface impunctate, obsoletely transversely grooved
at each side near the base; elytra slightly widened towards the
middle, very closely and distinctly punctured at the base, rather
more finely so below the middle, the spots placed as in O. hume-
ralis Fab., one at the shoulders, one near the scutellum, and the
third of oblique shape at the middle; the breast nearly black;
legs testaceous, as well as the abdomen.
Hab. Brazil.
I must separate this species from O. hwmeralis Fab., O. 4-punctata
Schauf., and several others with nearly similar elytral markings, on
account of the strongly punctured head and the black breast; the
eyes are moderately large and widely separated.
OEDIONYCHIS DECORA, Sp. Nn.
Narrow and subdepressed, testaceous ; antennz black, the basal
and the terminal three joints pale; thorax impunctate, the anterior
and posterior margins fuscous at the middle; elytra nearly im-
punctate, each with two basal elongate spots, a transverse band at
the middle, and another spot near the apex, fuscous.
Length 5-6 millim.
Head impunctate, testaceous or pale fuscous; eyes very large;
frontal tubercles trigonate, nearly joined; antenne scarcely
extending to the middle of the elytra, black, the basal joint
testaceous, the terminal three joints obscure flavous, third and
following joints equal; thorax flattened, rather more than twice as
broad as long, the sides rounded, broadly flattened, the base (in
one specimen) with an obsolete transverse groove, the dise im-
punctate, testaceous, the anterior and posterior margins fuscous at
the middle, anterior angles acute but scarcely produced ; elytra
not perceptibly punctured, testaceous, with four fuscous or piceous
marks—an elongate one on the humeral callus, a rounded spot near
the scutellum, a short transverse band at the middle, and another
larger rounded spot near the apex; under side and legs testaceous.
Hab. Amazons; also Peru.
IT may add that the suture of the elytra is sometimes also
narrowly marked with fuscous, and that the central band has
a short and narrow stripe attached to its outer end, pointing
downwards. P,
1905.] OF PHYTOPHAGOUS COLEOPTERA. 459
Llytra otherwise marked.
OEDIONYCHIS BICOLORATA, Sp. 0.
Testaceous ; the head, antenne, breast, and the legs black ;
thorax impunctate, the anterior angles produced ; elytra extremely
minutely punctured, the anterior two-thirds metallic greenish-
reneous, the rest testaceous.
Length 7 millim.
Head with some fine punctures at the vertex, the frontal
elevations pyriform ; clypeus flavous, strongly transversely raised ;
antennee black, the basal jomt elongate, strongly widened ante-
riorly, third joint shorter than the fourth ; thorax rather strongly
narrowed anteriorly, the sides nearly straight, the anterior angles
much produced and pointed, the sides broadly flattened, the surface
impunctate, testaceous; scutellum black; elytra very feebly de-
pressed below the base, very minutely and closely punctured, the
anterior portion to below the middle metallic greenish, this colour
not quite extending to the lateral margins and divided by a straight
line from the apical testaceous portion ; the breast and legs black ;
the abdomen testaceous.
Hab. Baiios, Ecuador.
This is a peculiarly marked species, of which I know only a
single specimen. The thorax has the sides less rounded than
is usually the case and the angles much produced; these differ-
ences distinguish the species from O. bolivianus Jac., previously
described, which must find its place in Asphera, as the metatarsus
of the hind legs is decidedly elongate; otherwise the coloration of
the elytra nearly resembles that of the present species, except that
the metallic colour of the latter occupies only the anterior half of
the elytra.
OEDIONYCHIS NIGROBASALIS, Sp. 0.
Testaceous, the intermediate joints of the antenne black; thorax
impunctate ; elytra very finely punctured, a transverse band at the
base and another one near the apex fulvous, the extreme basal
margin black.
Length 7-8 millim.
Head impunctate, testaceous or pale fulvous; eyes very large,
rather closely approached ; antennz with the four basal and the
two apical joints testaceous, the others black, third and fourth
joints equal ; thorax with very broadly flattened sides, the lateral
margins rounded, the anterior angles produced outwards into
a small tooth, the surface entirely impunctate, testaceous; scu-
tellum blackish at the base; elytra testaceous, with a transverse
fulvous band at the base; this band is concave at its posterior
edge and extends generally downwards in a narrow stripe along
the suture, where it is connected with another broad transverse
band near the apex, neither of them extends to the lateral margins,
and the posterior band is sometimes reduced to a round spot ;
460 ON NEW SPECIES OF PHYTOPHAGOUS COLEOPTERA. [Nov. 28,
under side and legs testaceous ; the extreme basal margin of the
elytra black.
Hab. Rio Janeiro.
This species is principally distinguished by the narrow black
base of the elytra, which extends to the shoulders and limits the
fulvous band anteriorly. The colour of the antenne will further
assist in the recognition of the insect.
OEDIONYCHIS PROMINULA, sp. un. (Plate XV. fig. 1.)
Ovately widened posteriorly, black, the apical two joints of the
antenne fulvous; thorax impunctate, narrowed anteriorly ; elytra
finely punctured, pale fulvous, the apical third portion black.
Length 6 millim.
Head impunctate, with the exception of a single puncture near
the eyes, black ; the eyes are very large and prominent ; frontal ele-
vations strongly raised, rather broad ; antenne long and slender,
black, the apical two joints fulvous, third joint shorter than the
fourth ; thorax twice as broad as long, the lateral margins rounded,
the anterior angles thickened and produced into a small tooth, the
sides broadly suleate, the sulcus connected at the base with another
shallow transverse groove extending across the disc and close to
the basal margin, the rest of the surface impunctate, black, very
shining; seutellum black; elytra widened towards the middle,
rather broadly margined, minutely and closely punctured, the
anterior two-thirds flavous, the rest black; under side and legs
black; metatarsus short, claw-joint strongly swollen ; prosternum
deeply longitudinally suleate.
Hab. Peru.
Distinguished by the black head, thorax, and under side, and the
short and posteriorly rather widened shape of the elytra.
EXPLANATION OF THE PLATES.
Puate XIV.
Fig. 1. Homopheta angustolineata, | Fig. 7. Asphera zonulata, p. 404.
p. 591. | 8. A. tessellata, p. 416.
2. H. peruviana, p. 399. | 9. A. divisa, p. 418.
3. H. argus, p. 591. | 10. A. tarsata, p. 402.
4. Asphera albicincta, p. 409. | 11. Oedionychis duodecimnotata,
5. A. nitidissima, p. 415. p. 454.
6. A. elegantula, p. 412. | 12. O. regina, p. 444.
PuatE XV.
Fig. 1. Oedionychis prominula, p. 460. Fig. 8. Oedionychis bisbinotata,
2. O. centromaculata, p. 431. p. 428.
3. O. exclamationis, p. 436. 9. O. flavomarginata, p. 451.
4. O. basinotata, p. 453. 10. O. ocellata, p. 434.
5. O. semifoveolata, p. 451. 11. O. illustris, p. 440.
6. O. interrupto-vittata, p. 436. | 12. O. adjuncta, p. 449.
7. O. arcuatofasciata, p. 431. |
1905. ] ON THE VASCULAR SYSTEM OF HATTERIA. 461
7. Some Additions to the Knowledge of the Anatomy,
principally of the Vascular System, of Hatteria, Croco-
dilus, and certain Lacertilia. By Frank E. Beppaxrp,
M.A., F.R.S., Prosector to the Society.
[Received June 5, 1905. |
(Text-figures 59-69.)
(1) On some Points in the Vascular System of Hatteria, p. 461.
(2) Notes on certain Veins in the Crocodile, p. 466.
(3) Notes on the Vascular System of Ophisaurus, p. 468.
(4) On the Anatomy of Amphisbena brasiliana, particularly of the Vascular
System and the Mesenteries, p. 479.
(1) On some Points in the Vascular System of Hatteria.
it is a noteworthy fact that, apart from the absence of a
copulatory organ, hardly anyone has attempted to utilise the
disposition of the internal viscera of Hatteria in order to show its
primitive, or at any rate isolated, position in the series with regard
to other Sauropsida. So far as I am aware, the only internal
feature in which Hatteria has been alleged to be primitive is in
the equal development of the internal surface of the lungs from
end to end, there being no trace in this Sauropsidan of the
partly or wholly anangious region at the caudal extremity of
the lung found in Lizards *, and, of course, especially in Snakes.
On the other hand, Osawa‘ has lately used the internal viscera
to emphasise the likeness between Hatteria and the Lacertilia,
especially even the Agamid Lacertilia. It is, in fact, agreed on
all hands that the viscera of this reptile are not widely different
from those of Lizards. The absence of a penis could hardly
be alleged to be primitive; it would rather “seem to be a
specialisation.
The vascular system of this reptile does not appear to me to
have been much investigated. Osawa, in his otherwise exhaustive
survey of the structure of Hatteria, has nothing to say of the
blood-vessels. Hochstetter =, however, has given some details
concerning the intestinal arteries, quoting an earlier paper by
Klaatch §. In the long bibliography given by Messrs. Howes
and Swinnerton ||, which includes references to papers dealing
with “ soft parts,” as well as with skeleton, I can find no memoir
quoted which refers to the vascular system. I am able therefore,
as I hope, to add something to our knowledge of this system of
organs in Hatteria, and to furnish additional evidence towards
the settlement of the much-vexed question of the place of.
FHatteria in the system.
* Milano, Zool. Jahrbiicher (Abth. f. Anat.), vii. p. 546.
+ Arch. f. mikr. Anat. Bd. xlix. p. 113.
{ Morph. Jahrb. vol. xxvi. p. 217, pl. v. fig. 1.
§ Ibid. vol. xviii.
|| Trans. Zool. Soc. vol. xvi. p 1.
462 MR, F. E. BEDDARD ON THE | Nov. 28,
Arterial System.—The arrangement of the aortic arches is pre-
cisely like that of the Lacertilia. It is not so different from that
of Lacerta, Iguana, &e. as is the arrangement found in Varanus.
The carotid arch gives off the usual three branches before joining
posteriorly the aortic arch. The third branch, that to the
muscles of the shoulder, arises just before the carotid arch joins
the aorta.
As to the systemic (aortic) arch (see text-fig. 59), it is in-
teresting to note that on both sides this arch gives off an
esophageal artery; frequently, as is well known, the right arch
alone gives off such a branch. Just at the meeting of the two
aorte the subclavians arise. A careful dissection shows (see
text-fig. 59, Sel.) that both subelavians arise close to each other—
and onea little in advance of the other—from the right aortic arch
only just before it joins the left. Hach subclavian gives off im-
mediately after its origin a forwardly directed vertebral artery,
which plunges at once into the parietes. Immediately after the
junction of the two aorte arises the first pair of intercostals.
Between this pair and the next arises a gastro-cesophageal artery.
This artery is separated from the gastric by three pairs of inter-
costals, and five pairs of intercostals lie between the gastric and
the superior mesenteric artery. The intestinal arteries I need
not refer to, as they have been already treated of by
Hochstetter *.
It may be mentioned that, as in some other Lizards (e. g.
Gerrhosaurus t), the pulmonary arch gives off on each side a
branch which runs along the windpipe and sends off branches to
the thyroid.
Venous System.—There is no question that, apart from details,
the venous system of Hatteria is distinctly Lacertilian. Nor
do the differences which it shows from Lacertilia tend to prove
a nearer resemblance to the Chelonia or to the Crocodilia. On
the other hand, I believe it possible to detect likenesses to the
Ophidia. This, however, in my opinion, does not argue a special
affinity between Hatteria and the Ophidia, but the antiquity of
the Hatteria type, which paleontology, as is well known, has
proved.
The Lacertilia are distinguished by the double vena cava
posterior, which is double, that is to say, as far forward as the
gonads, from which point onwards there is but a single trunk
formed by the fusion of the two trunks. As a rule, also, there is
an asymmetry between the two venz cave, or efferent renals,
as they are commonly termed. When there is this difference,
the right vessel is of greater calibre than the left. In Hatteria we
meet with the same conditions, and here the left vena cava is of
distinctly less calibre than the right. The two vessels, moreover,
* Morph. Jahrb. vol. xxvi. p. 217.
+ Beddard, “Anatomy of Gerrhosawrus,” P. Z. S. 1905, vol. 11. p. 263, text-
fig. 37, P.
1905. | VASCULAR SYSTEM OF HATTERIA. 463
Text-fig. 59.
Principal arteries of Hatteria.
The left-hand figure represents more in detail the origin of the subclavians
viewed from the dorsal aspect.
Ao., Ad. Right and left aorta; Ca. Carotid; D.B. Ductus botalli; g. Gastric;
Hy. Hyoid; Ic. Intercostals; L.Ao., R.Ao. Right and left aorta; MZ. Muscular
branch ; cs. (Hsophageal; Sel. Subclavians; S.m. Superior mesenteric.
464 MR. F. E. BEDDARD ON THE [ Noy. 28,
as is also often the case with the Lacertilia, are separated by the
dorsal mesentery.
The afferent renals are, as is the case with Lizards, derived
from two sources: the caudal vein divides into the two veins of
Jacobson and there is also a system of vessels derived from the
hind limbs and from the parieties in that neighbourhood. I
traced the veins of Jacobson for some way into the substance of
the kidney. It appeared to me that they did not directly join
the anterior abdominal vein ; and in any case it seems clear that
instead of there being a branch superficial to the kidney which
joins the ischiadic afferent renal system as in other Lizards (for
instance, in Lacerta, as figured by Hochstetter *), there is at most
a branch which effects such a union running within the substance
of the kidney. Jam inclined even to think that the union is
indirect. But in either case there is obviously an approach to
the condition observable in non-Boine Snakes, where the anterior
abdominal vein is independent of the caudal vein. It will be
noted, moreover, that the condition observable in the kidney-
region of Hatteria is quite remote from that to be noted in the
Varanide and in the Crocodilia, where the ischiadic, or both
the ischiadic and caudal, veins are directly continuous with the
anterior abdominal vein or veins, and merely send branches to
the kidney. The afferent renal system of Hatteria is, as it were,
an exaggeration of the typical Lacertilian type.
It is more particularly the anterior abdominal vein which
appears to me to show these Ophidian characters, partly matched,
however, as I shall indicate later, in a legless Lizard, Pygopus
lepidopus. In Lacertilia, at least as a rule, the conjoined anterior
abdominal and portal veins enter the left lobe of the liver at or
quite close to its posterior border.
In Snakes, on the other hand, there is, at least in some cases,
a different arrangement. In Hry«, for instance, the portal
runs along the side of the liver to its anterior end, giving off
branches at intervals to the liver-substance. In Hatéeria also (see
text-fig. 60) this is precisely what happens. The anterior abdo-
minal vein, reinforced by the portal, runs in the membrane which
connects the stomach with the left lobe of the liver, giving off
branches at intervals. to the liver-substance and receiving at
intervals branches from the stomach. ‘Towards the anterior end
of the liver the conjoined porto-abdominal trunk finally disappears
in the liver.
The details of the branching described here in general terms
can be understood by a reference to the figure (text-fig. 60).
Pygopus ~ shows an intermediate state of affairs. The main
branch of the conjoined portal and anterior abdominal veins
enters the liver near to its posterior extremity, as in Lacertilia
* Morph. Jahrb. vol. xix. pl. xvi. fig. 12.
+ “Notes upon the Anatomy of certain Snakes of the Family Boide,” P. Z.S.
1904, vol. 11. p. 113.
{ P. Z. S. 1904, vol. ii. p. 17.
1905.] VASCULAR SYSTEM OF HATTERIA. 465
generally. A thin branch, however, passing forward along the
Text-fig. 60.
Ant. Abd
Laan
\
\
Anterior abdominal and portal veins of Hatter ia.
Al.c. Stomach; Ant.Abd. Anterior abdominal; Liv. Liver; m. Gastro-hepatic
ligament ; P.v. Portal vein.
stomach, transmits branches to the anterior section of the liver,
:
466 MR. F. E, BEDDARD ON THE [Nov. 28,
This appears to me to be a reminiscence or a prophecy of the
forwardly extended portal of Hatteria.
The anterior abdominal vein gives off on each side before the
union of its two roots a well-developed lateral abdominal vein,
so common a feature in the Lacertilia.
It is a noteworthy fact that some of the venous trunks within
the liver appear upon the surface of that organ instead of being
entirely concealed within its substance. Almost the whole of
the vena cava is thus exposed and a considerable section of the
hepatic vein.
Another difference from the conditions usually, if not always,
to be observed among the Lacertilia is the total absence of dorsal
parieto-hepatic veins. This might at first appear to be a point of
likeness to the Crocodilia, among which the absence of these
veins has been asserted.
(2) Notes on certain Veins in the Crocodile.
Parieto-hepatic veins wr Crocodilus acutus.—As there appears
to be a considerable conflict of opinion as to these veins in the
Crocodilia, coupled no doubt with actual differences in different
genera, it is perhaps worth while to record the condition of the
parieto-hepatic veins in Crocodilus acutus.
Contrary to what is to be met with in many Lizards and
Snakes *, this Crocodile has three sets of parieto-hepatic vessels,
viz. ventral, dorsal, and lateral. The two former alone exist in
the Squamata, so far as we know at present.
The dorsal parieto-hepatics exist on both sides of the vertebral
column. On the left side they are most extensive and have the
following arrangement :—There are five trunks which correspond
to as many ribs. The three anterior of these, of which the second
and third are the stoutest, combine to form a common trunk,
which enters the liver (naturally the left lobe) near its posterior
extremity. These vessels, where they emerge from the parietes,
receive, each one of them, an intercostal. The last of these three
vessels (7. ¢., that which is most remote from the heart) gives off
two branches. One of these seems to be of some morphological
importance ; the other appears to be less important. The latter
isa branch which joins the last intercostal, which takes a share in
this section of the hepatic portal system. The vessel in question
runs along the “diaphragm,” and, receiving the branch already
referred to, enters the liver independently of the main dorsal
parieto-hepatic trunk. The branch which I regard as of some little
morphological importance arises from the bend of the third of the
first three affluents of the dorsal parieto-hepatic; it receives an
intercostal and then perforates the dorsal mesentery and joins the
system of parieto-hepatic vessels of the right side. I regard this
vessel as of importance because it seems to represent a corre-
* Tn all snakes, so far as my own experience goes.
1905. ] VASCULAR SYSTEM OF CROCODILUS. 467
sponding vessel in 7%liqua*, which arises on the left side of the
vertebral column and joins the right parieto-hepatic. In the
Lacertilia generally the dorsal parieto-hepatic veins are on
the right side only ; and if there are such vessels on the left they
either join the right-hand vein before entering the liver, as in
Tiliqua, or, as in Iguana ty and Anguis f, supply the castric and
cesophageal networks and thus reach the liver indir ectly. It may
be said, therefore, so far as present knowledge allows the state-
ment, that the Crocodilia differ from the Lacertilia in having
a left as well asa right dorsal parieto-hepatic, entering the liver
independently into both right and left lobes.
On the right-hand side of the body the single dorsal hepato-
parietal trunk is composed of three stout affluents, of which the
two posterior are joined by a cross anastomosis. The anterior
vessel is continued forwards superficially and joims, or nearly
joins, the right azygos. I may remark that on the left side the
gaps between the several superficially running sections of the
azygos are more pronounced.
Finally, the venous system of the liver in Crocodilus acutus
receives another affluent, which is not, as I believe, represented in
the Lacertilia. This isa vein which arises from the parietes on
the right side, in a position intermediate between the dorsal and
ventral parieto-hepatics. This single vein arises from a longi-
tudinally running trunk in the parietes which corresponds, as I
think, to the lateral abdominal vein; it passes straight to the
liver, which it does not, however, enter independently, but in
common with the dorsal parieto-hepatic.
The above-given facts are, as has been already mentioned, not
in entire accord with previous statements.
Hochstetter observes § ‘‘ Hine vena hepatica advehens vertebralis
[=my right dorsal parieto-hepatic] wie bie Lacerta und anderen
nicht vorkommt.” But his observation refers to Alligator lucius.
Jacquart ||, who previously studied the venous system of the
same species (“Caiman & museau de Brochet”), makes no
particular mention of the vessels which I describe here in
Crocodilus acutus. He refers to what is possibly the right dorsal
pavieto-hepatic (figured im fig. 1, pl. ii. 20 d, of his memoir)
merely as “une petite veine qui contourne le bord tranchant du
lobe droit du foie”; and the vein in question may be really a
branch of the ventral parieto-hepatic system. For the possibly
corresponding vein of the left side (figured by Jacquart in fig. 1,
pl. iii. 41, of his memoir) no special reference is made in mine
text.
Rathke 4, however, under the name of “vena epigastrica
* Beddard, “Contributions to the Anatomy of the Lacertilia: Pt. I.,” P. Z.S.
1904, vol. 1. p. 445.
+ Id. ibid. p. 440. { Morph. JB. vol. xix. p. 473.
§ Morph. JB. xix. p. 478. || Ann. Sci. Nat. (4) ix. 1858, p. 129 &c.
@ ‘Untersuchungen tiber die Entwickelung und der K6rperbau der Krokodile’
(Braunschweig, 1866), p. 256. The same name is also applied to the abdominal veins ;
but, I presume, in error for ‘‘ extern.”
468 MR. F, E, BEDDARD ON THE | Nov. 28,
interna,” does describe such vessels as I have dealt with above ;
but his descriptions do not tally exactly with the facts which
I have observed, and it is not clear to what species or even to
what genus his observations refer.
There are also ventral parieto-hepatic veins connected with the
epigastric vein, which are but slightly dealt with by Rathke * and
not figured by Jacquart ?. These are most conspicuous in the case
of the right lobe of the liver. They are partly directly connected
with the right epigastric vein and partly enter the ventral parietes
separately. There are three of these vessels, which arise from a
slender superficial vein running along the ventral surface of the
liver and continuous with the anterior abdominal vein posteriorly.
The first of these ventral parieto-hepatic veins (?. e., that nearest
to the breast) divides into three branches, of which one joins the
epigastric and the others plunge into the ventral parietes
separately. The second vein is at about the middle of the liver
and joins the epigastric. The third is really given off from the
anterior abdominal before it enters the liver and joins the
epigastric.
On the left side there is only one of these veins corresponding
in position to the stronger and middle one of the three on the
right side.
(3) Votes on the Vascular System of Ophisaurus.
The most recent memoir known to me which deals with the
blood-vessels of Ophisaurus apus (Pseudopus pallasti) is by
Prof. Hochstetter =, whose notes refer entirely to the venous
system of that Saurian. Some earlier works upon comparative
anatomy, such as those of Siebold and Stannius §, contain various
facts relating to the blood-vessels. But I find that the recorded
knowledge of the course of the arteries and veins in this Lizard
is practically confined to Rathke’s extensive memoir|| and to
Hochstetter, and does not enable us to draw up anything like a
complete account of the vascular system. I have therefore
thought it desirable to utilise a thoroughly injected example of
this Lizard, which was treated immediately after death, for the
purpose of a further contribution to the knowledge of the vascular
system in Lizards, which matter has been for some time occupying
my attention.
The origin of the several aortic trwnks from the ventricle is as
in other Lacertilia and a detailed description of the same is
therefore unnecessary here. The carotids show certain pecu-
liarities which are worth noting. The carotid artery arises from
the carotid arch just where it turns over to join the systemic
arch of its own side in a fashion which does not appear to
* Loe. cit. + Loe. cit.
t “ Venensystem der Amnioten,” Morph. Jahrb. xix. 1893, p. 475.
§ Handbuch der Zootomie, 2 Theil, Amphibien (Berlin, 1856), p. 225.
i| “Die Aortenwiirzel der Saurier,” Denkschr. Akad. Wien, xii. (1857).
1905. | VASCULAR SYSTEM OF LACERTILIA. ~ 469
characterise other Lizards. As will be seen from the drawing
(text-fig. 61), the artery is not merely a branch of the arch, but
between the two is an abbreviated rete mirabile. The carotid, in
fact, arises by three or four mouths, which at once unite to form
the single vessel. This is not shown in a lateral view of the
neck-arteries given by Rathke.
One cannot but compare this with the carotid “ gland” of
the Frog.
Precisely the same mode of origin was shown on both sides of
the body, so that we have evidently not to do with an asymmetrical
anomaly.
Text-fig. 61.
Heart and aortic trunks of Ophisaurus, to illustrate mode of origin of
carotid (c).
Branches of Carotid.—Before the origin of the carotid artery,
the carotid arch, as in other Lacertilia, gives off branches, which
differ in detail from these other forms. The first to be given off
is a branch to the thyroid on the right side; I did not notice a
corresponding branch on the left side, and, as will be seen shortly,
the right half of that gland receives its blood-supply from another
source. The next trunk divides into three principal branches, of
which the first supplies the sternal musculature and the adjoining
parts, the next is a slender artery which runs under the skin and
above the musculature, ramifying out beneath the scales. The
third branch goes to the hyoid region.
The right aorta gives off the swhclavian vessels before joining the
left aorta. My observations upon these arteries agree with those
of Rathke. They arise by a common stem from that aorta, which,
470 MR. F. E, BEDDARD ON THE [Nov. 28,
after giving off at any rate one intercostal twig, divides into two
slender trunks diverging right and left. Hach of these separates
from itself immediately after its own origin a vessel which
rapidly plunges into the thickness of the body-wall in the middle
line, and which represents on either side the anterior vertebral
arteries of other Lizards. In spite of the limbless character of
this Ophisaurus, the subclavians are still more distinctly re-
cognisable as such than they are in Amphisbena.
The left aorta gives off several vessels to the cesophagus before
joining the right aorta, but no intercostals. On the other hand,
the right aorta gives off several intercostals before joining the
left. Rathke mentions cesophageal arteries as arising from the
right aorta.
The carotid artery does not pass up the neck alongside of
the trachea. But the windpipe is, as in other Lacertilia, accom-
panied by an artery. This artery, however, in Ophisaurus is
only to be seen on the right side of the trachea; on the left there
is at most a rudiment of the same. It gives off branches to the
thyroid which correspond to those given off on the left side by
the carotid arch before it gives off the carotid artery. This
tracheal artery-arises, as do the corresponding pair in Hatéeria,
&c., from the pulmonary artery. In Ophisaurus it is accom-
panied by a vein of larger calibre than itself, which runs up the
neck in close contact with it and again only on the right side.
On the left I could discover no traces of a corresponding vein.
This vein joins the anterior cava. The asymmetry in this part
of the arterial system is noteworthy, for the reason that it is the
only part of the arterial system which shows, in correspondence
with the snake-like habit of body, any traces of an asymmetry.
The dorsal aorta gives off ventrally a regular paired series of
intercostals, which fail apparently nowhere and are even and
regularly paired throughout.
sophageal and Gastric Arteries.—A striking feature of this
Lizard as compared with many is the very large number of
trunks arising from the aorta which supply the csophagus
and stomach. There are two or three cesophageal vessels arising
from the left aorta before it joins the right. After the junction
there are seven small arteries still supplying the cesophagus.
Of these, which are not mentioned by Rathke, the first four
arise from the aorta itself. After these come three trunks,
which arise not from the actual aortic trunk but from the inter-
costal vessel of the left side. All of the cesophageal arteries
are very small and at the same time very convoluted in their
course. Following them are five gastric trunks, which are all of
greater calibre than the cesophageal vessels. The last three of
these are particularly important. A considerable gap separates
these gastric vessels from the three chief arteries which end upon
the walls of the intestinal canal. Hochstetter has figured three
variations in point of origin ofthese threearteries. In the individual
dissected by myself I found one of these three arrangements to
1905. | VASCULAR SYSTEM OF LACERTILIA, 471
exist, and that was—first the arteria cecalis, second the arteria
celiaca, and then, of course, the mesenteric. The cceliac artery is
limited to the stomach, liver, pancreas, and spleen. The small
branch to the spleen arises on the right side of the mesentery. Itis
Text-fig. 62.
Intestinal arteries and portal of Ophisawrus, from left side.
A.m. Mesenteric artery; Caec. Cxcal artery; Coel. Celiac artery; Spl. Spleen ;
Pa. Pancreas; P.v. Portal vein.
thus not seen exactly in the accompanying drawing (text-fig.’ 62),
which represents the arteries and veins seen from the left aspect
of the suspensory membrane of the alimentary canal.* It is to be
Proc. Zoou. Soc.—1905, Vou. II. No. XXXII. 32
472 MR. F. E, BEDDARD ON THE [ Nov. 28,
noticed that all three of the important gastro-intestinal arteries
in this Lizard arise from the aorta at the same plane exactly.
One is not more to the right or left of the median ventral line of
the aorta than the others. The hepatic artery accompanies the
conjoined abdominal and portal veins in entering the liver. That
organ is also supplied by several small branches (see text-fig. 64,
p. 475), which naturally owe their blood to the anterior gastric
arteries already mentioned, inasmuch as they accompany the
gastric veins, which, as is stated below, pour their contents into
the anterior region of the liver. I did not detect any further
arterial blood-supply of the liver than from the two sources
referred to.
Renal Arteries —These arteries (text-fig. 63, p. 473) are very
numerous and show a great regularity, not only in their mode of
origin, but in their segmental relations. I counted six separate
renal arteries on the right side and seven on the left; and in
addition to these the iliac trunks, which also give off the epigastric
arteries, send a branch to the kidneys posteriorly. The renal
arteries are accurately paired, save that one artery is missing on
the right side. That they are otherwise accurately paired is
connected with the fact that they all arise in common with the
intercostal arteries. Each artery runs over the kidney for some
distance before opening into it rather laterally and of course
dorsally.
Anterior Abdominal Vein.—This vein is typically Lacertilian in
origin and distribution. There are nevertheless two or three
facts concerning its branches to which it will be necessary to call
attention.
The vein arises as usual by two roots from the caudal vein.
On each side before they unite into the single vein each half gives
off two small veins side by side to the posterior part of the kidney
posterior in position to the parieto-renal afferent veins mentioned
below. After the origin of these a larger vein is given off
which runs along the body-wall dorso-ventrally and on the outer
side of the kidney. This vein dies away anteriorly before the
anterior end of the kidney. It is, as I think, the lateral abdominal
vein of other Lacertilia. The anterior abdominal vein runs along
the mid-ventral line of the body and is supported by a fold of
eritoneum, the continuation backwards of the falciform ligament,
and thus the equivalent of the primitive ventral mesentery. The
vein joins the portal before entering the liver close to the gall-
bladder.
Hepatic Portal System.—The intestinal portal vein posteriorly
frees itself from the large intestine, along which it runs in close
apposition, at the junction of the small and large intestines.
Henceforth it lies at some distance from the intestine in the
mesentery. It is noteworthy that this main portal trunk les on
the left side of the dorsal mesentery, so that it lies superficially
to the arteries when this mesentery is viewed from the left side.
The vein, moreover, contrasts with the arteries over which it runs
1905. ] VASCULAR SYSTEM OF LACERTILIA. 473
by its straight as opposed to their highly sinuous course. This
applies also to the affluents of the portal, which, so far as concerns
the small intestine, are five in number,
Text-fig. 63.
Ao
AR
AR
Renal arteries of Ophisaurus.
Ao, Aorta; A.R. First and last renal arteries ; ep. Epigastric; Ic. Intercostal.
The gastric affluents of the portal trunk arise from both sides
of the stomach, On the right side is a vein which runs forward
along the stomach to nearly its anterior end, but stops a little
before a region of the stomach the veins of which instead of
joining the main portal system open independently into the liver ;
the arrangement of these veins will be considered presently, At
29%
OL
474. MR. F, E. BEDDARD ON THE [ Nov. 28,
the postericr end of the stomach this portal affluent joins the
main portal trunk in the immediate neighbourhood of the
junction of the latter with the anterior abdominal vein.
On the left side is a corresponding vein which takes up blood
from the spleen as it passes that viscus.
The liver anteriorly is supplied (see text-fig. 64, p. 475) with a
series of some five gastro-hepatie veins, which run across from the
stomach to the liver, where they are collected into a longitudinal
vein before opening directly into the liver. This forwardly
directed vessel is not, however, a direct prolongation of the con-
joined portal and anterior abdominal as in Hatteria*. This vein
also receives the dorsal parieto-hepatic affluents of the hepatic
portal system, which will be dealt with immediately. Accompany-
ing each gastro-hepatic vein is an artery, which arteries I have
already described above. The close association of gastro-hepatic
veins and supplementary hepatic arteries is very reminiscent of
what is to be found among Snakes, and very unlike the prevailing
arrangement among Lacertilia. It is doubtless to be correlated
with the great length of the liver in Ophisawrus and Snakes.
The dorsal parieto-hepatic veins are particularly well developed
in this Lizard as compared with many other genera. And,
furthermore, they differ from those of many other Lacertilia in
being mainly developed upon the left instead of upon the right
side. There is, in fact, only one of these veins upon the right side.
On the left, on the contrary, three or four veins arise from a varied
number of intercostal spaces. The most posterior of these runs
along the vertebral column for a distance of seven vertebra,
receiving a branch corresponding to each intercostal space. The
vertebral affluents of the hepatic portal system which arise in
front of this have not so long a course along the vertebral column
by far. They emerge from the parietes and at once pass down-
wards to the portal system. These dorsal parieto-hepatic veins
join the longitudinal vein already described, which runs along the
dorsal edge of the liver anteriorly and which also receives the
gastro-hepatic vessels. The fact that this system is almost
entirely developed on the left side is to be compared with the
parallel fact that the only one of two azygos veins to be retained
in Ophisaurus is also the left-hand vein. '
Epigastric System of Veins.—The smaller veins which run in the
umbilical (falciform) ligament and pour their contents into the
liver have a somewhat different arrangement from that found in
certain other Lizards. The system, instead of consisting of one
continuous vein running in the falciform lgament in close
apposition to the ventral body-wall in the median line with
branches to the liver-substance, consists of two separate veins of
considerable size. The anterior of these enters the liver far
forwards. It is formed of two veins which unite just before
their conjoined entry into the liver, of which the anteriorly
* Above, p. 464, I offer some remarks upon this extension forwards of the’ portal
vein, also on p. 484 of the present communication.
2 i
1905. | VASCULAR SYSTEM OF LACERTILIA. AT5
running one is much the shorter; the posteriorly running vein
extends back to nearly the end of the liver, but sends no branches
into that organ ; nor is it continuous, so far as I could make out,
Text-fig. 64.
Hepatic portal system of Ophisaurus.
Ant. Abd. Anterior abdominal ; ep. Epigastric veins; G. Gall-bladder; g.v. Gastric
vein; g.hep. Gastro-hepatic veins; gast. Gastric artery ; L.v. Lateral vein on
liver receiving gastro-hepatics; LZ. Liver; p. Pancreas; par.hep. Parieto-hepatic
veins; P.v. Portal vein.
476 MR. F. E. BEDDARD ON THE | Nov. 28,
with a second epigastric vein, which, running parallel to and above
the anterior abdominal, enters the shelter of the liver at its end
close to the anterior abdominal and joins that vein under the
lower surface of the right lobe before it loses itself in the substance
of the liver. The disposition of these veins will be obvious from
an inspection of text-fig. 64.
Renal Portal Veins.—In addition to the veins from the tail which
bring blood to the kidneys, these glands are also supplied with
blood from the parietes in their immediate neighbourhood. A
series of vessels (see text-fig. 65) arises from the body-walls and
plunges into the substance of the kidney on either side. These
vessels were for the most part partly injected in the specimen at
my disposal and can therefore be accurately mapped. The perito-
neum in this region of the body as elsewhere is densely pigmented.
But the difficulty of seeing through it is removed by the fact that
it is very loosely attached to the parietes and to the kidneys, which
lie, of course, behind it. When it is carefully removed the veins in
question are very plainly exposed. They arise from the parietes
very laterally—that is, not at all close to the median dorsal line,
whence such vessels ordinarily arise in Lizards. Originally they
appear to have been accurately segmental, one arising from each
segment as denoted by a rib. In point of fact, however, the vessels
belonging to two or to three ribs occasionally unite before opening
into the kidney. It is also to be noted that the veins in question
pour their contents into the kidney at different levels. Some
vessels enter the kidney along its outer edge, while others plunge
into its substance more dorsally. This arrangement is roughly
alternate. There were six of these vessels to each kidney, but
their distribution was not exactly the same on both sides of the
body. These vessels do not appear to be referred to by Hoch-
stetter, though he mentions them in Angwis fragilis. I have
noticed them in other Lizards, where possibly they are represented
by the veins from the hind limbs. In any case they are very
conspicuous and impossible to miss in Ophisaurus, and their
arrangement is somewhat different from that which characterises
Anguis.
It is furthermore to be noted that those veins which enter the
kidney more dorsally join in each case one of another series of
afferent renals. I counted three of these on the right side, which
emerge from the parietes very close to the dorsal middle line.
They are rather stouter vessels, and run over the dorsal surface
of the kidney nearly to the outer edge of that gland before
plunging into its substance. All these parieto-renal vessels
become lost in the substance of the kidney. There is no super-
ficially running trunk continuous with the caudal vein posteriorly
into which they open. Nor can they be traced into direct and
superficial connection with the efferent renal veins.
Supra-renal Portal Veins —These important veins are naturally
referred to by Hochstetter, who has done so much towards the
elucidation of this as of other venous systems in the Lacertilia. I
1905.] VASCULAR SYSTEM OF LACERTILIA. ATT
shall, however, describe the conditions observed by me in a male
Ophisaurus (Hochstetter also examined a male) as an indication
of the variability of this region of the venous system. Hach
Text-fig. 65,
Renal veins of Ophisaurus.
a. Intercostal arteries; Ant.Abd. Anterior abdominal vein; DL.Abd. Lateral
abdominal vein; 7. Afferent renals; v. Veins running from parietes to the
kidney.
supra-renal body has two series of affluent supra-renals, as has
Iguana*. There is an outer series springing from the lateral
* Beddard, “ On the Venous System in certain Lizards,” P. Z.S. 1904, vol. i. p. 443.
478 MR. F, E. BEDDARD ON THE [ Nov. 28,
parietes in line with the afferent renal veins that have just been
described, and an inner series emerging from the body-wall close
to the median dorsal line. Of the latter I observed only one
vessel on each side of the body. Of the former there were two
on the left side and one on the right. They collected blood, how-
ever, from more than one intercostal space. On the left side a
blood-vessel belonging to the same series runs from the parietes
to the sperm-duct some way behind the testis and supra-renal.
I did not observe one of these vessels on the right side.
Résumé.
It may be useful to state briefly the main facts in the circulatory
system of this Lizard for purposes of an easier comparison with
other forms.
Arterial System.
(1) The origin of the carotids from the carotid arch suggests
the carotid “gland” of the Frog, inasmuch as the carotid trunk
arises by several mouths from the carotid arch as it bends round
to join the systemic arch.
(2) As in some other Lizards, the pulmonary artery gives off
a branch running along the trachea and supplying the thyroid
body. This exists only on the right side. The artery is relatively
small.
(3) The subclavians are two slender vessels arising by a
common trunk from the right aorta and give off two vertebrals,
one arising from each.
(4) The intercostals are quite regularly paired, and nowhere
deficient or asymmetrical. They commence upon the right aorta
before it joins the left.
(5) The left aorta gives off several wsophageal branches.
(6) There are seven esophageal arteries arising from the common
aorta, of which the last three arise from the intercostal of the
left side.
(7) There are five gastric arteries anterior to the cceliac.
(8) The liver is supplied with arterial blood from two sources.
First by the usual Lacertilian hepatic artery, which is a branch of
the celiac ; and secondly by a number of small trunks accompanying
the gastro-hepatic vessels and arising from the gastric arteries.
(9) The relative positions of the celiac, superior mesenteric,
and cexcal arteries (as has been shown by Rathke and Hochstetter)
differ.
(10) The renal arteries are six or seven in number, arising in
common with the intercostals and nearly regularly paired. The
iliac arteries also give off a branch to the kidneys.
Venous Systenv.
(1) The anterior vena cava of the right side receives a branch
1905. ] VASCULAR SYSTEM OF LACERTILIA. 479
which runs along the trachea parallel with a tracheal artery
referred to. This vein does not exist on the opposite side.
(2) The azygos vein is developed on the left side of the
body only.
(3) There is an unusual series of vestiges of the posterior
cardinals, which, like the anterior vestige of the same, the azygos,
are upon the left side of the body, and, with the exception of a
small twig, not upon the right side. The veins form the dorsal
parieto-hepatics, and pour their contents into a common trunk
which runs below the liver only in its anterior region, and which
receives also branches from the first half of the stomach.
(4) The anterior abdominal vein receives the portal just before
its entrance into the liver, along which it is not prolonged, and
just after the entrance of the portal the posterior part of the
epigastric vein. The anterior region of the epigastric vein is
either separate from the posterior part or joined by the minutest
twig; it pours its blood into the liver near to its anterior end.
(5) There are gastro-hepatic vessels to the number of four or
five in the anterior region of the stomach and liver only. The blood
from the posterior region of the stomach is chiefly collected into
a vessel which runs back along the stomach and joins the com-
bined portal and anterior abdominal.
(6) The supra-renal portal system consists of two series of
vessels, of which one series, consisting of one or more twigs, arises
from the parietes laterally ; the other series, consisting of one
vessel only, arises from the parietes close to the dorsal middle line.
Veins also emerge from the parietes and run to the sperm-duct.
(7) The kidneys receive blood from the parietes in their neigh-
bourhoed by a series of about six veins to each kidney arranged
metamerically, and corresponding in point of emergence from the
parietes with the more laterally placed supra-renal portals.
The two halves of the anterior abdominal, before they join,
also give off two twigs to the kidney on each side
(8) A lateral abdominal vein is present, which runs along the
kidney on the outer side, but dies away before reaching its
anterior end.
(4) On the Anatomy of Amphisbena brasiliana, particularly of the
Vascular System and the Mesenteries.
Though a good deal of information concerning the anatomy of
this genus of Lacertilia is already contained in zoological litera-
ture *, there remain certain matters which have not been ex-
haustively studied, either in the species (Amphisbena brasiliana)
with which I deal in the communication now submitted to the
Society or in other species. I have therefore, in continuation of
a series of dissections of the Lacertilia, some of the results of which
* The principal anatomical memoirs dealing with the viscera are by v. Bedriaga
(Arch. f. Naturg. 1884), Smalian (Zeitschr. wiss. Zool. 1885), and Butler (P.Z.S
1895). In none of these is A. brasiliana dealt with.
480 MR. F. E, BEDDARD ON THE [ Nov. 28,
have been published by the Society”, attempted to fill in some of
the lacune in our knowledge of an undoubtedly interesting genus
of Lacertilia, the systematic position of which within the order
cannot certainly at present be regarded as conclusively decided +.
Mesenteries and Veins of the Liver.—The hepatic ligaments are
quite typically Lacertilian, though presenting apparent differences
from those of other Lacertilia, which are due simply to the snake-
like form of Amphisbena and the correspondingly snake-like
form of the liver. In my example of Amphisbena brasiliana,
measuring 15 inches in total length, the liver is 107 mm. or nearly
43 inches. The smaller left lobe, which extends neither so far
forward nor so far backward as the right lobet, is only 73 mm.
long. It may be noticed in passing that the liver shows several
rather obliquely placed transverse fissures, a state of affairs which
is known to exist in burrowing, and also in marine, snakes and
in the burrowing Cecilians. The transverse lobation of the liver
is not, however, a very marked phenomenon in this Lizard and
might easily be, as it has been by some at any rate §, overlooked.
The wmbilical ligament is, as in other Lizards, attached along
the whole length of the liver from beginning to end. 1t does
not, however, end with the liver, but is prolonged further, in fact
to the very end of the abdominal cavity. This fact has been
noted by Butler ||, whose remarks, in so far as they bear upon the
matter under consideration, are as follows :—‘‘ In many Lizards
these fat-bodies, pushing the peritoneum before them, bulge into
the body-cavity; and, lying on the course of the large vessel,
ventral to the.... bladder ....and the alimentary canal, into
the ventral ligament of which they in some forms (Amphisbeenide)
obviously extend,” &e. Posteriorly, however, in the present species
the umbilical ligament is not attached to the gut. It leaves the
liver for the stomach at the gall-bladder and ceases to be attached
to the stomach on a level with the posterior extremity of the right
lobe of the liver. The ligament is single throughout.
The liver is attached dorsally by membranes which find their
homologues in other Lacertilia and are indeed but little altered
from the arrangements found generally. There are two of these
membranes. The left-hand one attaches the left lobe of the liver
to the stomach, and the right-hand membrane is the ‘‘ Hohlvene-
gekrose” of Hochstetter, which attaches the vena cava to the
dorsal parietes posteriorly and is continued on to the gonad, and
which anteriorly has somewhat varying relations among the
Lacertilia to the stomach and the parietes. In Amphisbena
this mesentery does not reach the dorsal body-wall independently
* P.Z.S. 1904, 1905.
+ For a réswmé of opinion, see Fiirbringer, “ Beitrag z. Systematik und Genealogie
der Reptilien,” Jen. Zeitschr. xxxiv. 1900, p. 616
{ it thus differs from A. cinerea as figured by v. Bedriaga, Arch. Naturg. p. 481
1884, pl. iv. fig. 2.
§ H.g. by Cuvier, ‘Lecons d’ Anat. Comp.’ ed. 2, vol. iv. part 11. (1835).
|| “On the Relations of the Fat-Bodies of the Sauropsida,” P. Z. S. 1889,
p. 603.
1905. | VASCULAR SYSTEM OF LACERTILIA. 481
of the stomach, to which it is attached. This disposition is possibly
due to the absence of a left lung and its accompanying pulmo-
hepatic ligament, which in forms where it does occur comes into
relation with the right hepato-gastric ligament. At a distance
of rather more than 40 mm. from the anterior end of the liver
the two dorsal hepatic ligaments unite to form a single membrane,
which extends forward for the remainder of the course of the
liver. It is at least common, if not the rule, among the Lacer-
tilia, for these two membranes to unite anteriorly. So that the
conditions obtaining in Amphisbena are merely an exaggeration
of those to be seen elsewhere, and due to the elongation of the
liver. I shall recur to this anatomical relationship of the mem-
branes in considering the blood-vessels which run in them.
Text-fig. 66,
Membranes uniting vena cava and left lung in Aimphisbena brasiliana.
a. Umbilical ligament ; 6. Pulmo-hepatic ligament ; Za. Lung; v.c. Vena cava.
The liver is also attached to adjacent viscera by a lateral
mesentery upon the left side of the body, and uniting the liver with
482 MR. F. E. BEDDARD ON THE [ Nov. 28,
the fully developed left lung (the only lung, as Mr. G. W. Butler
has correctly asserted, which exists in Amphisbena). The pulmo-
hepatic ligament in question is attached to the outer border of
the lung, where it is first visible (text-fig. 66, B) at some little
distance from the commencement of the lung, but at a greater
distance from the termination posteriorly of that viscus. It is
seen to be covered by the umbilical ligament when the reptile
is dissected so as to leave the umbilical ligament on the left side ;
it is furthermore attached at first to that ligament, and has
therefore a common attachment with it to the liver. Further
forward (text-fig. 66, C) the course of the attachment of the
pulmo-hepatic ligament gradually moves over the lung obliquely
until it comes to lie upon its imner border, 7. e. that nearest to
the liver, or rather by this time the vena cava, for the liver-
substance ends anteriorly a good way behind the heart. At the
same time the umbilical ligament moves obliquely in the line
of its attachment in the opposite direction, so that ultimately
(text-fig. 66, A) the inner edge of the lung is tied to the
opposite edge of the vena cava by a short mesentery which is
formed by the fused pulmo-hepatic and umbilical ligaments,
while the inner edge of the lung is attached to the median parietes
by a ligament which is presumably umbilical ligament only.
These relations will be understood by an inspection of the
accompanying figures (text-fig. 66), which represent a series of
diagrammatic transverse sections through the region of the liver
and lung which are dealt with here. ‘These attachments between
the liver and lung are not peculiar to Amphisbena, as I believe ;
but they are specialiy obvious in that Lizard on account of the
elongation of the organs concerned. The only other ligament in
this region of the body which remains to be noticed is the pulmo-
gastric, which attaches the lung to the stomach. It extends
along the whole lung, and is continued beyond it as a fold upon
the stomach, extending back as far as the spleen.
Amphisbena agrees with other Lizards in the possession of a
parieto-hepatic system of veins, which seem, however, to be limited
to the dorsal body-wall. I could at least observe no such veins
in the umbilical ligament belonging to the ventral epigastric
system. Of the former there are, as Mr. G. W. Butler has
correctly pointed out *, five veins distributed along the course of
the liver, and not limited, as they so often are, to the right lobe
where it is free from the left. These veins (text-fig. 67) are large
and for the most part bifurcate with a long course between the
point of evergence from the body-wall and of entrance into the
liver. They run, of course, in the right hepato-dorsal mesentery.
The large number of these veins is not an important character, for
in Scincus officinalis I find as many as six. It is their extension
along the whole length of the liver which is worthy of note, and
is a likeness to the conditions which obtain in the Ophidia.
* P.Z.S. 1895, p. 699, footnote.
1905. | VASCULAR SYSTEM OF LACERTILIA, 483
Text-fig. 67.
Liver of Amphisbena brasiliana, ventral view.
Ant.Abd. Anterior abdominal vein; d.h.p. Dorsal parieto-hepatie vein ;
gb. Gall-bladder ; vez. Vena cava posterior.
484 MR. F. E. BEDDARD ON THE [ Nov. 28,
Between the liver and the stomach runs a forward extension of
the portal vein, which dies away anteriorly but nearly reaches the
forward extremity of the liver. At first the dorsal parieto-
hepatic vessels, where the right lobe of the liver is prolonged
beyond the gall-bladder, open directly into the intra-hepatic
venous system. But further forward, where the two lobes of the
liver come into continuity and the two dorsal hepatic ligaments
fuse, the parieto-hepatic portal veins open into (or at least very
close to) the forward extension of the portal vein already referred
to. Itis only in this region that gastro-hepatic vessels occur.
The left gastro-hepatic ligament carries no gastro-hepatic vessels,
that I could see, in that part where it is free from the right
ligament. The vessels, in fact, are first visible about 40 min. from
the anterior end of the liver. They open into the longitudinal
portal vessel like the dorsal parieto-hepatic veins.
It is important to notice the likeness which the arrangement
of these veins in Amphisbena bears to the similar arrangement
of the same veins in Snakes on the one hand and in Hatteria on
the other. In Lacertilia, as a rule, the gastro-hepatic veins
bringing blood from the stomach and cesophagus to the liver enter
the latter organ separately, or at most one or two blend together
before opening into the blood-sinuses of the liver. In Hatteria,
as I have already pointed out *, there is a collecting-vein, which
is a prolongation forward of the portal vein, that is the conjomed
portal and anterior abdominal, which runs in the gastro-hepatic
ligament on the left side of the body and receives on the one hand
veins from the stomach, while on the other side it gives off veins
to the liver. There is, however, in Hatéeria, no further resem-
blance to the conditions which obtain in Amphisbena. In Snakes
there is the further likeness in that, while there is the same
forward prolongation of the portal vein forwards between the
liver and the stomach, this vein not only receives branches from
the stomach which it transmits to the liver from the opposite
side, but it is also in connection with the venous system of the
body-wall by means of the dorsal parieto-hepatic veins, which
thus come, as in Amphisbena, into close relations with the gastro-
hepatic veins.
The important point of likeness between all three types is, as
it appears to me, the extension forwards of the portal up to or
nearly up to the anterior extremity of the liver. ‘The close
association in Snakes and in Amphisbena of the dorsal parieto-
hepatic vessels with branches from the stomach to the liver seems to
me to be dependent merely upon the narrow form of the body and
of the liver, and the consequent necessity of packing everything
in a narrow space. As it is so markedly the rule for the portal to
enter the liver at its hinder border in the Lacertilia, these two
divergences from that normal condition cannot but attract atten-
tion, especially as they show a likeness to the admittedly nearly”
* Above, p. 464.
1905. | VASCULAR SYSTEM OF LACERTILIA. 485
related Ophidia. A likeness between Hatteria and the Ophidia
fits in well with the view that Hatteria, though unquestionably an
ancient form, is nevertheless to be placed closer to the Squamata
than to any other group of Reptiles. The Amphisbenids un-
doubtedly differ much from other Lacertilia, not only in structures
related to their apodous condition and snake-like habit, but in
various features which have at least no obvious connection with
their mode of life. There are no clear indications of their
relationship to other Lacertilia*. It may be that the fact dealt
with above is of some suggestiveness as a clue to the position of
this group, which, judging from its distribution and great modifi-
cation, would not seem to be a modern type of Lacertilian.
Other Veins.—It has been recorded by v. Bedriaga that the
posterior vena cava of Amphisbena shows no divergences from
the Lacertilian type. The left vena renalis revehens turns
abruptly to the right at about the middle of the testis, where it
receives the left spermatic vein, and from the right vena renalis
revehens where the latter receives the right spermatic vein. In
its course the vena renalis revehens of the right side (no doubt
of the left also, though I have not positively ascertained the fact)
appears to receive several veins from the parietes. These, how-
ever, really open into a vein to be described later.
Supra-renal portal veins exist. There were two on the left
side and two on the right. On the right side, where circumstances
allowed a more careful study, these veins were seen to open into
a vein running along the vas deferens as figured by Hochstetter
for Lacerta viridis. But in Amphisbena this vein runs back to
the kidney and receives in its course between the testis and the
kidney four veins from the parietes springing close to the dorsal
line. In continuation of this series three veins open into each
kidney.
This vein is shown in the accompanying figure (text-fig. 68,
p. 486). It is clearly the equivalent of the vena deferentialis
figured and described by Hochstetter in Varanus =. He does not,
however, mention branches to it from the parietes, such as occur in
Amphisbena. Considering this latter fact and the relations of
the vein to the vas deferens (Wolffian duct), I imagine that it is to
be regarded as a persistent, though small, posterior cardinal vein.
V. Bedriaga, in his illustration § of the viscera and vascular
canals in Amphisbena cinerea, shows veins from the parietes
opening into the vena renalis revehens of the left side. But this
illustration refers to a female example, in which the vein which
I have just described may not exist. Moreover, veins running
along the oviducal membrane and opening into the kidney-system,
such as exist in other Lizards, are obviously not the homologues
* They are, as it appears to me, rightly regarded by Fiirbringer as a suborder
equivalent to Lacertilia vera, Chameleonta, &c.
+ Morph. JB. xix. Taf. xvi. fig. 13.
& Loe. cit. p. 465, Taf. xvi. fig. 17, v.d.
§ Arch. f. Naturg. Bd. 1. 1884, pl. iv. fig. 2, 777°.
486 MR. F. E. BEDDARD ON THE [Noy. 28,
of this vena deferentialis, or posterior cardinal as I prefer to
call it.
Text-fig. 68. Text-fig. 69.
Text-fig. 68.—Kidney, testis, and intervening veins of Amphisbena brasiliana.
K. Kidney; 7.p. Veins from the parietes to the kidney; S.2.p. Suprarenal portals
opening into a cardinal; Z. Testis; V.d. Vas deferens; V.7.eff. Renal efferent
vein; V.V. Parietal veins opening into cardinal.
Text-fig. 69.—Origin of subclavian in Amphisbena brasiliana.
A & B. Aortic arches ; ic. Intercostals; Z.Sel. & R.Scl. Left and right subclavian
MM. Muscle referred to in text.
arterial System *.—As is well known, the carotids in Amphis-
* The arteries of Amphishena (but not of the present species) are dealt with by
Rathke, v. Bedriaga, and Smalian (Zeitschr. wiss. Zool. 1885), the last of whom does
not give many details. ,
1905.] VASCULAR SYSTEM OF LACERTILIA, 487
bena are not jomed by ductus Botalli to the systemic arch.
The left systemic arch in A. brasiliana is considerably larger
than the right.
The left anterior vertebral artery is not exposed for the whole
of its course within the body-cavity. Shortly after its origin
from the right aortic arch, and while its course is still oblique
and towards the left side of the body, it is covered by a muscular
layer, which is a continuation of the thick muscle covering the
vertebral centra in the cervical region, and forming a soft cushion
for the cesophagus to rest upon, and corresponding, I presume, to
the longus colli. ‘This muscle (see text-fig. 69, p. 486), after
crossing the left anterior vertebral artery as already mentioned,
becomes more and more slender and disappears. It is important
to note that it is not symmetrical, and that no corresponding slip
covers the right anterior vertebral artery. This curvature of one
artery at least by a muscular slip seems to me to have a bearing
upon the homology of the arteries,
The origin of these arteries from the right aortic arch, and the
fact that one springs from the aortic stem in front of the other,
is a distinct point of likeness to the subclavians of other Lizards,
which give off an anteriorly running vertebral. The loss of the
fore limbs and the increased importance of the neck for burrow-
ing purposes might account for the disappearance of the main
subclavian stem and the increase of its vertebral branch. The
burrowing of the artery in question beneath the musculature to
which I have referred is found in the case of the subclavian of
Tiliqua*.
There are three very slender wsophageal arteries arising from
the aorta. They are followed by three gastric arteries, of which
the last lies a little way behind the gall-bladder. The mesenteric
arteries have been shown by Rathke vt to differ considerably
among the Amphisbeenide. In the species examined by me
there is a celiac artery followed by a common mesenteric; the
intestine is also supplied by a posterior mesenteric which arises
from the aorta among the renal arteries.
The sper matic arteries arise just after the arteria mesenterica
communis; the right is slightly in advance of the left. They
both arise in common with an intercostal. On the left side an
additional spermatic artery arises very close behind the main
one.
Behind the spermatic arteries a number of fine arteries supply
the vas deferens. Of these I counted six on the left side, and
there are about as many on the right. As a rule (five on the left
side), these arteries arose directly from the aorta and indepen-
dently of the intercostal arteries.
The renal arteries differ in number on the two sides of the
body. I counted four on the left and five on the right side.
* Beddard, P. Z.S. 1904, i. p. 465.
+ Abh. Ak. Wiss. Miinchen, ix. (1863). See also Hochstetter, Morph. Jahrb.
xxvi. (1898).
Proc. Zoou. Sec.—1905, Vor. II. No. XX XIII. 33
488 ON 'THE VASCULAR SYSTEM OF LACERTILIA. | Nov. 28,
They very largely arise in common with intercostals. They do
not, however, show the continuous symmetry and regularity that
is shown by the renal arteries in Ophisaurus. In Amphisbena
cinerea, v. Bedriaga states the presence of 5—7 pairs of renal
arteries, of which the first pair are much the largest and are trace-
able for a long distance along the outer border of each kidney.
The wtercostal arteries in Amphisbena are upon the Lacer-
tilian plan, and not upon that shown in the Ophidia in spite of
the length of the body. They are paired equisized arteries *
each artery of a pair close together in their origin from the
ventral surface of the dorsal aorta. Though these pairs are
regular and repeated with no variation from seement to segment,
there are nevertheless occasional, but very occasional, indications
of a divergence in the direction of the arrangement so character-
istic of the Ophidia other than the Boide. In one case, on the
left side of the body, a single intercostal artery bifurcated
immediately after its origin from the aorta and supplied two
intercostal regions, one in front and one behind. In another
case an intercostal was wanting on the left side, but a branch
from the right corresponding intercostal was seen to pass under
the vertebra and to supply the left side of the body. Very
generally the intercostals branch before becoming lost to sight
within the muscles of the dorsal parietes. There are two divisions
which burrow, and a trunk which runs superficially outwards
between the ribs. This superficial trunk is to be seen in other
Lacertilia, particularly among the Scincide. No intercostals
arise from the left aortic arch, which is, indeed, free from branches
of any kind. Three pairs arise from the right aortic arch.
Lungs.—The trachea and lungs of the present species differ
very considerably from those of Amphisbena fuliginosa, described
and figured by Wiedersheim?. That author figures the lung
as extending considerably anteriorly to the heart, and the trachea
opens into it by a series of short branches of its lower surface.
The arrangement, in fact, is obviously suggestive of the “ tracheal
lung” of certain Snakes, and especially of the genus Ophiophagus,
where, as I myself have recently described, the trachea opens by
a series of orifices into the pre-cardiac portion of the lung~. An
almost exactly similar specialisation in a Snake, or rather in many
Snakes and in a snake-like Lizard, is very remarkable. It seems
possible, in view of the fact that the tracheal lung exists in Snakes
of quite different families, and that it also exists in Amphisbena
fuliginosa§, that this state of affairs is primitive and is to be
referred to an Amphibian ancestor in which the lung, as in the
Frog &e., opens at once into the pharynx without the mtermedia-
tion of any length of trachea.
* V. Bedriaga, however, figures the first few intercostals as arising in an irregular
and therefore snake-like fashion.
if Vergl. Anat. Wirbelth. 2nd ed. 1886, p. 558.
ng den ZS. 1908, vol. 11. p. 322.
§ Smalian, however (Zeitschr. wiss. Zool. 1885), does not find this spunea
1905. ] THE SECRETARY ON ADDITIONS TO THE MENAGERIE. 489
In any case the tracheal lung does not exist in Amphishena
brasiliana. The trachea opens into the lung some way behind
the heart, and is only continued into the lung for a very short
way. The short portion of the trachea which lies within the
lung shows an irregularity in the cartilaginous rings, which are
no longer uniform hoops. The rudimentary right lung is exactly
half an inch long, and, like the long left lung, extends for a short
way in front of the entrance of the trachea. The left lung
reaches down the body as far as the end of the liver. Of the
lung of Amphisbena (presumably the species fuliginosa) Dr. Wie-
dersheim writes in the same work (referred to in footnote) :
‘Die Lunge, deren interessantes Verhalten zur Trachea ich
frither schon erwihnt habe, ist insofern héher entwickelt als
diejenige der Lacertilier, als es kein einheitliches centrales Lumen
mehr besitzt, sondern von einem feinen Balkchennetz durch-
flochten ist.” The lung, in fact, of that species would appear to
resemble that of higher Reptiles, such as the Crocodilia. In
Amphisbena brasiliana there is nothing of the kind to be seen.
The lung is a simple sac as in Lizards generally. It has not,
indeed, even traces of a more complex structure, such as are to
be found in many Lacertilia. The walls show the usual honey-
comb appearance, and they are fairly thick, which would seem to
allow of a considerable inflation of the lung. ‘These important
differences between two species placed in the same genus would
seem to suggest that the genera of Amphisbenide need revision.
They are remarkably analogous, as I have observed, to the differ-
ences which distinguish the Hamadryad Snake from the Cobra ;
and these two are by many authorities confounded in one
genus *.
December 12, 1905.
Howarb Saunpers, Esq., Vice-President, in the Chair.
The Secretary read the following report on the additions that
had been made to the Society’s Menagerie in November 1905 :—
The number of registered additions to the Society's Menagerie
during the month of November was 147, of which 64 were by
presentation, 24 by birth, 9 by purchase, 35 were received on
deposit and 15 in exchange. The number of departures during
the same period, by death and removals, was 166.
Amongst the additions attention may be called to :—
An Abyssinian Guereza (Colobus abyssinicus matschiet) and a
White-tailed Mongoose (Herpestes albicauda) from the Upper
Nile, presented by Mr. J. J. Harrison, on Nov. 3rd.
A Water-Chevrotain (Dorcatherium aquaticum) trom Liberia,
* See Beddard, “On the Trachea &c. of the Hamadryad,” P.Z.S. 1903, vol. ii.
p- 319.
33*
490 ON AN EARTHWORM WITH BIFID TAIL, [ Dee. 12,
presented by Sir Harry Johnston, G.C.M.G,, K.C.B., on Nov.
25th.
A Capybara (Hydrocherus capybara), a Violet-eared Humming-
bird (Petasophora iolata), two Purple Sugar-birds (Cereba cerulea),
two Spotted Emerald Tanagers (Calliste guttata), and a Red-billed
Toucan (Rhamphastos erythrorhynchus), from Caracas, Venezuela,
presented by Capt. Albert Pam, F.Z.8., on Noy, 25th.
The Secretary exhibited a coloured print, published by
R. Ackermann in July 1812, of Polito’s Royal Menagerie at
Exeter Change, London. Mr. Polito died in 1814, and the
Menagerie was taken over by his chief assistant Mr, Cross, a
relative of the well-known Liverpool naturalist. The Exeter
’Change Menagerie became famous in 1827, because of the death
of an Elephant which became infuriated and had to be killed.
The Secretary was indebted to Mr. Howard Saunders, V.P.ZS8.,
for calling his attention to a long account of this occurrence
published in Hone’s ‘ Every-Day Book’ for 1827,
Mr. A. H. Cocks, F.ZS8., exhibited twelve enlarged photographs
of Whales taken by him at the Finwhaling Factories in East
Finmarken in 1883-89. The species represented were Megaptera
longimana, Balenoptera sibbaldii, B. musculus, and B. borealis.
Mr. Geo. P. Mudge, F.Z.S., exhibited an abnormal Dogfish
(Scylliwm canicula) in which the proximal limb of the siphonal
stomach was everted into the pharynx, where it took the form of
a flattened spathulate-shaped sac. Within the sac (which was
lined with ccelomic epithelium) there were contained the distal
loop of the stomach, the spleen and pancreas. That it was a
permanent condition, formed in the course of development, he
believed to be shown by the great length of the lieno-gastric
artery and by the presence of a peculiar triangular-shaped inva-
ginated sac, supplied by this artery, and infolded from the dorsal
surface of the everted loop of the stomach at its anterior end,
Mr. Mudge also exhibited an Earthworm (Allolobophora sp. °)
with « bifid posterior extremity. It was found at Bradfield,
Manningtree, in Essex, and was sent to Mr. Cole, the honorary
curator of the Essex Field-Club Museum, who was kind enough
to lend it to Mr. Mudge for description. The worm was normal
to about the 56th segment, or to rather more than one-half its
length, when it divided into two nearly symmetrical branches ;
the right branch at its origin was just a trifle larger than the
left, but.otherwise the two were equal.
A distinct anal aperture was present at the posterior extremity
of each branch, and indicated that the intestine was branched in
1905. | ON REGENERATION OF THE TAILS OF MICE. 49]
a corresponding way. The dorsal (supra-intestinal) blood-vessel
could be distinctly seen through the body-wall, and it branched in
the same fashion as the body. Hach branch bore its own four
rows of sete.
Mr. H. B. Fantham, B.Sc., F.Z.S., exhibited and made the
following remarks upon microscopic preparations of a new
Hemosporidian parasite belonging to the genus Piroplasma, from
the blood of the white rat :—The parasite is endoglobular and the
trophozoites are ovoid (0°5 to 1:5 » in diameter) or pear-shaped
(2 to 3p long and 1 to 15 broad), and usually uninucleate.
A single pear-shaped trophozoite often occurs alone in a blood-
corpuscle of the host. Some amceboid forms were seen in the
spleen. Schizogony takes place inside the red blood-corpuscles by
simple fission. Double infection of a blood-corpuscle may occur,
while free ovoid forms of the parasite have also been seen.
For this new species of Piroplasma in the white rat, the name
Piroplasma muris is proposed. The parasites are not numerous
in the peripheral circulation of the host, but occur in greater
numbers in the spleen, liver, and bone-marrow.
Some of the pathological effects (piroplasmosis) in the white
rat, due to this parasite, were anemia, biliary fever, alopecia,
emaciation, ulcers on the ears and tail, enlarged spleen, &c., and
proved fatal.
The genus Piroplasma is of great interest, as species of it
give rise in various mammals to serious diseases, usually of the
nature of biliary fever. LP. bigeminwm is the pathogenic agent
of Texas Fever (Redwater) in cattle; P. canis of malignant
jaundice in dogs; P. equi of biliary fever in horses; and P. ovis
of similar diseases in sheep. Piroplasmosis may also occur in the
human subject, e.g. P. hominis is found in the blood of persons
suffering from Spotted or Tick Fever in the Rocky Mountains ;
while the Leishman-Donovan bodies found in cases of ‘“ Kala-
azar” and Delhi boil in India are referred by Laveran and
Mesnil to this genus, as P. donovani. A Piroplasma has also been
stated to have been found in the blood of certain lizards in India,
though details have not yet been published. The symptoms in
the white rat seem to exhibit a combination of those enumerated
in other mammalian hosts.
Piroplasmosis is usually disseminated by ticks; but no ticks
have yet been found on infected white rats. Perhaps the inter-
mediate host in this case is a louse or a flea. No flagellates were
found in citrate cultures of the blood of infected white rats,
though Capt. Rogers, I.M.S., has obtained flagellates from cultures
of P. donovan.
Mr. Oldfield Thomas, F.R.S., F.Z.S., exhibited the tail-vertebrze
of a Dormouse of the genus Hliomys recently received by the
British Museum from Central Asia, and stated that it appearie
to represent a case of regeneration similar to what occurred in
AQ? MR. OLDFIELD THOMAS ON [ Dee. 12,
the tails of Lizards. Any form of regeneration of osseous parts
had been hitherto quite unknown among Mammals*.
The external tail of this Dormouse was about 5 em. in length,
and was thickened, fat, and club-shaped terminally, where its
hairs, 9 or 10 mm. long on its basal portion, lengthened to 25—
28mm. It formed therefore a sort of bushy club, quite different
to the simple distichous tail of a normal specimen. A similar
tail had been described in a Liberian Dormouse (Claviglis crassi-
caudatus Jent.t), but the bones had not been examined.
On extracting the bones of the tail, they proved to be of an
appearance so closely similar to that found in cases of regeneration
in Lizards, that Mr. Thomas had no doubt whatever that they
were of the same nature, and search for further examples fully
confirmed this opinion.
For, firstly, among the collections of the British Museum there
was found an example of a small Graphiwrus from Fernando Po
with a similar club-shaped, bushy tail, always hitherto looked
upon as accidentally broken, and this on being opened proved also
to contain a long regenerated terminal ‘“‘style,” as shown in fig. 71.
But this specimen, like that from Central Asia, was open to the
objection. that being a single individual from an out of the way
locality, it might conceivably represent a normal specific variation,
and not a case of regeneration.
Happily, however, further search had resulted in the discovery
of four specimens of a species of Graphiurus from the Cameroons,
sent by Mr. G. L. Bates, one of which had a club-shaped tail,
with a styliform bony appendix, while the other three had normal
Dormouse tails. This series thus put beyond cavil the inference
already arrived at as to the abnormal character of the specimen
exhibited.
Text-fig. 70 shows the tail-vertebre and regenerated appendix
of the Central-Asian Eliomys, now exhibited. The caudal column
consisted of 11 normal vertebrae, while the proximal end of the
12th was also normal. But distally this vertebra thinned out
into a long slender style, its total length being 15 mm. and its
diameter (after the basal 2 mm.) rather less than 1 mm. At its
tip there was a constriction succeeded by a small thickened knob.
The preceding vertebra measured 6°2 x 1°8.
Text-fig. 71 shows the tail of the Fernando Po Graphiurus.
Here, owing to the original breaking having occurred nearer. the
body, there appeared to be only about six normal vertebre pre-
ceding the elongated terminal one. This latter was 11 mm. in
length, and instead of the knob at the end it had a slightly
crooked point. The drawing would show the position of the point
relative to the general body of the tail.
On breaking the terminal spike across, its section proved to be
* “Tn the Mammals neither the legs nor the tail nor the jaws regenerate, although
several of the internal organs .... have extensive powers of regeneration,’ —Morgan,
T. H., ‘ Regeneration,’ p. 97 (1903).
+ Notes Leyd. Mus. x. p. 41 (1887).
1905. | REGENERATION OF THE TAILS OF MICE. 493
similar to that in Lizards, there being a central tube filled with
soft or cartilaginous matter, and surrounded by a cylindrical bony
envelope, of similar appearance and texture to the true caudal
vertebrae. A proper microscopic examination and report would,
it was hoped, be made by Dr. Ridewood.
In the third specimen from the French Congo the tail had
been broken at about a third of its length, and the regenerated
terminal vertebra, with its spike, measured 15 mm. in length.
Text-fig. 70.—Tail-vertebre and regenerated appendix of a species of
Central Asian Hliomys.
Text-fig. 71.—Tail of a species of Graphiwrus from Fernando Po showing
regenerated appendix. ;
It seemed clear from these specimens, from the type of Claviglis
crassicaudatus, as described by Dr. Jentink, and from the ap-
pearance presented by certain other skins of Graphiurus in the
Museum Collection, that in the not uncommon event of losing
part of their tail, Dormice—perhaps of all species—were able to
supply the place of the lost part by swelling up what remained
into a club-shaped organ, clothed externally with abnormally
long hairs, and supported internally by an elongated rod of bone
growing out of the vertebra in which the break had occurred.
Such a regeneration would be of essential value to the animal,
for, in climbing, the tail was used as a balancer, and, if broken off
494 PROF. J. E. DUERDEN ON CRABS [ Dee. 12,
short, its balancing functions might be restored by the increase
in its thickness and length.
Dr. W. G. Ridewood, F.Z.8., exhibited microscopic sections of
the skeletal tube found in the restored tail of one of the Dormice
(Graphiurus) exhibited by Mr. Thomas. He showed that the
wall was made up of close-set lamelle, producing in a transverse
section a fine concentric striation. Lacune with numerous
branching canaliculi were disposed regularly in relation with the
concentric striations, and the general effect was that presented by
a transverse section of the humerus or femur of a Frog. Internally
to the bony layers and contiguous with the central jelly was a
moderately thick layer, which was clear, homogeneous, and
highly refractive.
Dr. Ridewood also exhibited, by way of contrast, slides of the
skeleton of the restored tail of an Iguana Lizard, the skeletal
tube in this case being composed of calcified fibro-cartilage and
not of bone.
The following papers were read :—
1. On the Habits and Reactions of Crabs bearing Actinians
in their Claws. By J. E. Duerpen, Ph.D., A.R.C.Se.
(Lond.), Professor of Zoology, Rhodes University Col-
lege, Grahamstown, Cape Colony *.
[Received November 29, 1908. |
(Text-figures 72-76.)
Prof. K. Mobius, in 1880 (‘ Beitriige zur Meeresfauna der Insel
Mauritius und der Seychelles’), described the crab Melia tessellata
(Latr.) as having the remarkable habit of holding a living actinian
in each claw. The polyps are carried about in front of the
crab, held in a kind of defensive attitude, and it is assumed that
the actinians, by means of their stinging-threads, may be of
service to the crab as aggressive and protective agents and assist
it In securing its food; while, on the other hand, the movements
of the crab may serve the actinians by bringing them into the
neighbourhood of more prey.
The fact of one animal making direct use of an altogether
different type of animal whereby to obtain its food, employing it
as if it were a weapon or implement, would appear to be unique
among the lower animals, and invoives questions as to the mutual
relationships of the two, the reactions of one towards the other,
* Communicated by Prof. HicKson, F.R.S., F.ZS.
+ The account is given in a footnote (p. 174) to Dr. F. Richter’s Report of the
Crustacea of the Mauritius and the Seychelles Islands, the crab with an actinian in
each claw being depicted on plate xvi. fig. 19.
1905. | BEARING ACTINIANS IN THEIR CLAWS. 495
the manner in which the combination is brought about, and the
peculiarities which each may exhibit in correlation with the
commensal habit.
The note by Mobius is as follows:—‘“‘TI have collected about
50 male and female examples of Melia tessellata, all holding in
each claw an Actinia prehensa |text-fig. 72]. The hooks on the
inner border of claws are bent in a peculiar manner, so as to
hold fast the actinian. I have never been able to withdraw the
actinian from the crab without injury. If the pieces of the ac-
tinian which had been thus withdrawn were allowed to remain in
the vessel along with the Melia tessellata, the latter again seized
them in a short time. If the actinians were cut into pieces they
were again found in a few hours in the claws of the crabs.
Text-fig. 72.
Melia tessellata from Mauritius, holding an actinian in each claw (Richter).
“It is very evident that the actinians by means of the threads
of their stinging-cells are able to assist the crab in securing its
prey, for which the actinian has the advantage of being carried
from one place to another, and by this means is brought into
touch with more animals which serve them as food. We have
here a very interesting case of commensalism.”
Nothing further seems to have been contributed to this
peculiar relationship between crab and actinian until Mr. J.
Stanley Gardiner’s expedition to the Maldive Islands. In the
account of the marine crustaceans of this expedition, Mr. L. A.
Borradaile (‘ The Fauna and Geography of the Maldive and Lacca-
dive Archipelagoes,’ vol. i. pt. 3, p. 250) writes of Melia tessellata
(text-fig. 73, p. 496) as follows :—‘‘ The crab, which lives, like
Trapezia, among the living branches of coral stocks, holding on by
its long slender legs, has for some time been known to be in the
habit of carrying in each chela a small sea-anemone. The object
of this habit is not known, but it is certainly a voluntary act on
496 PROF. J. E. DUERDEN ON CRABS (Deesh2s
the part of the crab, for the actinian is not attached, but held
between the fingers of the Melia, and, if it be taken away, will
be again seized. Usually there is an anemone in each hand, but
sometimes one or both hands are empty. The actinians, which
ie
—- = ri py a
= =
ae Ne
a. Melia tessellata from the Maldive and Laccadive Archipelagoes, bearing in each
claw a sea-anemone; the crab is represented holding on to a living coral stock.
b. The “hand” holding an anemone. Both enlarged. (After Borradaile.) ,
are grasped firmly round the middle below the tentacles, may be
useful, by means of their stinging-cells, either for defence or to
‘fish’ for food with, or perhaps for both purposes. The chelipeds
1905. ] BEARING ACTINIANS IN THEIR CLAWS. 497
are slender and feeble—ill-suited for defence, but at the same
time mobile and well adapted to wield the anemones they carry ;
and, if the crab be threatened, it will stretch out its arms towards
the aggressor, as though it would ward him off with the dis-
agreeable obstacles it thus presents to his attack. Certainly the
fingers cannot be used to take food unless the anemone be first
dropped ; but, on the other hand, the tentacles of the latter are
directed outwards, away from the mouth of the evab. The third
maxillipeds are mobile, with the proximal joints rather slender
and the last three stout, and are fringed with long hairs.
Possibly they are used to catch small organisms for food in much
the same way as those of the China Crabs (Porcellanide), which
part with their chelipeds so readily when they are attacked,
since they do not use them for taking food.
‘Tn any case we seem to have here an interesting example of
the use of an implement by.an animal which, however intelligent,
has at least a very differently organised nervous system from the
Vertebrata. It should be noted that the case is different from
that of a Spider-crab, which sticks pieces of seaweed on its back
and enjoys passively the concealment gotten thereby. For the
Melia carries the anemone in its cheliped—the chief grasping-
organ of the animal, corresponding to the hand of a primate or
the trunk of an elephant—and, whatever its use, it cannot be
a means of passive concealment, to which its size is wholly
inadequate.”
These two accounts leave much to be desired ere we can be said
to have a complete acquaintance with the living relationships
between Jelia and its associated actinians, and thew peculiarities
of habits and reactions.
A short time ago Miss M. J. Rathburn, of the United States
National Museum, forwarded me for identification the actinians
held in the claws of a specimen of Melia. The crab had been col-
lected at Hilo Bay, Hawaiian Islands, by Prof. Henshaw, and the
actinian proved to belong toa species of Bunodeopsis, a genus well
known as occurring in the Mediterranean and the West Indies.
During a recent visit by the author to the Hawaiian Islands,
under the auspices of the Carnegie Institution, for the purpose of
studying the living corals, an effort was also made to procure
other specimens of J/elia and its commensal actinians. On the
second day’s collecting over the reef-flats at Waikiki Beach, near
Honolulu, a single crab carrying actinians (text-fig. 74, p. 498)
was obtained, and another a few days later. During all the sub-
sequent collecting, extending over three months, at various points
of the islands, no other Melias were seen, so that evidently the
species is not so common in Hawaiian waters as in the regions
visited by Mébius and Borradaile.
Both specimens of Melia were found on the dead under surface
of coral blocks, not wandering among the branches of the living
coral as in Borradaile’s experience. Further, Prof. Henshaw,
who has on rare occasions collected the crab at Hilo Bay, also
498 PROF. J. E. DUERDEN ON CRABS [ Dec. 12,
found them on the under surface of blocks of coral. When
kept in the laboratory they would sometimes come from under
the corals and wander over the living polyps.
The following observations were made upon the two specimens
of Melia, and a few notes are added upon an example of Poly-
dectus—another crab obtained which likewise bears actinians in
its claws.
The first Melia collected carried a Bunodeopsis in each claw.
One of the actinians was fully grown, while the other was a mere
fragment having two or three large tentacles and several im-
perfect members. The polyps were held across the column, the
tentacular dise directed upwards and the aboral disc downwards ;
so that when at rest the crab presented the appearance depicted
in fig. 74, where, however, the tentacles have been increased to
their usual number. Usually the crab travelled with its claws
extended a little forwards, sometimes waving them and the
actinians from side to side.
Melia tessellata from the Hawaiian Islands, bearing an expanded actinian in each
claw. When food is placed on the disc of the actinians, the first ambulatory
limbs of the crab reach over and abstract it and pass it to the crab’s mouth.
The actinians were grasped rather loosely, the claws of the crab
being about halfway open, and with a little care it was possible to
free them, though sometimes the minute spines on the inner side of
the claws (text-fig. 75, p. 500) would penetrate and tear the polypal
wall as described by Mobius. The claws seemed very feeble and
during the operation remained open, making none of the attempts
to close and grasp objects, such as one usually experiences when
experimenting with crabs. The imperfect polyp was torn during
its removal, a minute fragment being left on the chela; but the
larger piece quickly recovered from its injuries and expanded its
tentacles to their full degree.
The second Melia held two small sagartiids, these actinians
being of an altogether different type from the unodeopsis.
Both polyps were of about the same size, and were likewise held
across the middle of the column in a partly expanded condition.
The fact that the two specimens of Melia held different forms of
1905, } BEARING ACTINIANS IN THEIR CLAWS. 499
actinians at once makes it certain that the commensalism is not
restricted to a single species of actinian, as might have been
supposed ; moreover, the experiments given below prove that the
individual crab will seize whichever of the two forms is presented
to it. It may be, however, that the commensalism is limited
to these two forms of actinians, Bunodeopsis and Sagartia.
The figure of the actinian which Borradaile gives, reproduced on
p. 496 (text-fig. 73), closely recalls the sagartiids found on the
Hawaiian crabs, though he writes me that it is to be regarded
as only a conventional representation. Richter’s figure (p. 495,
text-fig. 72) is clearly intended for a Bunodeopsis, and there is
no reason to suppose that the form is different from the Hawaiian
species.
Experiments were first conducted to determine the responses
of Melia toward different actinians. The first crab was deprived
of both its bunodeopsids and then placed in a dish in which were
the two sagartiids removed from the claws of the second crab, the
polyps lying free upon the bottom of the dish, not fixed by their
base. The crab walked about for some time, showing no response
whatever which would indicate that it was aware of the presence
of the actinians; many a time it would pass in close proximity to
them without any recognition signs. Happening in its wan-
derings to touch one of the sagartiids, it stopped immediately,
moved its claws around as if examining the polyp, and then
grasped it at an oblique angle and carried it away. After the
crab had moved about for some time longer, with one claw
occupied and the other vacant, the second Sagartiid was inten-
tionally placed so as to touch the unoccupied chela, when it was
likewise examined, seized upon, and carried off.
Thus the crab which originally held two bunodeopsids had now
provided itself with two sagartiids; hence the species of actinian
as regards Bunodeopsis and Sagartia are interchangeable.
One of the sagartiids was now released and placed in the dish
along with its original crab having both chelipeds vacant, the
bunodeopsid fragment being also introduced. After a short time
the Sagartia was seized, and later the small fragment of Buno-
deopsis. The first Melia was also placed in a dish along with its
own bunodeopsis and a Sagartia, and after a time these were
likewise appropriated. Thus each crab was again provided with
two actinians but of different species, the one a bunodeopsid and
the other a sagartiid. In all the experiments the crabs appeared
to seize either one or the other species with equal readiness.
Experiments as to the behaviour of the crabs towards other species
of actinians were very desirable, but at the time no other forms
were available.
The crabs exercised what must unquestionably be considered
an intelligent selection, as far as regards the desirability or other-
wise of an actinian already held by them. <A Melia carrying a
small fragment of a Bunodeopsis in one claw and a perfect
Sagartia in the other was placed in a dish containing the full-
500 PROF. J. E. DUERDEN ON CRABS [ Dec. 12,
grown Lunodeopsis fixed by its base. While walking about, the
crab accidentally came into contact with the large Banodeopsis
and stopped as if to examine it ; then by means of one of its first
ambulatory limbs it began working around the base of the polyp,
and after a few minutes detached it. At the same time it moved
the claw holding the fragment of Bunodeopsis towards its mouth
as if to ingest the polyp, but the fragment was merely liberated
and left free in the dish, and the empty claw then seized upon the
larger Lunodeopsis which it had previously dislodged from its
substratum. The Melia had now a perfect bunodeopsid and a
sagartiid. At a later stage the large Bunodeopsis was removed
and the previously discarded fragment introduced into the dish,
when after a time the latter was appropriated.
The fragment of Bunodeopsis and also a Sagartia were again
placed in a dish containing a Melia with both its claws unoccupied.
These were taken up as soon as the crab came into contact with
them, and a second perfect sagartiid was then placed in the dish.
The crab with both its claws occupied came into contact with the
third actinian, remained near it for some time, and then pushed it
away. On returning fifteen minutes later, however, it was found
that the fragment of Bwnodeopsis had disappeared, and its place was
occupied by the sagartiid ; the J/elia had detached the bunodeopsid
fragment and had taken up the sagartiid in its place. There
appeared to be evidence that the crab will tear a single actinian
in two in order to provide each claw with a polyp.
MertHOD oF HOLDING AND SEIZING THE ACTINIANS.
Usually the actinians were held so loosely within the chelipeds
of the crab that the column was but slightly constricted. Asmen-
tioned by Mobius, the joints of the chele are provided with very
Text-fig. 75.
Claw of Melia tessellata showing the two rows of spines. Much enlarged.
minute spines, and these no doubt assist In maintaining the polyp
in position (text-fig. 75). Occasionally the body of the polyp was
held in such a manner that the column was not altogether within
the claws, and the wall would then be constricted and indented by
the tips of the claws. In preserved specimens the polypal tissues
1905. | BEARING ACTINIANS IN THEIR CLAWS. DOL
are sometimes thus deeply constricted and indented, and in one
instance the body of the polyp was actually pierced by the two
sharp points of the claws coming together. In such cases, it is
conceivable that the crab when placed in preservative fluid had
closed its chele more firmly than usual. Under ordinary cir-
cumstances, the actinians do not seem to be in any way injured
by the crab. Indeed, the polyps show no signs of their peculiar
position being even one of irritation; shortly after seizure they
expand to their full degree and remained in this condition, the
tentacles outstretched and overhanging.
Numerous observations with the crabs deprived of the polyps
lead one to suppose that the actinians are encountered only in a
haphazard manner, and also that the crab makes no response to
their presence until it comes into actual contact with them. When
the crabs with their claws unoccupied were placed in vessels along
with free polyps, they would remain still or wander around in an
apparently aimless manner, even coming close to the polyps
without showing any signs of secoeition. When, however, the
chelipeds happened to touch a polyp the crab would at once
stop, move its chele around the polyp for a few seconds, and then
open the claws and seize hold of it in almost any position, not
necessarily across the column.
In their natural condition, most actinians are firmly adherent
by a broad base to some substratum from which they are with
difficulty dislodged ; and @ priori it is not manifest how the crabs
are able to detach and carry away a polyp thus firmly fixed.
Faurot*, who has studied the habits of various Hermit Crabs
(Pagurus) and their commensal actinians, Sagartia parasitica
and Adamsia palliata, finds that when a Hermit Crab attempts
to remove a fixed actinian it seizes it with its maxillipeds and
ambulatory limbs, and moves these about as if resisting the
escape of some prey. These movements being continued bring
about the retraction of the polyp, and in the end the detachment
of its pedal dise from the surface of the glass or stone. Buno-
deopsids and sagartiids have each adherent bases, and experiments
were made to determine the manner in which they are loosened
by the crustacean. After removal from the chelz the sagartiids
failed to fix themselves, but remained lying free on their sides;
the large Bunodeopsis, on the other hand, readily fixed itself to
the bottom of the glass vessel, to such a degree that it was not
detached by a strong stream of water from a pipette. A Melia
with empty claws was then introduced into the vessel. In time
the crab came into touch with the fixed actinian and began,
as usual, to pass its chele around it, but without effecting its
dislodgment. Then the right member of the first pair of ambu-
latory appendages was brought forward, and its sharp end was
applied between the polypal base and the surface of the glass, exactly
in the manner one would apply one’s finger in attempting to
* Faurot, L.: ‘“‘Htudes sur l’anatomie, l’histologie et le développement des
Actinies,’ Arch de Zool. Exp. et Gén. 3 ser. vol. iii. p. 152.
502 PROF, J, E, DUERDEN ON CRABS [ Dec, 12,
carefully separate an actinian from its attachment (text-fig. 76).
The crab moved round the actinian, inserting the tip of its limb
at intervals, until in the end the polyp was dislodged, when it was
seized and borne away,
Text-fig, 76.
Melia tessellata dislodging a fixed actinian by means of its first
ambulatory limb.
The crab Melia has thus the remarkable power of being able to
detach a sea-anemone fixed to a substratum, proceeding in abso-
lutely the same way as would a collector in endeavouring to secure
the same kind of animal. Manifestly it is only by some such
method that the actinian can be freed without injury, as the
chele, along with the other appendages, are almost useless as
grasping-organs. In other instances where crabs mask themselves
by hydroid, sponge, or algal growths the fragments are simply
torn away by the chelipeds, but the dislodgment of an entire
actinian without injury and without the use of the claws is an
operation much more complex in character, whether we regard it
as an instinctive or an intelligent act.
When first grasped by the crabs the sea-anemones were not
necessarily held in the most favourable position, that 1s, across
the middle of the column withthe disc directed upwards; at the
beginning the chelz seized them in almost any fashion, so that
the disc and tentacles were directed at anangle. In one instance,
an actinian which had been thus grasped in an irregular manner
was turned towards the maxillipeds and there held in position
by the first ambulatory limbs; the chela was then freed from
the actinian, cleansed thoroughly, and finally seized the actinian so
that it was held across the middle with the dise directed upwards.
There seems some evidence also that the actinians themselves
institute righting reactions, such as they carry out under more
natural conditions; so that, although at first grasped in any
position, they are ultimately held across the middle with the
1905. ] BEARING ACTINIANS IN THEIR CLAWS. 503
oral dise and tentacles turned upwards, this being the usual rela-
tionship when first captured.
Whenever an actinian was removed from the claw of a crab,
certain cleansing-operations on the part of the latter invariably
took place. Ordinarily the claws have particles of débris adhering
to the hairs with which they are provided, as well as to the general
surface of the skeleton, the amount being undoubtedly increased
by the presence of mucus from the actinian. On the chelipeds
becoming unoccupied they were turned towards the mouth, and
the masticatory appendages, which are richly provided with bristles
and spines, at once began a series of scraping or combing move-
ments over them. So effective were these, that within a short
time the claws were altogether cleansed of any adhering foreign
particles and presented a much fresher appearance.
REACTIONS.
Under ordinary circumstances the crab when at rest holds its
two chelipeds bent towards itself, and the actinians are inclined
upwards and outwards with the tentacles fully expanded, thus
masking to a certain extent the anterior part of the crab. When
walking the chelipeds are held more forwards, and the actinians
are then presented in what can be best described as a threatening
attitude. It would be impossible for any animal of moderate
size to molest the crab in front without touching the polyps. Some-
times the claws are held downwards so that the polyps touch the
bottom of the vessel, and on being dragged over it the mucus with
which the body is covered leads to the adherence of debris.
If any part of the crab be touched in front, the reflexes are such
that the chelipeds are at once extended in the direction whence the
stimulus proceeds, the polyps being thereby raised and presented
in a defensive attitude. Likewise when irritated from the side,
poth chele are turned laterally, the polyps again being directed
towards the region whence the stimulus comes. Similarly, if
touched on the upper surface of the carapace or posterior part of
the body, the actinians are turned upwards and backwards: in
fact, by varying the part stimulated, the chelipeds can be made
to turn through about two-thirds of a circle ina vertical direction,
and in addition they can perform complex lateral movements. In
every case, it may be said that the responses of the crab are of
such a nature that the claws bearing the actinians are turned
towards the part irritated, thereby placing the polyps in a position
most favourable for defence or offence. The reflexes are usually
rapid and continue for some time, first in one direction and then
in another, according to the region irritated. At the same time
the crab generally moves away from the stimulus, backwards or
forwards, though the claw reaction, the striking out, always occurs
as a preliminary measure: retreat on molestation is by no means
so readily resorted to as in most crabs.
It is of much importance to find that exactly the same responses
Proc. Zoou, Soc.—1905, Vou. II. No, XXXIV. 34
504 PROF. J. E. DUERDEN ON CRABS [ Dec. 12,
to stimuli take place in a Melia deprived of its actinians as when
they are present, but the empty chelipeds make no attempt what-
ever to grasp the source of irritation as in ordinary crabs. The
movable joint (dactylopodite) remains partly open, to about the
same degree aS when holding an actinian, and its use as an
organ for direct protection or attack seems to have altogether
disappeared.
The responses of the chelipeds are manifestly so many instinctive
reflexes on the part of the crab, directed towards the region whence
the irritation comes, and are carried out independently of the
presence or absence of the actinians. When the latter are in
position, the reactions may be assumed to be aggressive or pro-
tective in their nature; while when taking place in the absence
of the polyps they are of no protective value, as the claws are
useless for grasping or seizing.
Compared with most crabs, it would seem that there is in Melia
a marked increase in the power of directive response on the part
of the chelipeds, accompanied by a loss of activity on the part of
the movable joint which ordinarily serves for aggressive purposes ;
moreover, the chelipeds as a whole are greatly reduced in size,
Frepine REACTIONS.
Under ordinary circumstances, the Melias were often seen trans-
ferring towards their mouth the débris occurring on the bottom
of vessels or other objects over which they passed. This they
accomplished by means of the maxillipeds, with the assistance of
the first, second, and even third pair of ambulatory limbs, the
first ambulatory pair being the most active. The débris was
seized by the maxillipeds, and the nutritive particles were ingested,
and the non-nutritive rejected and wafted away posteriorly. The
chelipeds, whether empty or holding actinians, took no part
whatever in the feeding processes. Even fragments of meat given
directly to the crab were treated in the same manner ; their
passage to the masticatory appendages was effected by the first
ambulatory limbs, always without the assistance of the chelipeds.
As the actinians were dragged about from place to place, débris
readily adhered to them by means of the viscid slime with which
they were covered, and very frequently the first ambulatory limbs
were applied to the polypal walls, and the latter were thoroughly
cleansed from any adhering particles. The operation was carried
out much in the same way as that by which the crab cleansed its
own limbs. During the process the actinians were brought close
to the mouth, and the débris removed was easily transferred
thereto by the appendages. Some of the particles were nutritive,
and there is no question that the crab will frequently secure food
material thus mechanically adhering to the walls of the polyp.
No instance was observed where the crab applied its appendages
to the general body-surface of the polyps except when foreign
particles were adherent. Durimg the cleansing treatment the
1905. ] BEARING ACTINIANS IN THEIR CLAWS. 505
actinians remained altogether passive without even retracting ;
sometimes the points of the maxillipeds would penetrate the
delicate flesh of the polyps and be freed only after a strugele.
By far the most unique and remarkable reactions were those
observed when the actinians were supplied with food. When
shreds of meat were placed on the dise of the polyp, the latter
responded in the usual manner of actinians by bending its ten-
tacles towards the disc and partly closing over the food. If the
pieces were too large to be wholly covered and readily ingested,
the crab seemed to be soon aware of their presence, and would
then bring forward the hook of one of the first ambulatory limbs
and apply it to the oral disc from time to time until all the
fragments of food were removed and transferred to its own
mouth. Thus the freshly broken chela of a small Alpheus was
placed upon the oral disc of the actinian so carefully as not to
touch any part of the Melia. Immediately the polypal tentacles
closed over it preparatory to ingestion, but before the process was
accomplished the first ambulatory limb of the crab reached over
among the tentacles and dragged away the fragments to its own
mouth.
If the fragment were sufliciently small as to rest wholly on the
disc of the polyp, and the latter quickly opened its mouth to
swallow it, the Melia might then exhibit no responses and the
actinian appropriated the food. But in very few instances in a
number of feeding experiments were the ingestion reactions of
the actinian sufficiently rapid as to wholly indraw the food before
the crab would extend an ambulatory limb and vigorously abstract
it. Im some instances the fragments were already partly swallowed
by the polyp when the crab, receiving some stimulus, would extend
an ambulatory limb to the polypal disc, and actually abstract the
food from the stomodeum of the actinian and transfer it to its
own mouth.
The feeding experiments were sufficient to demonstrate beyond
all question that Melia actually takes away and appropriates to
itself the food procured by the actinian. In the language applied
to human actions, it can be truly said that the crab robs the
actinian of its food, though no one would think of introducing
ethical considerations into the act, even if consciousness could be
established.
What are the means by which the crab is made aware of the
presence of food-material on the dise of the actinian, or, rather,
what determines the very definite responses of the chelipeds
towards the dise of the actinians? It is certainly not a tactile
reaction, for the responses took place when the food-particles
could not possibly have come into contact with the crab or any
of its tactile organs. It may have been that the movements of
the polyp during ingestion produced some stimulus which was
transmitted through the chelipeds, but ordinary stimulation of
the actinian by mechanical means failed to call forth any responses
on the part of the crab, It is most probable that the reaction is
34*
506 PROF. J. E. DUERDEN ON CRABS | Dec. 12,
a result of stimulation by the meat juices emanating from the
food on the disc. Fragments of meat or meat extract diffused
around the anterior part of the crab called forth vigorous move-
ments of the mouth-appendages and first pair of walking-legs,
though directed towards no very definite end; but when the
extract was applied towards one side or the other, there was a
decided movement of the appendages in that direction. Similarly,
juices emanating from the food on the polypal disc may be
assumed to serve as the stimuli by which the reflexes are brought
about, the source of the stimulation and direction of response
being determined from the direction in which the juices reach
the crab.
When non-nutritive particles, such as fragments of shell or
grains of sand, were placed upon the polypal disc they produced
no movements on the part of the actinian; likewise there was no
response from the crustacean. Also in other cases substances
which called forth no responses on the part of the actinian failed
to bring about reactions from the crab. A small spider fallen
into the water, and thereby drowned, was given the actinian.
The tentacles closed over it momentarily, then withdrew, leaving
the spider exposed on the disc. In this case the crab made no
attempt to abstract the spider from the polyp, and after a time it
was rejected by the latter. Fragments of bread and small pieces
of paper placed on the polypal disc called forth no response from
the actinian nor any from the crab. In fact, throughout the
observations the actinians and crabs responded or remained in-
different to the same substances; in each case ingestion reflexes
took place only towards nutritive substances from which stimula-
tive juices might be supposed to emanate, while there was
indifference or rejection towards what might be supposed to be
non-nutritive substances. Where the food supplied was so small
in bulk that the polyp ingested it without any attempt at ab-
straction on the part of the crab, we may assume that the nutritive
juices were so weak that they failed to reach the sensory organs
of the crab, and thereby failed to stimulate it to activity.
PoLYDECTUS.
While searching among the blocks of coral rock for further
examples of Melia, a single specimen of Polydectus cupilifera
(Latr.) was secured, also bearing an actinian in each claw. Both
in its form and behaviour the new crab presented a great contrast
with Melia. The former is very hairy, sluggish, and irresponsive,
while the latter is active and most readily responds to stimuli of
all kinds.
The actinians held by Polydectus were small specimens of a
species of Phellia, which occurs in abundance on the under surface
of rocks and stones all round the Hawaiian Islands. Externally
the polyps are characterised by having a thick cuticle over the
greater part of the column, a circular area at the apex (the
1905. ] BEARING ACTINIANS IN THEIR CLAWS. 507
capitulum) alone being naked. In aquaria they are very inactive
and do not readily expand.
Polydectus was under observation for only two or three days,
and during most of that time it remained quiescent, hidden under
fragments of coral. It allowed itself to be pushed over the floor
of the vessel, making only a feeble attempt to escape, and showed
little or no activity with its chelipeds. If irritated, the chele
were not directed against the source of the stimulus as in the case
of Melia. When the actinians were gently removed from the
claws and after a time again presented, the crab made no imme-
diate attempt to seize them. On the whole Polydectus proved
itself to be a most unsuitable crab for experimental studies.
INTERDEPENDENCE OF CRAB AND ACTINIAN.
Enquiry may now be made as to how far the crab and its
actinians are interdependent. Can the crabs maintain their
existence deprived of the actinians, and can the latter exist
separated from their captors? Although a careful search was
made during three months’ collecting, no free independent
examples of either Sagartia or Bunodeopsis, the actinians com-
mensal with Mela, were met with, and neither Mobius nor
Borradaile speaks of finding such. There seems no reason,
however, why the actinians should not be able to live separated
from the crustaceans. Compared with closely allied species
elsewhere, they present no modifications whatever which indicate
a correlation with the commensal habit. So far as the actinians
are concerned, their presence in the claws of the crab seems of the
most incidental character, and it can scarcely be doubted that
ordinarily they are fixed isolated species, and may yet be found
as such either in the Hawaiian Islands or elsewhere. As regards
Polydectus and its associate Phellia, the latter certainly exists
independently of any commensalism, for all round the Hawaiian
Islands specimens of the sea-anemone are very numerous, attached
to the under surface of stones and coral blocks. These places
also constitute the habitat of the crab. In the case of the
actinians Sagartia and Adamsia, commensal with hermit crabs,
Faurot has shown experimentally that the polyps do not live
long when separated from their host; but the relationship on
the part of the actinian is here much closer than in the polyps
simply held by Melia and Polydectus. In Sargartia palliata, at
any rate, the commensalism is correlated with a permanent
modification of form.
The genus Lunodeopsis occurs also in the West Indian and
Mediterranean seas, where it lives in shallow water loosely
adherent to the leaves of the marine phanerogams Thalassia and
Ruppia. In these regions, however, it is never found associated
with crabs; indeed, the genus J/elia is absent from the Atlantic.
A careful comparison of the external characters and internal
anatomy of the Hawaiian and West Indian species of Buno-
508 PROF. J. E. DUERDEN ON CRABS [ Dec. WAR
deopsis shows no important differences, and they may have to be
regarded as one and the same species. Hence the commensal
habit may be regarded as not essential to the life of Buno-
deopsis, and the same can also be said of the Sagartia and
Phellia.
Of all actinians, members of the genus Bunodeopsis would
appear to be the best adapted for the réle of commensalism.
They are active polyps with long tentacles which are usually
expanded to their full extent, and in the absence of a sphincter
muscle the column is incapable of overfolding the tentacles. The
tentacles are provided with nematocysts of several sizes, and very
large stinging-cells occur in the spheroidal outgrowths on the
column; and, lastly, the polyps are easily detached from any
substratum to which they may be adherent. Were the com-
mensalism of Melia restricted to Bunodeopsis, its suitability for
such a relationship is so pronounced as to suggest more than a
haphazard selection on the part of the crab. But when we
consider that the same crab will also take up a Sagartia, 1t must
be admitted that the wisdom of its selection is not so manifest ;
for this form retracts readily on slight irritation, does not
re-expand so freely as Bunodeopsis, and is usually very firmly
attached to its substratum. Phellia, so far as observations
upon its activities in aquaria go, seems even less desirable than
Sagartia for the ccenobiotic habit.
As regards the dependence of the crabs upon the actinians, the
case seems much clearer. Owing to the absence of the usual
junctions of the claws, the commensal habit would appear to be
necessary to the existence of Melia. The claws, when deprived
of the anemones, showed no power to grasp or seize other objects,
not even when food was presented to them. The maxillipeds and
ambulatory limbs transferred to the mouth any nutritive objects
offered, but from their non-chelate character these appendages
can be of little use in seizing or holding prey or warding off
enemies. There is no question that the procuring of food by the
crab itself would be very precarious were it not for the assistance
of the actinians. Moreover, wherever met with, throughout its
wide distribution, the crab is found to bear actinians. According
to the observations of Mobius, all the specimens of Melia collected
by him possessed polyps, though in Borradaile’s experience they
were sometimes absent from both claws, or from only one. It is
to be expected that the crabs will occasionally lose their polyps,
especially during ecdysis, and conceivably they may wander about
for a time without meeting with others.
If we attempt to estimate the advantages of the commensalism
to the two organisms concerned, it must be admitted that the
result seems to be entirely one-sided, and in favour of the crus-
tacean. The experiments show that the reflexes of the crab are
of such a nature as to result in the removal of any food or prey
which the actinian may secure. The tentacles of the polyp move
about freely and seize and retain organisms coming within their
1905.] BEARING ACTINIANS IN THEIR CLAWS. 509
reach, passing them towards the middle of the disc, from which,
however, they are abstracted by the ambulatory limbs of the crab.
Enemies to the crab, too large to be held by the tentacles of the
polyps, may nevertheless be warned off by the stinging-cells of
the anemone emitted on irritation. A careful consideration of
all the cireumstances justifies the view that the crab will secure
much of its food through the activity of the anemones, and,
further, that the latter will exercise a protective influence upon
the crab against larger enemies. The advantages to the actinian
appear largely negative. As Mobius suggests, the movements of
the crab will serve to bring the actinian into the neighbourhood
of more prey, but its chances of ultimately appropriating to
itself much of this seem very small. The feeding experiments
demonstrated very clearly that it is only rarely that the actinians
succeed in ingesting their food ere it is withdrawn by the crab.
In the case of the actinians Sagartia and Adamsia, commensal
with hermit crabs, it is usually considered that the polyps secure
fragments of the food torn up by the masticatory appendages and
slipping away, but it is not likely that this occurs with Melia.
Independently of the actinians, the crab can only obtain such
food as may be lying upon the sea-floor and incidentally come
upon the maxillipeds and the ambulatory limbs.
The acquisition of such a peculiar commensal habit on the part
of two wholly distinct types of crabs, Melia and Polydectus, cor-
related, in the case of the former at least, with a diminutive size
and partial loss of activity on the part of the chelipeds, does not
admit of ready explanation. Among the activities of other
crustacea there appear to be no examples which help us to
understand how such behaviour and structural peculiarities have
become established—no simpler or intermediate stages which
suggest the lines along which the evolution has taken place.
In the well-known instances of masking-crabs (Stenorhynchus,
Dromia) we have the tearing away of suitable objects, such as
zoophytes, alge, and sponges, which are then affixed to the shell ;
but the instinctive processes involved therein are less complex
than in the cases under consideration. In the latter the ordinary
aggressive and tearing functions of the chelipeds are replaced by
those of merely holding a living example of another group of
organisms. Even the seizure by a crab of an anemone and the
affixation of it upon a gastropod shell, as in the well-known
hermit crabs Pagurus, and the actinians Sagartia parasitica and
Adamsia palliata, involves much less of a departure from the
usual activities of crustacea.
As in so many morphological and physiological phenomena in
nature where intermediate stages are not forthcoming, it is
difficult to see how such an instinct could have been acquired
or evolved by slow degrees. For instance, while holding the
actinians the crab could not at the same time employ its claws
for the usual purpose of seizing and conveying food to its mouth.
One is constrained to think of mutation as a possible explanation
510 ON CRABS BEARING ACTINIANS IN THEIR CLAWS. [Dec. 12,
of commensalism of such a nature, to conceive that a similar
instinct has appeared suddenly in the case of two distinct species
of crab, and its possession proved favourable to the survival of
the individuals. Such an explanation may suffice until it can be
put to experimental test, or until extended observations on the
activities and structure of animals render the theory of mutation
as plausible in the animal kingdom as from De Vries’s work it is
among plants.
SUMMARY.
1. The commensalism between the crab Jelia tessellata and
actinian polyps is not restricted to a single species of actinians.
Of two crabs captured, one carried a Bunodeopsis in each claw
and the other a Sagartia.
9. As regards the same crab the two actinian species are
interchangeable, and the crabs will dislodge a small polyp of
one species to take up a larger polyp of another (intelligent
selection).
3. Apparently the crab is not aware of the presence of
an actinian until it comes into tactile connection with it.
Dislodgment of a fixed actinian is brought about by the inser-
tion of the first ambulatory limb between the polypal base and
the substratum.
4, The crab travels with the actinians expanded and directed
forwards, sometimes waving them from side to side. When
irritated it responds by moving its chelipeds towards the source
of irritation, thereby placing the actinians in what may be con-
sidered as the most favourable aggressive or defensive attitudes.
The crab reacts in the same manner, whether carrying the
actinians or deprived of them.
5. Food given the polyps is abstracted by the crab by means
of its first pair of walking-limbs, the stimulus to activity being
derived from the diffusion of the meat juices.
6. In correlation with the commensal habits the crabs have no
direct use of the chelipeds as aggressive or defensive organs, or
for grasping objects other than the actinians, and the functions
of the first ambulatory appendages are partly modified.
7. The commensal actinians present no structural or physio-
logical modification compared with closely allied free species
elsewhere.
8. The ceenobiotic habit seems to be necessary for the existence
of Melia, though not for that of the actinians.
9. A second species of crab, Polydectus cupilifera, also bears
an actinian, Phellia, in its chelipeds; specimens of the actinian
ave also found adherent to stones and coral rock in the natural
habitat of the crabs. Thus in all probability a similar commensal
habit has been acquired independently by two wholly distinct
forms of crabs.
10. The advantages of the commensalism to the crab are (1) that
1905.] oN SNAKES FROM JAPAN AND THE LOO CHOO ISLANDS. 511
it secures most of its food from the activity of the anemones in
capturing small organisms, these being afterwards abstracted by
the crab; (2) a possible protective influence against enemies
by the ejection of stinging-cysts as a result of the irritation of
the polypal tentacles. The only possible advantage to the
anemone would seem to be that of being carried about by the
erab, whereby it may be brought into contact with more prey,
against which is the disadvantage of having much of its food
abstracted by the crab.
2. Notes on a Collection of Snakes from Japan and the Loo
Choo Islands. By Captain F. Watt, C.M.Z.8., Indian
Medical Service.
[Received August 28, 1905. ]
I am indebted to Mr. Alan Owston, of Yokohama, for the
opportunity of examining a large number of Snakes collected by
him in Japan and the Loo Choo Islands. Of a total of 513
specimens, 461 are Land Snakes; and the special interest of the
collection lies in the extensive and representative area in which
the specimens have been captured, for besides a large number
obtained from Japan itself and many from all the important
islands of the Loo Choo Group, examples have been obtained from
the two islands, Tanega and Yaku, interposed between Japan and
the Northern Loo Choos. They are distributed as follows :—
( Yuzo.
1. Ancistrodon blomhoffit. (1) 1
Hownpbo.
1. Tropidonotus vibakart. (14) )
2. - tigrinus. (53)
3. Dinodon japonicus. (1)
4. Coluber conspiciilatus. (18) 165
5 » climacophorus. (11)
6.- ,, guadriwirgatus. (30)
7. Ancistrodon blomhoffit. (38)
TanEeGA ISLAND.
Japanese.
|
. Tropidonotus tigrinus. (1)
2. Coluber conspicillatus. (1) 3
3. Ancistrodon blomhoffit. (1)
Yaxku IsLanp.
. Tropidonotus tigrinus. (2)
. Coluber quadrivirgatus. (2)
Ancistrodon blomhoffii. aD)
Lachesis okinavensis. (1) |
co ee
_—
He Oo bo
512 CAPT. F. WALL ON SNAKES FROM | Dec. 12,
C AMAMI.
1. Tropidonotus pryert. (3)
2. Dinodon senicarinatus. (3) |
? 3. Ablabes semicarinatus. (3) 37
o 4, Hemibungarus japonicus. (4) (
6 = Jee é
| 5. Lachesis okinavensis. (3) |
: 6. 4, flavoviridis. (21) J
= OKINAWA.
- 1. Tropidonotus pryert. (54)
iw 2. Dinodon semicarinatus. (19) |
3. Ablabes semicarinatus. (131) 934
4, Hemibungarus japonicus. (6) r "
5. Lachesis okinavensis. (4) |
(UG: » flavoviridis. (20) }
Miyako.
1. Dinodon rufozonatus. (2) 5
E 2. Lachesis mucrosquamatus. (3)
§ IsHIGAKI.
© 1. Dinodon rufozonatus. (2)
fe) : 3
3 2. Coluber schmackerr. (1)
oe [TRIOMOTE.
8 1. Tropidonotus pryerc. (1)
2. Dinodon rufozonatus. (4) 7
3. Ablabes hermine. (1)
L 4. Lachesis mucrosquamatus. (1) |
IDeyngl SMES s5.40d080500 461
SealSmakesii i jesse: 52
Motel cecnasaee essa oneir 513
Hitherto the Snakes from the Loo Choo Archipelago have
been simply labelled “Loo Choos,” with no special reference,
except in a few instances, to the particular islands from which
they were obtained (vide Boulenger, Cat. Snakes Brit. Mus.
vols. iiii.). Thanks to the careful and methodical way in which
Mr. Owston has labelled his specimens, more than a usual interest
attaches to his collection, for it shows that the distribution of the
species in this region is restricted to very definite zoological areas.
Three such may be recognised by a glance at the above-given list:—
(1) The Japanese area, with which the islands of Tanega and
Yaku must be included. It will be noticed that all the species
from these two islands belong to the Japanese Snake fauna except
Lachesis okinavensis, a single specimen of which, curiously enough,
was collected in Yaku. (2) The North Loo Chooan area, com-
prising the islands Amami and Okinawa. ‘The six species collected
1905. ] JAPAN AND THE LOO CHOO ISLANDS. 513
in this area are peculiar to it, except Lachesis okinavensis, which
encroaches upon the Japanese area on Yaku, and Tropidonotus
pryeri, which extends further south into the next division. (3) The
South Loo Chooan area, comprising the islands of Miyako, Inio-
mote, and Ishigaki. Only 15 specimens were collected in this
area, including 5 species. Two of these extend to Formosa, viz.,
Lachesis mucrosquamatus and Dinodon rufozonatus ; one 1s common
to the whole Loo Chooan area, viz. Tropidonotus pryeri; and the
remaining two hitherto have only been obtained from this area,
viz. Coluber schmackeri and Ablabes hermine.
Group 1. JAPANESE SNAKES.
Family COLUBRID, Subfamily CoLuBRIn«&.
1. TRoprponorus vIBAKARI.—The 14 specimens were all obtained
from Japan (Hondo)*. The supralabials were eight with the
fourth and fifth only touching the eye in three specimens, and
eight with the third, fourth, and fifth touching the eye on
one side in one specimen. The anterior chin-shields touched five
infralabials in one specimen. One example captured in July
contained five eggs, the largest measuring 1,4," x 8".
2. TROPIDONOTUS TIGRINUS.—Of 56 specimens, 53 were collected
in Japan (Hondo), two in Yaku, and one in Tanega. ‘The supra-
labials were eight with the fourth and fifth touching the eye in
two, the postoculars two on one side in one. The loreal was con-
fluent with the postnasal on both sides in three, and on one side in
one. A toad had been ingested in two examples.
3. Dinopon JAponicus.—A single normal specimen was obtained
from Yamanashi (Hondo). The ventrals were 202 and the sub-
caudals 74.
4, CoLUBER CONSPICILLATUS.—Of 19 specimens, 18 were from
Japan (Hondo) and one from Tanega Island. The temporals
were two in one Hondo specimen, and the scales 23 in another
Hondo specimen in the middle of the body. Ventrals and sub-
caudals were as follows in five specimens :—209+71, 203+ 64,
214471, 217466, 221+69 (the fourteenth and fifteenth sub-
caudals entire). The Hondo adult examples, with one exception,
were uniform brown with each scale outlined darker ; the belly
rose or cherry-coloured, with a double series of large, rectangular,
black, median spots frequentiy confluent across the belly ; two
* Boulenger, op. cit. vol. i. p. 221, mentions Formosa as a habitat for this species.
If this is correct, it is a very singular circumstance. ‘There are no other instances
of Japanese species occurring in Formosa, except Dinodon rufozonatus and Ancis-
trodon blomhoffii. ‘The existence of both in Formosa is easily understood, since they
are common snakes on the Chinese mainland, and the Formosan Snake fauna is com-
posed almost entirely of Chinese species. In the case of Tropidonotus vibakari,
however, it is significant that it has not been recorded from China (except Manchuria)
and it does not occur in the Loo Choos. I am prompted to regard this record as an
error.
514 CAP. F. WALL ON SNAKES FROM [Dec. 12,
chevrons on the head, the anterior converging in front of the eyes,
divergent behind to form postocular streaks, the posterior con-
verging on the frontal, both often obscure or almost obliterated.
Tn one the belly was sparsely spotted and in another was whitish
and unspotted. The young were pinkish-brown or dove-coloured
with small black dorsal spots, with an inclination to a transverse
distribution; the belly whitish chequered black. One Hondo
adult specimen had preserved the peculiar colouring and dorsal -
spots of the young, but the belly was rosy, as is usual in adults.
In this specimen the scales in mid-body counted 23. The example
obtained in Tanega Island was a very distinct colour-variety,
singularly resembling a Dinodon japonicus at first sight. It was
light brown with well-defined black bars, as wide as the intervals.
A series of large spots in the flanks alternated with the dorsal
bars. The usual head-marks were present and the belly was
chequered black and white.
5. CoLUBER CLIMACOPHORUS.—AIl the eleven specimens were
obtained from Japan (Hondo). In four specimens the scales were
25 in mid-body, in all the rest 23. The subocular was absent in
one. Temporals three in one. Postoculars three on one side
in two. Anterior chins touched four infralabials im two. One
captured on 6th July contained 14 eggs with no trace of embryo,
the largest of which measured 2" x 1335".
6. COLUBER QUADRIVIRGATUS.—Of 32 examples, 30 were collected
in Japan (Hondo) and two in the Island of Yaku. In one Hondo
specimen the supraiabials were nine with the fifth and sixth
touching the eye on one side. Postoculars three on one side in
one specimen. Nearly all belonged to Boulenger’s Variety A*.
The young were lighter in colour, with well-marked spots or cross-
bars, but the longitudinal stripes faint or absent. One of the
Yaku specimens belonged to Variety B, and the other was inter-
mediate between A and B.
Family VIPERID. Subfamily CroraLin#.
7. ANCISTRODON BLOMHOFFIt.—-Of 41 specimens, 39 were from
Japan (Hondo 38, Yezo 1), one from Tanega Island, and one
from Yaku Island‘. In only one Hondo specimen were the
scales 23 in the middle of the body, but this number was present
in both the specimens from Tanega and Yaku. The ventrals and
subcaudals in the Yaku example were 143+ 53, and in the Tanega
example the ventrals were 142. One had eaten a frog. One
captured on the 27th June contained three immature eggs with
no trace of embryo.
* Op. cit. vol. ii. p. 60.
+ It is doubtful whether the specimen in the British Museum labelled Okinawa
(Boulenger, op. cit. vol. ili. p. 526) is correctly recorded. It appears to be the only
specimen reported from the Loo Choo Group of islands, where it is singularly out
of place. Tsu Sima is an island im the Corean Strait, and not in the Loo Choos as
stated by Boulenger on the same page.
1905. | JAPAN AND THE LOO CHOO ISLANDS. 515
Groups 2 and 3. Loo CHoo SNAKES.
Family CoLUBRID. Subfamily CoLuBRIN”.
1. TRopmonorus pryert.—Of 58 specimens, 54 were obtained
from Okinawa, three from Amami, and one from Iriomote. There
were two postoculars on one side in one specimen. Four contained
eggs with no trace of embryos.
1 killed 20th April had 3 eggs, largest 157" $f".
4)
Daas at es Manta Hoy ah as My about 1” long.
1S ED Yee RR ARSON, “i 142" long.
1 ,, 8th May ay, 8 a"
” ” 9) *
The size of the eggs first alluded to 1s very remarkable con-
sidering the size of the species. The mother measured 2 feet
2 inches, tail slightly docked.
9. DInopon RUFOZONATUS.—OF eight specimens two were from
Miyako, two from Ishigaki, four from Iniomote. The two speci-
mens from Miyako were peculiar in colour, being of a much lighter
brown than usual. Each had 21 whitish, dark-margined dorsal
bars. The ventrals were 182 and 189.
3. DINODON SEMICARINATUS.—Of 22 specimens, 19 were from
Okinawa and three from Amami. The supralabials in one were
eight with the fourth and fifth only touching the eye. One had
swallowed a fledgling, and another a lizard.
4, ConuBer scuMACKERI.—A single specimen, much mutilated
and of large size, was obtained from Ishigaki. The supralabials
were nine on the right side with the fifth and sixth tonching the
eye, ten on the left side with the sixth and seventh touching the
eye. The loreal was more than twice as long as high. The upper
of two preoculars nearly touched the frontal.
5. ABLABES SEMICARINATUS.—Of 134 specimens, 131 were from
Okinawa and three from Amami *.
6. ABLABES HERMIN#.—The single specimen was from Iriomote.
It was an aberrant example in that the scales number 19 in mid-
body. Anteriorly and posteriorly the normal 17 scales were
present. Ventrals 159 and subcaudals 60.
7. Hemipunearus sAponicus.—Of ten examples, six were from
Okinawa and four from Amamit. Those from Okinawa were all
alike in having five longitudinal black dorsal lines broader than the
ink intervals. There were 9-12 narrow black annuli round the
body and 1-2 (2 usually) on the tail. The ventralsand subcaudals
* There seems but little doubt that Japan has been incorrectly included as a
habitat for this species and for Hemibungarus japonicus. Boulenger is clearly of this
opinion (vide op. cit. vol. 111. p. 395 footnote). These species were originally described
and figured by Giinther (Ann. & Mag. Nat. Hist. (4) i. 1868, pp. 418 & 428) from
one specimen of each reported to have come from Nagasaki. Thirty-seven years
have now elapsed without either being rediscovered in Japan,
+ See footnote to Ablabes semicarinatus.
516 ON SNAKES FROM JAPAN AND THE LOO CHOO ISLANDS. [Dec.12,
are 204428, 183+28, 194430, 202+ 2, 197427, 1294 29.
Two specimens from Amami agreed in having three longitudinal
dorsal, black lines, narrower than the pink intervals. One of
these had indications of another line in the flanks on each side.
One had 12 and the other 14 black annuli. Both were peculiar in
that the last ventral was divided, a condition which obtains in no
other specimen, and this may constitute a separate species. The
ventrals and subeaudals were 2084+ 29 and 198+28. The remaining
two specimens from Amami were pale pink with a single, narrow,
vertebral black line. One had 15 and the other 13 black annult,
and the ventrals and subcaudals were 215+ 28 and 214430. One
of the Okinawa examples had swallowed a lizard measuring
41 inches. The snake was 1 foot 73 inches in length, and the
lizard occupied a position entirely posterior to the tenth inch im
the snake’s length. The stomach was therefore placed unusually
far back in this species, and I have noticed a similar peculiarity
in an allied snake, Bungarus candidus, in India,
Family ViPERIDA. Subfamily CrotaLIné.
if Nf
8. LACHESIS OKINAVENSIs.—Of eight specimens four were from
Okinawa, three from Amami, and one from Yaku. ‘The scales were
93 in mid-body in all except one specimen, where they were 24.
The subocular was broken up in two specimens. ‘The ventrals and
subeaudals were 131+44, 134446, 127+42, 128446, 128+ 46,
and 129+42. One had swallowed a small shrew-like animal.
9, LacnEsis FLAVoviRIDIs.—Of 41 specimens, 21 were from
Amami and 20 from Okinawa. The ventrals were 232 in one
specimen, 234 in another. ‘The scales were 40 in mid-body in one
specimen. Many were quite young, hatchlings apparently ; six
such varied in length from 1 foot 64 inches to 1 foot 9# inches.
One had swallowed a rat. The fang of one large specimen was
+2" measured straight.
10. LAcHEsIs MUCRosquAMATUS.—Of four specimens, three were
from Miyako and one from Iriomote. I have no hesitation in con-
sidering these specimens as belonging to this species, though it
extends the habitat considerably. They agreed with the specimens
T have examined in the British Museum Collection. A pair of
internasals was present. ‘Two to four rows of temporals were
smooth. The scales were 23 in mid-body in two specimens, 24 in
another, and 25 in the fourth. The ventrals and subcaudals were
186466, 1902477, and 185472.
SEA SNAKES.
Family CoLUBRIDA. Subfamily HypRopHIINA.
1. Hyprus pLATURUS.—One specimen of Boulenger’s Variety E
(op. cit. vol. iii, p. 268) was from Okinose Sagami (Hondo).
2. HypDROPHIS MELANOCEPHALUS.—Of three examples two were
1905. ] DR. A. DUGES ON A NEW MEXICAN SNAKE. 517
from Ishigaki and one from Iriomote. The scales behind the neck
were 24 in one specimen, round mid-body 29 in one specimen and
33 in the others. The ventrals were 336, 316, and 332.
3. DistrrA oRNATA.—The three specimens were all from
Okinawa. ‘The scales behind the neck were 29, 32, and 33; mid-
body 35, 37, and 38. Ventrals 271, 268, and 251.
4, AIPYSURUS ANNULATUS.—AIl the six examples were from
Okinawa. Four had a sharp spine on the rostral which was absent
on the other two. The prefrontals were very irregular. There were
four in three specimens, two in one specimen, and three (2 right,
1 left) in two specimens. In all one or both parietals were split
by a suture behind. The scales were 17 in mid-body when the
vertebral row was enlarged, which was usually the case, though often
to a variable degree. In two specimens the scales were 19, the
vertebrals being divided into three rows subequal to the other
dorsals. Ventrals numbered 138 to 143,
5. PLATURUS LATICAUDATUS.—The two specimens were from
Okinawa. ‘The ventrals were 243 in one specimen; the last was
divided in both specimens.
6. PLATURUS SCHISTORHYNCHUS.—Of 37 specimens, 29 were from
Miyako, 6 from Okimawa, and 2 from Amami.
All the specimens were preserved in formalin.
3. Description d’un Ophidien nouveau du Mexique (Morenoa
orizabensis, g. et sp. nn.). Par Atrrep Dugés, M.D.,
C.M.Z.S.
[ Received July 7, 1905.]
(Text-figure 77.)
Ce Colubride (Sous-fam. Colubrine) ne m’est connu que par
deux exemplaires provenant d’Orizaba (Etat de Vera- Cruz) dot
me l’a envoyé le Prof. Aniceto Moreno pour le déterminer. Ne
le trouvant décrit dans aucun des ouvrages que j’ai pu consulter,
jai du lui donner un nom générique et spécifique nouveau et je
le dédie 4 mon ami M. Moreno.
Ses rapports les plus intimes sont avec le g. Ablabes, tel que
Va compris Boulenger (Catal. Snakes of Brit. Mus. 1894); mais
ilen différe assez pour l’en séparer, comme le prouve sa description.
Les vertébres dorsales posterieures manquent d’hypapophyses.
La dentition est isodonte : il m’a semblé quil y avait une douzaine
de dents au maxillaire supérieur, mais je n’al pu m’en assurer
exactement pour ne pas trop mutiler l’exemplaire que je pouvais
examiner. L’aspect général est celui d'une Coronella.
Caractéres.—La rostra le se replie un peu sur le museau. Les
internasales sont un peu plus petites que les préfrontales; celles-ci
518 DR. A, DUGES ON A NEW MEXICAN SNAKE, [ Dec. 12,
se rabattent de chaque coté jusqu’au contact de la frénale. La
frontale égale & peu prés la distance qui la sépare du bout du
museau ; elle est plus étroite en arriére qu’en avant. Les sur-
oculaires, subtriangulaires, séparent la frontale de la préoculaire.
Pariétales 4 bords externes un peu excavés, et plus étroites a
leur extrémité postérieure. Nasale double. Frénale un peu
plus longue que haute. Une seule grande préoculaire. Deux
post-oculaires. Temporales 2+2, celles du second rang atteig-
nant V’extrémité des pariétales ; sur un exemplaire la temporale
inférieure du premier rang a gauche est divisée prés de la post-
oculaire inférieure. Rostrale plus large que haute. Huit sus-
labiales, les quatriéme et cinquiéme sous Vceil; la sixiéme, trian-
gulaire, ne touche pas la premiére temporale inférieure. Deux
généiales longues, suivies de deux petites séparées par une écaille.
Huit labiales inférieures. La mandibule est un peu plus courte
que le museau.—Dix-neuf rangs d’écailles lisses, rhomboidales,
sans pores. Anale simple. Gastrostéges 198, Urostéges doubles
85. Queue terminée par une petite poimte cornée
Text-fic. 77,
Téte de Morenoa orizabensis, en dessus et de profil.
Dimensions :— m.
Corps avec la téte ... 0-41
(GYEVS Deis Uanmnneeee aaa aot 0-08
MOA secascaon. OPA
Le corps est un peu comprimé.
Coloration.—Parties supérieures brun-gris clair; les écailles
sont toutes bordées de noir. Des barres transversales brun-foncé
se détachent sur le fond et sont plus nettes dans le tiers posté-
rieur du corps. Une tache noire oblique se voit de chaque cdté
en arriére de la téte, distante de langle de la bouche comme
celle-ci ’est du museau ; plus loin sur les flanes il y en a quelques
autres moins visibles. Le dessus de la téte est d’un brun fauve
uniforme; le dessous est blanc; il y a une bordure noire sur
4 des labiales supérieures. Le dessous du corps est blanchatre
avec des lignes noires transversales qui descendent des flancs.—
Sur un exemplaire les pariétales portent une ligne anguleuse un
peu plus foncée, mais trés peu distincte.
Guanajuato, le 20 Juin 1905,
1095. | ON MAMMALS FROM PERSIA AND ARMENIA. 519
4. On a Collection of Mammals from Persia and Armenia
presented to the British Museam by Col. A. (. Bailward.
By OuprieLD Tuomas, F.R.S., F.Z.S.*
[Received October 27, 1905. ]
(Plate XVI.t)
The National Museum owes to Col. A. ©. Bailward a most
interesting collection of small mammals from Persia and Armenia,
obtained during the past summer on his way home from India to
England. Before starting he applied to the Society’s Secretary
for advice on the subject, and Dr. Mitchell suggested his taking
with him someone trained to collect mammals and birds. By
good fortune Mr. R. B. Woosnam, one of our ablest collectors,
who had already done good work in South Africa, was able to go
with Col. Bailward, and the specimens now described were all
trapped and skinned by him.
Considering that the expedition was primarily a shooting-trip,
that it never stayed more than a day or two in any place,
and that the party rode something like 20 or 30 miles every
day, the number of mammals obtained—about 70—is a credit to
Mr. Woosnam, who also collected about 380 birds.
About 31 species are represented in the Mammal collection,
of which I have described five as new. Of these by far the
most interesting is the beautiful large-eared mouse described as
Calomyscus bailwardi, which forms a new genus entirely unlike
anything hitherto known from the Old World, but allied to the
North-American Peromyscus.
Col. Bailward’s party entered Persia at the head of the Persian
Gulf, beginning work at Ahwaz, on the Karun River. From
there they travelled north-eastward across the Bachtiari mountains
to Isfahan, and it was in this region that the majority of the
novelties were obtained. From Isfahan they went westwards to
Kermanshah, and thence by way of Lake Van, Erzeroum, and
Baibort to Trebizond.
While the Armenian specimens obtained during the trip are
most valuable, their interest is dwarfed by that of the series from
Persia, for from the region travelled by Col. Bailward the only
mammals that have ever been collected were those obtained in
1870-72 by the late Dr. W. T. Blanford, and described in his
work on Kastern Persiat, the few collected and described by
de Filippi§, and a small series obtained in 1902 by Mr. H. F.
Witherby. From the character of the present collection it is
* (The complete account of the new species described in this communication
appears here; but since the names and preliminary diagnoses were published in the
‘Abstract,’ such species are distinguished by the name being underlined.—Ep ITOR. |
+ For explanation of the Plate, see p- 527.
‘Eastern Persia,’ Zoology and Geology (1876).
t ‘Viaggio in Persia,’ p. 342 (1865).
Proc. Zoou. Soc.—1905, Vou. Il. No. XXXV. 35
520 MR. OLDFIELD THOMAS ON [ Dee. 12,
evident that much remains to be done in this area, and I would
draw the attention of other Indian sportsmen to Col. Bailward’s
success, with the hope that when coming home to England they
may follow his admirable example in working Persia by the way.
1. VESPERTILIO sp., near V. serotinus.
©. 27. Mala-i-Mir, 70 mi. N.B. of Ahwaz. 4300’.
This Bat, of which Mr. Witherby also obtained examples near
Telespid, is a pale form of the Serotine group, but I cannot at
present determine its exact relationship to V. turcomanus Kiversm.
and V. mirza Fil. One thing is clear, however, that V. shiraziensis,
described in 1871 by Dobson, but afterwards referred by him, in
company with turcomanus and mirza, to V. serotinus, 18 a per-
fectly distinct species, readily distinguishable by its much greater
size.
2. VESPERTILIO MATSCHIEI PELLUCENS, subsp. n.
dg. 14, 15, 16, 17,19. Ahwaz, Karun R.,S.W. Persia. 220’.
“¢Common in the town.”
Closely similar to the species recently described as V. matschiei*,
from Aden, but slightly larger, and markedly paler in colour, the
upper surface uniformly pale buffy, very slightly darker than
Ridgway’s “ cream-buff,” which the under surface just matches.
Kars and membranes pale brownish, the hinder edges of the wings
white, and the posterior third of the interfemoral transparent
white or colourless. In true matschiei the membranes are dark
opaque brown throughout.
Dimensions of the type :—
Forearm 35:7 mm.
Head and body (in flesh) 45; tail 43; ear 13.
Skull, greatest length 13:2.
Hab. as above.
Type. Male. B.M. No. 5.10.4.4. Original number 16. Col-
lected 28 Mar., 1905,
This beautiful little Bat is readily distinguishable from all
others by its uniform pale colour, the hairs being pale to their
roots. In the pale form of Pipistrellus kuhlii, found in company
with it, the bases of the hairs are dark, even though the tips are
light. The peculiar translucent character of the posterior third
of the interfemoral is also very unusual.
3. PIPISTRELLUS KUHLI Natt.
3. 2, 5, 18, 20, 21. Ahwaz, Karun R. 220.
@. 11. Dizful, near Ahwaz.
These specimens vary a good deal in colour, some being nearly
as light as the darker examples of the last species. But the darkest
are far lighter than South European specimens, and no doubt
* Thos. Ann. Mag. N. H. (7) xvi. p. 573 (1905).
1905. | MAMMALS FROM PERSIA AND ARMENIA. 521
they represent a valid lighter-coloured Eastern subspecies, for
which there appear to be several names available.
“Shot close to the town of Ahwaz—their fur matches the soil
in colour.”’—A#. B. W.
4, PIPISTRELLUS ALADDIN Thos.
Abstr. P.Z.8. No. 24, p. 23, Dec. 19, 1905.
3. 41. Derbent, 50 mi. W. of Isfahan. 6500’. B.M.
No. 5.10.4.13. Type.
A very small species. The minute upper premolar in the
tooth-row.
Size about as in P. nanus and mimus. Ears of medium size;
inner margin slightly convex, outer margin with a well-marked
concavity in its middle third; antitragal notch shallow, the outer
basal lobe low, buried in the fur. Tragus of medium length,
rather broad, its broadest point just above its inner base; inner
margin slightly concave; outer basal lobe rounded. Wings to the
base of the toe.
General colour above ‘“ wood-brown,” the hidden basal halves
of the hairs blackish. Under surface similar, but rather lighter.
Ears and wing-membranes blackish grey, the hinder edge of the
wing from the tip of the fifth finger backwards prominently
white, as in P. kwhlit.
Skull small, delicate; much as in P. nanus. Outer upper
incisors about equalling the well-marked secondary cusp of the
inner. Large premolar well separated from the canine, the small
premolar standing in the tooth-row, wholly visible from without.
Dimensions of the type :—
Forearm 31 mm.
Head and body (in flesh) 41; tail 35; ear 10.
Skull—greatest length 11:3; basal length in- middle line 8:7;
breadth of brain-case 6:1; palatal length 4; combined length of
large upper premolar and two molars 2°8; lower tooth-row from
front of canine 4:2.
Hab. and Type as above.
This little Bat is perhaps a representative of the Indian
P. mimus Wrought.*, with which it agrees in size and certain
other characters. But it is much lighter in colour, the extreme
tips of the dorsal hairs m that animal being alone pale brown,
the rest being blackish, and the small upper premolar does not
stand so well in the tooth-row, although more so than in most
species of the genus. P. nanus again is a dark-coloured bat, as
dark as a European Pipistrelle.
5, Myoris MYOTIS OMARI, subsp. n.
6. 42,43. Derbent, 50 mi. W. of Isfahan. 6500’,
(2. No. 13. Near Telespid, 8.W. Persia. H. F. Witherby.
Kssential characters as in true myotis, the ears apparently
* Journ. Bombay Nat. Hist. Soc. 1899, p. 722.
35*
522 MR. OLDFIELD THOMAS ON [ Dee. 12,
nearly or quite as long as usual, not shortened as in the
N. Indian blythi. But the colour is very different, being that
characteristic of specimens from desert-regions. General colour
above uniform pale “ wood-brown,” the basal halves of the hairs
smoky brown, succeeded by a broad ring of glossy whitish sandy
and a fine pale brown point. Under surface broadly washed with
“ cream-buff.” Membranes and ears also much paler brown than
in myotis.
Teeth rather smaller than those of true myotis, larger than
those of blythi.
Measurements of the type :—
Forearm 60 mm.
Head and body (in flesh) 75; tail 61; ear 26.
Skull—ereatest length 22:2; breadth of brain-case 9-9; upper
tooth-row from front of canine 9°5; front of lower canine to back
of m, 10:1.
Hab. Persia; type from Derbend. Alt. 6500’.
Type. Adult male. B.M. No. 5,10.4.14. Original number 42.
Collected 14 May, 1905.
It is quite natural to find a desert-coloured form of the common
M. myotis inhabiting Persia. Mr. Witherby’s specimen is very
similar to the two presented by Col. Bailward.
Mr. Miller has shown* that the Indian Vespertilio blytht Tomes
is definably different from the European J. myotis, to which
Dobson had assigned it. I may further note that Dobson's
V. africanus f is clearly the same as IZ, blythi, the collection from
which the type came having been wrongly labelled as from the
Gaboon, when it really was from N. India. Dobson’s mistake
was therefore quite excusable.
6. NroMys FODIENS Schr.
3g. 53. 25 miles N. of Erzeroum. 7000’.
“Caught by a brook in the mountains. Was swimming and
diving with two others.’—f. B. W.
7. ERINACEUS EUROPZUS L.
56. 9. Tortoum R., N. of Hrzeroum. 4000’.
Probably belonging to the form recognised by Barrett-Hamilton
as H. e. concolor Mart.
8. CANIS AUREUS L.
3d. 12. Shus, near Dizful, Arabistan.
9. VULPES VULPES FLAVESCENS Gray.
6.7. Bunde Kil, Karun R. 250’.
10. Purorius nivauis L.
d. 61. Baibort. 7000’.
* P. Biol. Soc. Wash. xiii. p. 155 (1900).
+ Cat. Chir. B.M. p. 310.
1905. | MAMMALS FROM PERSIA AND ARMENIA. 523
11. Metutvora tnpica Kerr.
©. 24. Ram Hormuz, E. of Ahwaz.
12, CrreLLus XANTHOPRYMNUS Benn.
3. 60. Baibort, between Erzeroum and Trebizond.
In the fulvous summer pelage. Those obtained by Mr. Danford
in Central Asia Minor are in the grey winter coat.
13. CrreLLus concoLor Geoff.
©. 47. Bast-Kala, near Lake Van. 7200’.
Soe 9. A. AO) Iba Wein S00"
“Very plentiful on open sandy ground ; to be seen about all
day.”— Fk. B. W.
14, Tavera tHntuRA Wagn.
3g. 8, 9,10. Bunde-Kil, Karun R. 250’.
©. 13. Shus, near Dizful. 500’.
3. 23. Ram-Hormuz, 60 mi. BE. of Ahwaz. 500’.
@. 28. Mala-i-Mir, 70 mi. N.H. of Ahwaz. 3300’.
Whether this species grades into the Indian 7’. indica remains
to be seen when more material is available.
15. MerIoneEs PERSiIcuS Blantf.
@. 26. Mala-i-Mir, 70 mi. N.E. of Ahwaz, S.W. Persia.
3. 36. Dopulan, 120 mi. N.E. of Ahwaz.
No, 26 agrees very well with a co-type, a female, in the British
Museum from Kohrud, but 36 has longer ears and smaller bulle.
As its locality, however, is intermediate between those of 26 and
the type, I presume the differences are either individual or sexual.
I am glad to be able to come at last to a definite conclusion
about the generic position of this animal, the teeth of the co-type
being so worn down that it was impossible till now to decide
whether it was a Weriones or a Gerbillus. The new specimens
show clearly that its teeth are those characteristic of the former
genus.
16. MERIONES ERYTHRURUS Gray.
6. 1,3, 22. Ahwaz, Karun R. 220’.
This Gerbille, which I provisionally refer to the Afghan species,
is also nearly related to I. meridianus Pall.
“ Plentiful all along the flat coast plain from Bushire to the
Karun River. Nocturnal.”—A. B. W.
17-18. Mus—mMuscuLUS group.
. 29, Deh-i-Diz, 90 mi. N.E. of Ahwaz. 5500’.
. 31. Bachtyari Mts., 100 mi. N.E. of Ahwaz. 5800’.
. Bagh-i-Badaran, 30 mi. 8. of Isfahan. 8000’.
45. Sakiz, 100 mi. N. of Kumanshah. 5000’.
. 55. Tortoum R., N. of Erzeroum. 4000’.
O; +0 +0 +0 +O
(SU)
~J
524 | MR. OLDFIELD THOMAS ON [ Dec. 12,
When the difficult Mus musculus group comes to be worked
out these specimens will be of the greatest value, but they cannot
well be determined at present. No. 55 is a typical dark long-
tailed house-mouse; the others are pale desert forms,
19. Micromys mystacinus Danf. & Alst.
3. 64, 65, 66. 2.67. Sumela, 30 mi. 8. of Trebizond.
1500’.
“Trapped on hill-side below the fir-woods.”—A&. B. W.
20. MiIcROMYS SYLVATICUS ARIANUS Blanf.
6. 30, 34. 2. 32. Bachtiari Mts., 100 mi. N.E. of Ahwaz.
5800’.
These specimens are coloured very like the South Persian
M. s. witherbyi Thos., but have the larger teeth of arianus.
21. CALoMYSCcUS BAILWARDI Thos. (Plate XVI.)
Abstr. P. Z. 8. No. 24, p. 23, Dec. 19, 1905.
25. ¢. Mala-i-Mir, 70 mi. N.E. of Ahwaz. 4300’. 10 April,
1905. B.M. No. 5.10.4.68. Type.
CALOMYSCUS.
A member of the Cricetine, or biserial-toothed Muride, of
which the only recent Old World * members hitherto known have
been the Cricetus group and the South African Mystromys. Most
nearly allied to the N. American Peromyscus, with which it shares
the possession of only five cusps on the anterior upper molars.
External form as in Peromyscus, but the tail bushy terminally,
as in many Gerbilles, to which the pallid colour also gives a
resemblance. Ears large. Fur soft. Feet of normal length and
structure; soles naked except just under the heels; sole-pads six,
the posterior one far back, separated from the others. Tail long,
pencilled, the single specimen with a peculiar double tuft of white
hairs at a point two-thirds along it, which may indicate the
presence of a special gland, or, more probably, be merely due to
an accidental injury.
Skull, as compared with that of Peromyscus, low, flat, and
rounded, the shape of the brain-case recalling that of a dormouse.
Bulle low, little developed. Palatal foramina comparatively small.
Coronoid process of mandible long, considerably overtopping the
condyle. Incisors smooth. Molars brachyodont, thin, pattern
very similar to that found in Peromyscus, but even more simple ;
the cusps low, and the valleys between them shallow, and without
any trace of supplementary intermediate ridges. First upper
molar with only five cusps and without any trace of that dupli-
cation of the anterior cusp so characteristic of Cricetus and its
allies.
* Madagascar excepted.
1905. | MAMMALS FROM PERSIA AND ARMENIA. 525
Type :—
CALOMYSCUS BAILWARDI.
A beautiful Gerbille-coloured, long-eared, tufted-tailed mouse
of about the size of Mus musculus.
Fur soft and fine, hairs of back about 7 mm. in length.
General colour above a beautiful “pinkish buff,” darkened on
the back by the tips of the hairs being black, clear and rich along
the flanks and down the outer sides of the legs to the ankles.
Whole of under surface pure sharply contrasted white, which
ascends rather high up on the cheeks, nearly to the eyes, covers
the whole of the fore limbs, ascending almost to the shoulder, and
the inner side of the hind limbs. Head buffy, slightly paler than
back. Ears very large, practically naked, pale brown, their few
fine scattered hairs white; a small white patch above the base of
their anterior margin. Upper surface of hands and feet pure
white. Fifth hind toe long, reaching to the middle of the
terminal phalanx of the fourth. Tail long, well haired, the hairs
lengthening terminally into a pencil; pure white below, above
whitish proximally, darkening terminally to blackish.
Skull with the nasal region long and narrow. Interorbital
space broad, smooth, slightly convex, its edges scarcely marked,
no ridges developed on the parietals. Anterior plate of zygomata
not projected forwards. Palatal foramina ending half their own
length in front of the molars.
Dimensions of the type (measured in the flesh) :—
Head and body 78 mm.; tail 87 ; hind foot 20°5; ear 21:5.
Skull—greatest length 26 ; basilar length 19°2; greatest breadth
13°8: nasals 10:1 x 3:2; interorbital breadth 4:4; brain-case
breadth 12; interparietal 3:1 x 87; palatilar length 10°5;
diastema 69; palatal foramina 4°5 x 1:8; length of upper molar
series 3°3.
Hab. and Type as above.
“Trapped among barren rocks on mountain-side above the
Mala-i-Mir marsh.”—A. B. W.
The discovery of this beautiful animal is of extreme interest, as
it belongs to a group hitherto believed to be exclusively American
and Malagasy, with the exception of Cricetus and Mystromys.
This group of biserial-toothed Muride is apparently a very
primitive one *, and was no doubt spread widely over the Old
World as well as the New before the triserial Murine were
developed and beat it in the struggle for existence throughout the
Eastern Hemisphere. But they penetrated neither to Madagascar
nor America, in which countries the Muride are all of the
biserial group. Now in Calomyscus we have another Cricetine
% Several fossil members of this group, Eocene and Miocene, are known, and are
all referred by paleontologists to Cricetodon Lartet, but if still existing they would
apparently represent quite a number of what mammalogists now call genera. I am
indebted to Dr. Forsyth Major for showing me a series of representative specimens
of the fossil forms.
526 MR. OLDFIELD THOMAS ON [ Dec. 12,
Mouse preserved in the mountains of Persia, closely allied to the
N. American Peromyscus, and widely different from any of the
Asiatic Muride hitherto known.
T have named this striking novelty in honour of Col. Bailward,
to whose generosity the Museum is indebted for the interesting
collection of which it forms a part.
22. CricreruLus pHzuS Pall.
$. 46. Sakiz, N.W. of Karmanshah. 5000.
9. 54. Tortoum R., 60 mi. N. of Erzeroum. 4000.
3. 58. Baibort, Choruk River, between Erzeroum and Tre-
bizond. 5500".
“Trapped among the corn-lands.”—R. B. W.
93. MIcROTUS NIVALIS Mart.
3g. 62. 25 miles N. of Baibort. 7000’.
24-27, Microrus spp.
g. 40. Derbend, 60 mi. W. of Isfahan. 6500’.
2. 44. Diwan-Déré, 150 mi. N.W. of Kermanshah. 6500’.
@. 57. Axvab-Keni, 60 mi. N. of Erzeroum. 9000’.
©. 59. Baibort. 5000’.
2. 63. 70 mi. N. of Baibort. 7000’.
These five Voles belong to at least four species.
28, ELLOBIUS LUTESCENS Thos.
6. 51. Lake Van. 5000.
Topotype. Quite similar to the original specimens.
299. ELLOBIUS WOOSNAMI Thos.
Abstr. P. Z. 8. No. 24, p. 23, Dec. 19, 1905.
3. 38. @. 39. Dumbeneh, 50 miles N. of Isfahan. 7000’.
Colour much as in Z. lutescens. Teeth of much simpler pattern.
Fur soft and loose in texture; hairs of back about 9 mm. in
length. General colour above dull greyish buffy, the hairs slaty
grey, with dull buffy tips. Sides paler greyish, not more strongly
buffy as is the case in L. talpinus. Head blackish above, con-
trasting markedly with the general colour, much more so than in
E. lutescens. Under surface similar to sides, the tips of the hairs
very pale buffy.
Skull rather more heavily built than in /.lutescens. Zygomata
not so expanded vertically in the centre as in lutescens and fusco-
capillus, its greatest vertical breadth 3 mm. or less.
Teeth of a more simple type than those of H. lutescens and
fuscocapillus, and nearly corresponding with those of fig. 6 of
Biichner’s plate * of Hllobius teeth. The last upper molar with
* Mamm. Przewalsk. pl. xv. (1889).
1905. ] MAMMALS FROM PERSIA AND ARMENIA. 527
one simple deep reentrant angle on each side, the projecting
angles bordering them in front and behind nearly equally salient ;
no trace of the secondary antero-external reentrant angle, which
in #, lutescens tends to divide into two the large antero-external
projecting angle; posterior lobe diminished or absent. Last
lower molar with the anterior external reentrant angle about half
the depth of the posterior one; in fuscocapillus it is quite as
deep as the posterior one, while in éalpinus it is almost non-
existent.
Dimensions of the type (measured in the flesh) :—
Head and body 112 mm.; tail 16; hind foot 23.
Skull—greatest length 32; basilar length 29:2; zygomatic
breadth 24; nasals 8°38 x 3°5; palatilar length 19; diastema 12°5 ;
length of upper molar series (alveoli) 7°4.
Hab. as above.
Type. Female. B.M. No. 5.10.4.65. Original number 39.
Collected 9 May, 1905.
“Trapped in corn-land in broad valley, near a stream. Plen-
tiful.”—R. B. W.
In colour this Hilobiws has a close resemblance to the Z. lutescens
of Lake Van, but its teeth are of much simpler pattern, more
approaching those of #. talpinus.
30. ALLACTAGA WILLIAMSI Thos.
6. 50. Lake Van.
A topotype of this beautiful Jerboa, which was described
in 1897 from specimens presented to the British Museum by
Col. W. H. Willams, R.A.
31. LEpPuS GRASPEDOTIS Blanf.
6.4. Karun R., N. of Ahwaz. 250’.
©. 6. Bunde Kil, Karun R. 250’.
This appears to be the lowland coast representative of the
ordinary plateau Hare of Persia and Afghanistan, to which the
name of L. tibetanus should probably be applied.
It is distinguished by its shorter fur, which is silvery whitish
at base, with a broad black subterminal ring. In the highland
forms the part below the black ring is slaty basally, with a
creamy terminal half.
The type was described from Pishin, 8.W. Baluchistan, about
100 miles from the coast.
EXPLANATION OF PLATE XVI.
Calomyseus bailwardi; natural size: p. 524.
528 MR. L. DONCASTER ON COLOUR-VARIATION [ Dec. 12,
5. On the Colour-Variation of the Beetle Gonioctena
variabilis, By L. Doncastsr, M.A., F.Z.8.
[ Received July 7, 1905. }
In 1895 (P. Z.S. 1895, p. 850) an account was given by Mr. Bate-
son of the colour-variation of Gonioctena variabilis, a Chrysomelid
beetle. His material was collected almost entirely at Granada
in the months of March and April; and he found that although
the insect is extraordinarily variable, yet when a large collection
is made the beetles could be classified into two chief groups with
very few intermediates between them. The ground-colour of
the elytra varies from a brilliant red through orange and buff to
a greyish green; and although the intermediate colours (orange
and buff) are comparatively rare, no sharp line between the red
and green can be drawn. There is also a great diversity in the
markings: some individuals, chiefly those with red elytra, have
two black spots on each elytron (spotted type), others (almost
exclusively greens) are without these spots but have rows of
minute black dots (striped form), and a third class has both spots
and stripes. A large series of figures is given in the paper
referred to. Bateson further found that the spots and stripes
have a definite relation to the sculpturing of the elytra; the
spots having their centres on certain of the longitudinal rows of
punctulations, while the stripes lie between them. The spotted
or striped type may be associated with either the red or green
colour, but Bateson observed that almost invariably the spotted
elytra were associated with black pigmentation of the ventral
surface of the abdomen, and that specimens with no spots had
no black pigment in this position. The colour of the underside
therefore provided a means of dividing a population into two
classes with exceedingly few intermediates; some had dark
undersides and spotted elytra (with or without stripes in addition),
the remainder had light undersides and were without spots.
When classified in this way, it is found that most of the dark-
spotted specimens have red or reddish elytra, and most of the
unspotted light are green; and further, that about 80 per cent.
of the first class are males, and about 70 per cent. of the second
class females. The males are easily distinguished from the
females by the presence of a small rounded depression in the last
uncovered abdominal plate; this is absent in the female.
In addition to the variations mentioned, there may be more
or less suffusion of the elytra with black pigment, until a totally
black form is reached. The specimens in which this melanic
variation is not very pronounced show that they belong to the
class which is both spotted and striped; it occurs much more
frequently in red than in green individuals.
1905. ] IN THE BEETLE GONIOCTENA VARIABILIS. 529
The case is of peculiar interest not only on account of the
great variability in a single species, but especially because of
the rather close correlation between the two chief colour-types
and the two sexes. Bateson found that on the hills behind the
Alhambra at Granada 80 per cent. of the males were spotted and
dark below, and over 70 per cent. of the females unspotted and
light. In the Darro valley, perhaps a couple of miles away, only
62 per cent. of the males were dark, and 85 per cent. of the
females were light; i.e. there was a much higher proportion of
light specimens in each sex. On the other hand, at Castillejo,
near Toledo, rather early in the season, of 75 specimens all were
dark and spotted, all but one being males. There was therefore
some indication that the proportions vary with the locality, or
possibly with the season; and it seemed important to determine
whether the correlation between variation.and sex was a genuine
and permanent phenomenon, or was more or less accidental,
depending on the local and seasonal conditions at Granada. I
therefore teok the opportunity, during a visit to Southern Spain
this spring (1905), of collecting Gonioctena in various localities,
in the hope of settling this question.
I found that Spartiwn retama, wpon whieh the beetle lives,
grew abundantly in most of the hilly uncultivated districts I
visited, except in the neighbourhood of Gibraltar, where [imagine
that the rainfall is too great, and in the desert to the east of
the Sierra Nevada, which is almost wholly without vegetation.
Almost everywhere where I found the Spartiwm I found also
Gonioctena, but never saw it on any other plant. Where the
beetles were abundant they were beaten into a net, but when
they were scarce it was necessary to search carefully for them
and catch each one separately. This probably leads to a slight
excess of reds in my samples, since they are much more con-
spicuous; but when this method was adopted the bushes were
searched very thoroughly, and I believe that the error may safely
be disregarded. On one occasion one method was used in a
particular locality, and two days later the other was tried in the
same place; and the difference in the proportions of red and
greens was not more than about 3 per cent., which might easily
have been due to chance in a comparatively small sample.
I collected the beetles at Ronda, Granada, and in two or three
localities in the neighbourhood of Malaga ; those at Ronda were
obtained on March 23-24, at Granada March 25 and 28, and
collections were made at Malaga at the beginning of April and
again towards the end of the month. It will be most convenient
to describe the Granada collection first. On the hills behind the
Alhambra, between the Genil and Darro valleys, Gonzoctena was
exceedingly abundant, and I collected altogether 1382 specimens,
978 males and 404 females (Table I.). In the distribution of
the different varieties they agree remarkably closely with those
obtained by Bateson ten years ago in the same place. Bateson
530 MR. L, DONCASTER ON COLOUR-VARIATION [ Dec. 12,
found that of the males 81 per cent. were spotted with dark
undersides, 19 per cent. striped only with light undersides. I
found rather over 83 per cent. spotted and dark, 16 per cent.
striped and light, and about 0°5 per cent. with intermediate under-
sides. Of the females, | found 27°5 per cent. with dark under-
sides, the same proportion as was observed by Bateson. The
occurrence of the different varieties is in every way in close agree-
ment with that found by Bateson; and it may be concluded that
their distribution at that season has not changed appreciably in
ten years. J did not collect in the Darro valley from which
Bateson’s second sample was obtained, but I found that on the
lower slope of the hill towards the Genil valley the proportions
did not differ from those on the top. On the Darro slope of the
hill, which is very steep and faces north, the beetle did not occur,
although Spartiwm was abundant.
At Granada a considerable proportion of the beetles were in
cop., and I collected 119 couples and recorded the characters of
each as they were gathered. Care was taken to see that they
were really paired, and since 71 pairs remained coupled after
they were dead in the killing-bottle, there can be little doubt
that all or nearly all were really iz cop. ‘Table II. gives an
analysis of these. Of the 119 pairs, there were 22, or over 18 per
cent., in which both male and female were striped green with
light undersides. Taking pairing at random among the general
population the expectation would be 10°5 per cent. But the pro-
portion of males of this type which were paired is considerably
higher than in the general population (29 out of 119 or 24:4 per
cent.); so that random mating out of those paired would give
17 per cent. of such pairs, which does not differ greatly from the
18 per cent. observed. Similarly there were 25 pairs (21 per
ce t.) in which both male and female were red with dark under-
sides. The expected number on random mating among the whole
population is 15:2 per cent., on random mating among those
actually found paired about 17 per cent. The numbers observed
are of course much too small to give reliable conclusions, but they
indicate that of the males of the green striped form, and females
of the red spotted form, a slightly higher proportion is found
paired than in the general population, and that there is possibly a
very small tendency towards selective mating between individuals
of the same colour type.
At Ronda Spartiwm bushes were very scarce, and upon many
there were no beetles, so that altogether only 106 individuals
were obtained, 80 of which were males, 26 females. Although
these numbers are small, they indicate that the population differs
considerably from that of Granada (Table IIT.). Of the males
60 (75 per cent.) were spotted and dark underneath, 9 were
green, striped and light, one red, spotted and striped, light, and
10 red, spotted and striped, with intermediate undersides. At
Granada only 6 intermediates occurred in 1382 specimens; while
1905. ] IN THE BEETLE GONIOCTENA VARIABILIS. ddl
at Ronda over 12 per cent. of the males, and one female out
of 26, were classed as such. The females also differed greatly
from the Granada population: out of 26 only 10 were green
striped with light undersides, one was red, spotted and striped
and intermediate, and 15 were spotted and dark below. Even
this small collection indicates that the proportion in which the
different forms occur varies widely according to locality, as was
suggested by Bateson’s collections in two areas very near together
at Granada, and the entirely different type which he found at
Castillejo.
The only other collections which I was able to make came from
localities in the neighbourhood of Malaga, and these differ very
greatly not only from those of Granada and Ronda, but from
one another. In the first few days of April I collected on the
hills round Hl Palo, a village on the coast some three miles east
of Malaga. Spartiwm bushes were not very abundant and the
collection is not large. All the beetles were obtained in an area
not more than two miles in length, extending from near the
sea to less than a mile inland, and nearly all were found at
heights from 20 to perhaps 200 feet above the sea. In some
places higher up the hills, Spartiwm was common but the beetles
exceedingly scarce. A summary of this collection is given in
Table IV a, and it is seen that out of 173 males 141 (81°5 per
cent.) were of the green striped form with light undersides, the
remainder: being mostly red, spotted with no stripes, and dark
below. Of 204 females 187 (91:6 per cent.) were green, striped
and light underneath, so that the percentage of this form does
not differ greatly from that found among the males. It is im-
portant to notice that two of the males and one female included
in this class were pure green with no spots or stripes. It is also
noticeable that in this locality the females were more numerous
than males.
During the same days I made collections in two localities to
the north of Malaga. One of these was at a place some three
miles up the main road, perhaps 500 feet above the sea. Here
I obtained 322 males and 197 females (Table Va). Of the males
with light undersides, 98 were green striped (9 of them having
also spots), 3 red striped, 18 red spotted and striped, and one pure
green, giving 120 or about 37 per cent. of light undersides.
There were 16 with intermediate undersides, and the remainder
were red spotted and dark underneath, mostly without stripes.
Among 197 females, 52 (about 26 per cent.) were light underneath,
all being green, and there were only two with intermediate under-
sides. At this place, therefore, the proportions of the different
colours were entirely different from those of Palo, although the
two places are not more than 5 miles apart; and the percentage
of light undersides was actually lower in the females than in
the males.
I also made a very small collection on some bushes growing in
532 MR, L. DONCASTER ON COLOUR-VARIATION [ Dec. 12,
the river-bed about two miles above Malaga, i. ¢. about a mile from
the place just mentioned, but only a few feet above sea-level.
There were only 25 males and 39 females (Table VI), but they
are of interest partly on account of the preponderance of females,
and partly because the proportions closely resemble those shown
in Table V., although the beetles were obtained from near sea-
level, 7. e. at the same kind of altitude as those from Palo. In
this collection there were no plain greens.
On April 7 collecting was interrupted for nearly three weeks,
but on April 25 and 27 I was able in the short time at my
disposal to obtain 23 males and 33 females at Palo (Table I'V 6).
These numbers are too small to make possible a close comparison
with the earlier gathering, but they are of importance from the
fact that 12 of the males and 14 of the females were of the pure
green type, usually with a yellowish tinge and nearly always
brighter in colour than the green striped form. At the beginning
of the month only 3 specimens of this type occurred ina collection
of 377.
On the 26th I visited the bushes up the river-bed and gathered
23 males and 31 females (Table VI 6), which included 4 males
and 9 females of the pure green type, the proportions among the
remainder being similar to those found on April 6. And on
the 28th I obtained 40 males and 47 females from the road to
the north (Table V 6), and here again the plain green type was
frequent, while three weeks before it had been almost absent.
When I first arrived at Malaga I found that a beetle larva was
common on the Spartiwm, and a couple which I kept alive both
hatched to the pure green form of Gronioctena. It occurred to
me that the green type might develop black pigment later, but
several which I kept alive for a week showed no change of colour.
Finally, when I was about to return to England, I gathered a
quantity of larve in the hope of bringing them back alive; some
of these came from Palo, where the predominant type was green,
others from the north road locality, where the majority were
red. The greater part died on the voyage, but I reared to
maturity three of the Palo batch and eleven from the north road,
and every one of these was plain green. There were 4 males
and 10 females.
I thought at Malaga that possibly the plain green type belonged
to another species; and I attempted to find out whether it ever
paired with the other forms, but was not successful. Very few,
however, were pairing at that time, so no importance can be
attached to the fact that I never found the two types paired
together.
On my return to England, Dr. Sharp very kindly examined
some specimens of the green form and compared them with the
spotted red, and reported that he believed they belonged to the
same species. It must be concluded that as the season advances
a new type begins to appear, and, judging by the fact that all the
1905. | IN THE BEETLE GONIOCTENA VARIABILIS. 533
larvee which hatched yielded this form, it probably replaces
the other varieties altogether.
A possible explanation of the meaning of this seasonal change
occurred to me, when I noticed that the plain green form only
appeared when the bushes began to come into bloom. Bateson
has pointed out how close a resemblance the green striped form
has to the grey-green of the Spartiwm twigs, and suggested that
the resemblance might be regarded as protective. So also the
red spotted type has a marked general similarity to the common
Coccinella septempunctata which frequently occurred on the Spar-
tawm ; sothat the red type of coloration may perhaps be considered
as mimicry of a species protected by its unpleasant odour. But
more close than either of these is the resemblance of the plain
green type to the flowers of the Spartiwm. The flowers are very
small and grow in clusters; the petals are yellow, but are partly
covered by the bright green calyx. When a bush is in full bloom
the plain green type of beetle becomes almost invisible ; its thorax
is yellow corresponding with the yellow petals, and its elytra
have nearly the same colour as the calyx. The general resem-
blance is so close that the beetles are very hard to see when the
bush is in bloom, although when they are found on a plant which
has not come into flower they are nearly as conspicuous as the
red type.
My observations, taken as a whole, lead me to the conclusion
that the correlation between the two main forms of Gonioctena
and the two sexes, which Bateson observed at Granada, is a
special phenomenon depending partly on locality and partly on
season. At Ronda the correlation was much less conspicuous,
and at Malaga it did not exist. Further, it appears that the
frequeney of the different varieties depends largely on season,
but my observations did not extend over a long enough period
to work this out thoroughly. At the higher, and presumably
more backward, localities the males were more numerous than
the females, and the red spotted type was most abundant; this
was most conspicuously the case in Bateson’s collections from
Castillejo. Near sea-level there was an excess of females, and
at Palo this was associated with a predominance of green,
Finally, as the season advanced and the Spartiwm came into
bloom, a pure green type appeared; and from the fact that no
other form hatched from the larve which I collected, it seems
probable that in the summer this is the predominant type of
both sexes.
In conclusion, I wish to acknowledge my indebtedness to my
brother for much valuable help in collecting the beetles.
Zoological Laboratory, Cambridge,
July 1905.
3
?
3
?
3
?
3
¢
g
?
534
MR. L. DONCASTER ON COLOUR-VARIATION
[ Dec. 12,
[In the tables reference is made to the figures given by Bateson,
P. Z.S. 1895, plate xlvii. |
TasLe I.—Collection made at Granada, March 25-28.
Description.
A. Dark undersides.
Red, spotted (Bateson’s figs. 1, 2, 3, 14, 19)
Green, spotted (B., figs. 4, 5, 6: 13) ..
Red, spotted and striped (B., figs. 7, ‘8, 30) .
Melanic reds (B., figs. 10, 11, 1
Green, spotted and striped (B., a 27, 28)
Total dark undersides
B. Intermediate undersides.
Red, spotted and striped .
Red, spotted
C. Light undersides,
Green, striped (Bateson’s figs. 22, 23)...
Total light undersides
Green, spotted and ‘striped ogee sede
Motalkintermediavemeenceeeee eects
Green, spotted and striped (B., figs. 25, 27, 98)...
Males. Females.
Col- | Per | Col- | Per-
lected. cent. | lected.) cent.
Set 674 | 69 50 | 11
34 | 35 | 23 6
“_ aaah aes 17 4
ae 28 | 3 19 5
cats 4 || OR 6 15
817 | g4 | 116 | 275
roe
2) | 1
1 | 05
2 |
5 | O65 1
149), 274 | 68
7} tO lel iS
156 | 16 | 288 | 715
be. 978 | 1005 | 404 | 99
Taste I1.—Couples recorded at
Granada, March 28.
Total | Remained || Total | Remained.
Description. Fa une ’ | Description. tecouded coupes
gathered.| death. gathered.| death.
‘ lg green, spotted, dark ... |
red, spotted, dark ...... i 10 9 green, Sesaik ene | 3 2
red, spotted ............2 6 9 | green, striped, light ... ) |
redsemelaniG eee as ,) |2 red, spotted, dark (one -| 3 iL
red, spotted, dark... } 4. 3 | melanic) ...) |
green, spotted, dark... | green, striped, light .. at 4 3
red, spotted (one | green, spotted, dark .. |
melanic) .. 58 40 ig be 2
green, striped, light .. QO ¢eteen, striped, light...) 22 9
red, melanic ....... 4 9 1 —— =
red, spotted & striped | Toran .:.... | 119 71
1905.]
IN THE BEETLE GONIOCTENA VARIABILIS.
539
TasiLe [II.—Collection made at Ronda, March 23 and 24.
Males. Females.
|
Description. | | |
| Col- | Per | Col- | Per
lected.| cent. lected.| cent.
A. Dark undersides. |
Red, spotted (Bateson’s figs. 1, 2, 19) .. soaosel|, 2B | 2
Red, spotted and striped (B., ties. 7, 8, 3 16) sepega| all Neral
Green, spotted (B., figs. 4, 5, 28) .. aoe yd Maren RAE ED
Total dark undersides ............... 60 75 15 58
|B. Intermediate undersides.
| Red, spotted and striped (B., figs. 7, 16, 30) | TKO) |) TBR 1 4
| C. Light undersides. | |
Red, spotted and striped (B., fig. 7) ............... 1
Green, spotted and striped (B., ‘figs. 27, 7 28) pastes 2 4,
Green, striped (B., figs. 22, 23) Sa aamtaont ; a 6
| Total light undersides | 10. | 12:5 10 39
TasLeE 1V.—Collections made at Malaga (Hl Palo).
| Plain green, light
IV aon April 1, 2, 4,7. IV 6 on April 25 and 27.
IV a. IV 6.
Males. Females. Males. Females.
Description. l
Cok || isp || Cole || dae || Cole | Isp | Cob || ese
lected.| cent. | lected.) cent. lected.) cent. lected.) cent.
Red, spotted, dark ....... 25 Oot il 2
Red, spotted and striped, (danke 7 5 | | iL
Motaludankem pees ron | mel Sion ald: a | 1 4 3 9
Red, spotted and striped, intermediate 2 ales
Green, spotted and striped, ree caer ee Peete oul :
Green, striped, ight Peaenaaber |r us) 80°5 | 187 915 10 43 16 48
Sb Ae ecean Reeth: 2 ead aL 05 | 12 52 14, 42
Morallighteee ees | IAIN | Asics | degya|ee2 | 22 | 95 | 30 | 90
TROT donee 173 | 100 | 205 | 100 || 23 | 99 | 33 | 99
Proc. Zoou. Soc.—1905, Vou. II. No. XXXVI. 36
Females.
Col- | Per
. | lected.| cent.
15
8
23 49
12
12
24, 51
47 100
936 ON COLOUR-VARIATION IN GONIOCTENA VARIABILIS. [ Dec. 12,
TaBLE V.—Collection made 3 miles north of Malaga,
Vaon April 3and 5. V6 on April 28.
Va. Vv
Males. Females. Males.
Description.
Col- | Per | Col- | Per || Col- | Per
lected.| cent. | lected.) cent. || lected.| cent
A. Dark undersides.
Plain red... 1
Red, spotted (Bateson’ s fies. il, 2, Banc 166 114 17
Red, spotted and striped (B., fies. ts 8) 19 | 27 2
Red, melanic (B., figs 9, 10, 11) ete Be 2
Total dark ...............| 186 58 | 143 72°65 19 48
B. Intermediate undersides.
Red, spotted and striped (Bateson’s
figs. 7, 19, 30)| 16 5 2 1
C. Light undersides.
Red, spotted and striped (Bateson’s
figs. 7,19, 30)| 18 2 6
Red, striped (B., figs. 20, 21) ......... 3
Green, spotted and striped (Bateson’s
figs. 27, 28)) 9 1 |
Green, striped (B., ee 22, See saat 89 50 12
Plain green ........ 1 atte 1 7 nee
Total light ...............| 120 37 52 26°5 21 52
ToraL 322 100 197 100 | 40 100
TaBLE VI.—Collection made in river-bed, 2 miles above Malaga.
Viaon April 6. VI6o0n April 26.
Via. VIO.
iectras an us 7 ;
Males | Females. Males. Femates.
Description. | | | allen
Col- | Per | Col- | Per ] Col- | Per | Col- | Per |
lected.| cent. |lected.| cent. || lected.) cent. | lected.) cent.
Red, spotted, dark . Aaa eeeli gO. 29 | a le
Red, spotted and striped, darken. «jack ee ae 6 2 8
Total dark ............... 16 64 | 35 90 || 18 56 14 45
Red, spotted and striped,intermediate) 2 8 reseed | 1 4 1 3
Green, striped, light 7 | 28 A\ || Osa peri ees 7 | 23 |
Plain green, light ae eae vi Es “Tl A a
| TUE ISIS socusodneccaonel) 28 4 TO) O20 16 | 62
——__| ——— iI _——
Toran 25 | 100 | 39 100 | 23 | 100 31 100
|
J.G.de Man.del.
PZo, (9 OSavoll Ea
Bale & Danielsson L't Photograwure.
l=5-]PrMcCHOGNAT Es PUSS Me riuySse
64 Pe BAS Ane Ss.
GR
ih ween
P25. 1905, vol Il. Pl. XVED.
J.G. de Man. del. Bale &Dantelsson Lt4 Photogravure.
7-15, PALAMON (BUPALAIMON) LAR VAR.
IS Sy IP (1s UN EVN IE 2S IMO ING) Ib/AIRY
1905. ] ON CRUSTACEANS FROM CHRISTMAS ISLAND. 537
6. On Species of Crustacea of the Genera Ptychognathus
Stimps. and Palemon Fabr. from Christmas Island.
By Dr. J. G. pr May, of Terseke, Holland.
[Received October 20, 1905.]
(Plates X VIT. & XVITI.*)
The Crabs and Prawns described in this paper were sent me
for examination by Dr. W. T. Calman, of the British Museum.
They were collected by Dr. R. Hanitsch, of the Raftles Museum,
Singapore, who wrote to Dr. C. W. Andrews regarding them :
“The Prawn and the Crab were obtained from a small, artificial
freshwater pool, on Christmas Island, above the waterfall, which
probably did not exist in your time [7. ¢. when Dr. Andrews was
on the island in 1897-1898].” Dr. Andrews adds that at the
' time of his stay on the island the stream in question was a very
small thread of water, trickling down the precipitous hill through
thick bush, without pools of any size or depth, and that he care-
fully explored it for Crustacea without finding any. Of course
it is just possible that they may have existed in some pools not
visited by him.
PrycHo@NnaTHus PusiLLus Heller. (Plate XVII. figs. 1-5.)
Ptychognathus pusillus Heller, Crustaceen der Novara Reise,
1865, p. 60.
Ptychognathus pusillus de Man, in Zoolog. Jahrb. (Spengel),
vol. ix. 1895, Abth. f. Syst. p. 99, Taf. 28. fig. 22.
One male and one female without eggs from a freshwater pool
on Christmas Island.
Ptychognathus pusillus Heller was founded, forty years ago, on
a single female specimen collected by the ‘Novara’ Expedition on
the Nicobar Islands; Heller did not figure his species. A new,
detailed description, illustrated by several figures, of this type-
specimen, preserved in the Museum of Vienna, appeared in 1895
in my paper on the Decapod Crustacea gathered by Captain Storm
in the Indian Archipelago: I suggested in this description that
Ptychognathus pusillus should be regarded either as a distinct
species, the male of which was still unknown, or as a young indi-
vidual of another known species, perhaps Ptych. pilipes A. M.-Edw.,
from Celebes, or Piych. intermedius de M., from the Moluccas
(l.c.p. 100). Ptychognathus pusillus, however, apparently a rare
freshwater crab, has not been met with during the long period
of forty years, and its rediscovery on Christmas Island is there-
fore particularly interesting, especially because not only the female
was found, but also the male, which hitherto was unknown.
The two specimens prove that Ptych. pusillus Heller is a “ good
species,” different from all its congeners.
* For explanation of the Plates, see p. 550.
36*
538 DR. J. G. DE MAN ON CRUSTACEANS [ Dec. 12,
The female from Christmas Island is of a somewhat larger size
than Heller’s type specimen; the measurements are the same,
except that the greatest width of the carapace of the female
from Christmas Island is a little larger in proportion both to -
the length of the carapace and to the distance between the
external orbital angles. The exognath of the external maxil-
lipedes, though still less broad than the ischium-joint, appears
broader in proportion to this joint than in Heller’s younger
type specimen, and the chelz are comparatively larger. The
tips of both fingers carry some stiffish hairs on their outer surface
close to the horny border; these hairs are more numerous on the
tip of the fixed finger. In the Vienna type specimen these hairs
were, no doubt, worn off. The chehylitg carries 6 or 7, acute,
conical teeth, and the fixed finger 4 or 5, which are a little lar eer.
These slight differences are caused by the larger size of this
specimen, which, for the rest, fully agrees with Heller’s type.
The male is larger than the female and more than once and a half
as large as Heller’s type specimen ; regarding the proportion of the
measurements of the carapace, the male agrees with the female
from Christmas Island. The cephalothorax also fully agrees in its
other characters with my description of 1895, except as regards
the outer footjaws. I suggested in that paper that, in the male,
the exognath should be as broad as or perhaps even a little broader
than the ischium-joint; this supposition is now confirmed by the
male from Christmas Island. In this male, indeed, the exognath
(PL. XVII. fig. 3) appears a little broader than the ischium, the pro-
portion between them being as 11:10; the exognath is distinctly
convex longitudinally and also a little transversely. The merus-
joint fully agrees with that of the type specimen, its antero-
lateral angle being rounded, whereas the external margin, so far
as it is contiguous to the exognath, appears very slightly concave ;
the outer half appears, under a lens, finely granulate. The
exognath is somewhat punctate, except on the mner border and
posteriorly, as is also the endognath, except in the middle, and
short stiff sete are inserted on the puncta. The abdomen (fig. 4)
resembles that of Ptych. polleni de M. from Madagascar (de Man,
l.c. Taf. 28. fig. 20 6), as is proved by the figure and the measure-
ments. Sternum and abdomen are punctate; the 3rd, 4th, and
5th segments of the abdomen, counting from the base, carry,
moreover, each a larger pit on their antero-lateral angle and
another on the anterior half at either side of the middle line.
The chelipedes are equal (fig. 1). The punctate, anterior surface
of the ischium carries one or two short, stiff sete. The upper
border of the merus is hairy on its proximal half, the obtuse
anterior border is granular and a little pubescent proximally.
The upper surface of the carpus is closely, but finely pune-
tate, the rest smooth, but it appears finely granular under a
lens in the female; the internal angle is obtuse, though not
rounded. The chele (fig. 5) resemble closely those of Ptych.
barbatus, not only as regards their general shape but also because
1905.] FROM CHRISTMAS ISLAND. 539
the fingers are provided, each, exactly as in that species, with a
tuft of hair; the chele also much resemble those of Ptych. pilipes
A. M.-Edw. from the Philippine Islands, but here the tufts of
hair are wanting. Measured horizontally, the chele appear just
as long as the distance between the antero-lateral angles of the
carapace ; the palm is a little shorter than the fingers and, at their
articulation, a little higher than long. The convex, outer surface
of the palm, under a lens, appears very finely, but closely, punctate,
though smooth to the naked eye; both the upper and the lower
borders are rounded. The somewhat curved, tapering dactylus
carries 7 or 8 small teeth, which are rather obtuse, except two or
three near the tip; the immobile finger has 5 or 6 more conical
teeth, which are larger than those of the dactylus, especially two
or three in the middle. The fingers are finely and closely punctate,
just like the palm; on the middle of the outer surface of the
fixed finger the puncta are arranged in a longitudinal row that
extends from the tip almost to the middle of the palm; a few
larger, impressed puncta occur on the distal half of the index just
above that row. As in Ptych. barbatus, each finger carries a close
tuft of brown woolly hairs on the proximal half of its outer surface ;
the tuft of the dactylus does not extend on to the upper border
of the finger, and that of the fixed finger reaches only halfway
between the teeth and the lower border. The tips of the fingers
have horny margins: on the outer side of the tip of the fixed
finger, close to and parallel with the horny edge, are seen a
few short, stiffish setze, though much less numerous than in the
female; on the tip of the dactylus they are perhaps worn off.
The inner surface of the chelz (palm and fingers) is smooth and
glabrous.
The ambulatory legs are hairy on the upper side of their basal
joints, and a few stiff sete occur on the lower surface of ischium
and merus on either side of the articulation between these joints ;
the posterior border of the last two joints is also setose, and rows
of short sete: occur on the lower side of the propodites of the Ist
and 2nd pair. For the rest, the upper and the lower borders of
these legs are glabrous, devoid of the long hairs that are character-
istic of Ptych. pilipes A. M.-Edw. The meropodites appear under
a strong lens very finely granular, except those of the last pair,
which are almost smooth and only punctate; the puncta are
small and numerous, but three or four larger puncta in a longi- -
tudinal row are found on the middle of the meropodites of the
last pair. Just as in Ptych. barbatus A. M.-Kidw., there is no
subterminal spine on the anterior border of the meropodites.
The following joints are also punctate, and the dactyli are ridged
longitudinally both on the upper and lower sides.
On a yellow ground-colour the upper surface of carapace and
legs is marked with innumerable, small, irregular spots of a dark
purple colour, which on the epigastric and protogastric regions
are almost confluent.
Among the twelve species of Ptychognathus, certainly Ptych.
540 DR. J. G. DE MAN ON CRUSTACEANS [ Dec. 12,
barbatus A. M.-Edw. *, a marine crab from New Caledonia, which
has also been observed on the shores of Atjeh, Penang, and of
the islands between Japan and Formosa, is the most closely
related form. As regards the proportion between the length of
the carapace and the greatest width of it in adult specimens, both
species fully agree with one another, but in young individuals the
carapace of barbatus is slightly broader in proportion to its length
than that of pusillus (de Man, J. ¢. p. 104). At all ages, how-
ever, both in the male and in the female, the cephalothorax of
barbatus is anteriorly distinctly broader in proportion to 1ts
length, as is proved by comparing the measurements of the length
of the carapace and of the distance between the extraorbital
angles ; the extraorbital teeth run therefore more obliquely with
regard to the median line of the carapace in Péych. pusillus than
in Ptych. barbatus (figs. 1 and 6). In proportion to the greatest
width of the carapace the front appears @ little broader in barbatus ;
it has the same form in both species, but the granulated line that
runs immediately behind the frontal margin is, in the middle
line of the carapace, contiguous to that margin in barbatus,
whereas in Heller’s species (fig. 2) both lines are distant from one
another in the middle. In Ptych. barbatus the epigastric lobes
are situated farther from the frontal border than in pusillus
(figs. 1 and 6). In Péiych. barbatus the 2nd and the 3rd antero-
lateral teeth of the carapace are more saliené and the incisions are
deeper than in pusillus; near the antero-lateral teeth the carapace
of pusillus is somewhat granulated, but in barbatus not.
The exognath of the external maxillipedes of the adult male of
Ptych. barbatus is one-third broader than the ischium, and im the
adult female it is just as broad or even very slightly broader than
the ischium; in the adult male of pusillus the exognath appears
a little less broad in proportion to the ischium, and in the female
the ischium is decidedly broader than the exognath.
The slight differences exhibited by the legs are of little im-
portance. But for a few hairs on the outer side of the tip of the
fixed finger in the female, the extremities of the fingers of barbatus
are glabrous. Péych. barbatus is smaller than pusillus and the
habitat is different, the former being probably a marine species,
the latter a freshwater one.
An adult female of Pseudograpsus barbatus Rumph from the
River Wukur, on the island of Flores, is lying before me (vide
de Man, in Max Weber’s ‘Decapoden des Indischen Archipels,’
1892, p. 317); it will be useful to indicate the differences between
this specimen and the female of Ptych. pusillus Heller, since they
much resemble each other. Both species, of course, differ at
first sight by their external maxillipedes; the rounded antero-
external angle of the merus-joint is less strongly produced in
Pseudograpsus barbatus than in Heller's species, and the exognath
* Ptych. barbatus is also described in Prof. Alcock’s work: “‘ Materials for a.
Carcinological Fauna of India.—No. 6. The Brachyura Catometopa or Grapsoidea,”
Journ, Asiatic Soc. Bengal, lxix. (2) no. 3, 1900, p. 406.
1905. ] FROM CHRISTMAS ISLAND. 541
of the former is, in the middle, only half as broad as the ischium,
whereas it narrows more anteriorly. The epistome has a different
form: in Ptych. pusillus it is barely broader laterally than in the
middle, but in Pseudogr. barbatus the posterior margin is strongly
arcuate, so that the epistome appears much broader laterally than
in the middle. The legs are much alike in both species, but in
Pseudogr. barbatus the last three joints of the ambulatory legs
are much more tomentose. Pseudogr. barbatus finally attains a
larger size.
Measurements of the two specimens of Ptych. pusillus Heller
from Christmas Island, in millimetres.
3. 2
Distance between the antero-lateral angles of
GHE Cava pace mr ost teen ec ee aa cee Sumeee at mn 135 10°5
Distance between the second teeth .............. 175 13°25
Distance between the third teeth, 7. e. the
greatest breadth of the carapace ............ 18 13°75
Breadth of the carapace at the posterior end of
theglateralbmemr oun sires acer ne penta 17 13
Length of the carapace, in the middle line ... 14:5 115
Breadth of the frontal border ..................... 7:2 55
Breadth of the posterior border of the carapace 75 6
Breadth, in the middle, of the ischium-joint
of the external maxillipedes .................. 2 15
Breadth, in the middle, of the exognath ...... 2°2 Ilsa}
Horizontal length of the chele .................. 13°5 6°5
er pallina ne Secnene ates 6 3
Height of the ‘palm, at the articulation of the
fingers oe VU Ah a ot ge oath) 3°3
Length of the antepenultimate joint of the
abdomen, measured in the middle ............ 21
Length of the penultimate joint.................. 21
Breadth of the posterior border of this joint... 4°12
e anterior A his athe 2°7
Length Oli WAS, WOVE TATEN TOWNE condnbdessacboooseone 2°6
REVISION OF THE GENUS PTYCHOGNATHUS STIMPS.
The genus Péychognathus, eveated by Stimpson in 1858 (Proc.
Acad. Nat. Sci. Philadelphia, p. 104), and identical with the genus
Gnathograpsus A. M.-Kdw. 1868, is, at the present time, September
1905, represented by the following twelve species :—
1. Ptychognathus glaber Stimps. 1858. 3.
2 3 pusillus Heller 1865. ¢ 9.
3. 3 riedelii A. M.-Edw. 1868. <3 @.
3 a. 3 » var. pilosa de M. 1892. ¢.
4 ‘ pilipes A. M.-Hdw. 1868. <¢.
5 a barbatus A. M.-Edw. 1872. ¢ @.
542 DR. J. G. DE MAN ON CRUSTACEANS [ Dec. 12,
- 6. Ptychognathus intermedius de M. 1879. ¢.
7
: Bi dentatus de M. 1892. o¢ Q@.
8. 5 spinicarpus Ortm. 1894. ¢.
¥). as polleni de M. 1895. ¢.
10. 7 afinis de M. 1895. ¢.
ll. 5 onyx Alcock 1900. o.
I, 7 andamanicus Alcock 1900. @.
Of all these species the male is known, except of Ptych. anda-
manicus Aleock, which is, however, probably identical with
Ptych. riedelii A. M.-Kidw.; of five species only has the female
been observed.
According to their outer appearance and physiognomy these
12 species may be divided into three natural sections. The first
section represented by five species, viz. Ptych. dentatus, spinicarpus,
polleni, affinis, and onyx, of which Ptych. dentatus is the typical
form, is distinguished by the following characters :—-The carapace
is hardly broader than long, the regions usually quite distinct, as
also the epigastric lobes. The three teeth of the antero-lateral
margins are sharp and salient. Front prominent, laminar,
straight, or nearly straight. Inner angle of the carpus of the
chelipedes produced, in the male, to form a more or less long
spine, except in Piych. dentatus, in which the inner angle is acute,
but not spiniform. Chel glabrous on their outer surface, except
in Ptych. onyx, in which there is a tuft of hair in the finger-cleft
and extending along the fixed finger. Ambulatory legs hairy,
the anterior border of the merus with a subterminal spine.
The second section is composed of Ptych. glaber, riedelii, with
its variety pilosa, and Ptych. andamanicus; Plych. riedelii may
be regarded as the type. The carapace of Ptych. riedeli and
andamanicus is hardly broader than long, that of glaber, however,
is distinctly broader than long. The upper surface is quite flat,
much depressed, the regions are not or hardly indicated, and the
epigastric lobes are wanting. There are two teeth behind the
extraorbital angle, as in the two other sections, or one (glaber) ;
the teeth are small, not very acute or distinct. Front prominent,
laminar, slightly sinuous, furrowed transversely. Inner angle of
the carpus of the chelipedes obtuse, rounded, or (in Ptych. anda-
manicus) pronounced, though not spiniform. A brush of stiffish
hair at the tip of the fixed finger on its outer surface, except in
Piych. glaber ; chelz for the rest glabrous, except in Ptych. riedelu
var. pilosa. Ambulatory legs hairy ; subterminal tooth on the
anterior border of the merus inconspicuous or blunt.
The third section is represented by four species, viz. Péych.
pusillus, pilipes, barbatus, and intermedius, of which pusillus
may be regarded as the type. The carapace is decidedly broader
than long, flat, though not much depressed. Regions more or
less distinct, as also the epigastric lobes. Front not prominent,
distinctly sinuous, and transversely ridged. The three antero-
lateral teeth are not very conspicuous. Inner angle of the carpus
1905. | FROM CHRISTMAS ISLAND. 543
of the chelipedes obtuse, or little pronounced, never spiniform.
Fingers, in the male, with a tuft of hair on their outer surface,
proximally (barbatus, pusillus), ov glabrous; in the latter case the
palm is either smooth on its outer side (pilipes), or granulated
(tntermedius). Ambulatory legs more or less haivy, no sub-
terminal spine on the anterior border of the meropodites.
Artificial key to the males of the Indo-Pacific species of
the genus Ptychognathus Stimps.*
. Fingers glabrous on their outer side (proximally }) ......... 2.
- Both fingers, or one of them, with a tuft of hair on their outer
surface, proximally .
. Exognath of external ‘maxillipedes, i in the adult ‘male, twice
or more than twice as broad as the ischium { es OO UE
2. Exognath less than twice as broad as the ech RSE ha ve
4. Inner surface of the chela glabrous
4. Inner surface of the palm with a tuft of hair ; : ‘carpus with a
small, acute tooth at the inner angle; second and third antero-
lateral teeth of the carapace ore salient; epigastric lobes
distinct .. .. dentatus.
6. Inner angle of the carpus obtuse or pr nounced, but not spini-
form; a brush of stiffish hair at the tip of the fixed finger
on its outer surface; second and third antero-lateral teeth of
the quite flat, much depressed carapace not salient, incon-
spicuous
Do ee
DOE oo
( riedelii.
6. Inner angle of the carpus produced to form a long spine; no
brush of stiffish hair at the tip of the fixed finger on its outer
surface; second and third antero-lateral teeth of the flat,
though not particularly depressed carapace salient, poate ... spinicarpus.
5. Two teeth behind the extraorbital angle : He ie
5. One single, small tooth behind the extraorbital angle ; inner
angle ‘of the car pus rounded; outer surface of ‘the chelz
smooth ; ambulatory legs w ith long hairs on both margins. glaber.
7. Outer surface of the chelx smooth, “towards the base of the
immobile finger ..... : 8.
7. Outer surface of the chele ‘distinctly eranulated ; ; “antero-
lateral teeth of the carapace as little prominent as in Péych.
riedelit, general shape of the carapace as in Plych. pilipes,
and ambulatory legs, as in that species, very hairy ........... intermedius.
8. Inner angle of the carpus produced to form a short, sharp
spine . 2:
8. Inner angle of the carpus obtuse; distance between the extra-
orbital ‘angles much shorter than the length of the carapace ;
epigastric lobes distinct ; anrbulatory legs very hairy ......... pilipes.
9. Distance between the extraorbital angles much shorter than
the length of the carapace; epigastric lobes distinct ......... polleni.
* Ptych. andamanicus Alcock is included in this key, though only the female is
known, because this species is probably identical with riedelia, or in any case most
closely related.
+ The word “ proximally ” is added, because in Ptych. riedelii and andamanicus
there is a small tuft of hair at the distal end of the immobile finger, externally.
t Only the young female of andamanicus is known. In it “the breadth of the
exognath is nearly twice that of the ischium; we may therefore conclude that in
the adult male the exognath will be twice or move than twice as broad as the ischium,
because, as a rule, the exognath is, in this genus, less broad in the female than in
the male.
§ These two species are probably identical. The carpus of the chelipedes of
riedelit has a tuft of hair on its owfer angle, both in the male and in the female; in
Alcock’s description of andamanicus this character has not been mentioned. Péy ych.
riedelit has also been observed at Atjeh.
544 DR. J. G. DE MAN ON CRUSTACEANS [ Dec. 12,
9. Distance between the extraorbital angles as long as the length
of the carapace; no epigastric lobes ........... ee § Offinis.
3. Both fingers with a tuft of hair proximally ..
3, A tuft of hair in the finger-cleft and extending along the fixed
finger; carapace hardly broader than long , depressed ; teeth
of the antero-lateral border sharp and salient ; imner ane
of the wrist produced to form a long spme ...... . onyx.
10. Exognath of external maxillipedes, in the adult male, ‘more
than twice as broad as the ischium ; epigastric lobes ‘want-
ing; a brush of stiffish hair at the ap of the fixed oes
externally .. riedelit.
PAE Se var. pilosa.
10. Exognath, in the eran nies not once — a half ¢ as ae as
the ischium cebedons 11.
11. Upper surface of the carapace ‘granulated 1 near the antero-
lateral margins; second and third antero-lateral teeth of the
carapace not salient; epigastric lobes distinct ; granulated
ridge behind the frontal border ee separated from it
in the middle .... . pusillus.
11. Upper surface of the carapace, which is broader “anteriorly
than that of puséllus, not granulated near the antero-lateral
margins; second and thir d antero-lateral teeth more salient
than those of pusillus; epigastric lobes distinct; granulated
ridge behind the frontal margin contiguous to it in the
faiddle dane’ SA-adanbendst-tey ts lon geeseemeneeels. Aantal dias aetna t Mei nm Bacrsacus’
Artificial key to the known females of the species of
Ptychognathus.
1. Carapace hardly broader than long, front prominent, nearly
straight .. 2.
1. Carapace decidedly broader than long, front little prominent
and distinctly sinuous.. ou
2. Regions of the flat, though not ‘par ticular ly depressed carapace
al epigastric lobes distinct : ; antero-lateral teeth of the cara-
pace sharp and salient.. ; .. dentatus.
2. Regions of the much depressed ‘and quite flat. carapace ‘har dly { ricdelii
indicated; no epigastric lobes ...............ec.ccc cece 6
andamanicus.
3. Upper surface of the carapace granulated near the antero-lateral
margins; ridge behind the frontal margin distinctly separated
from it in the middle ; exognath of external maxillipedes
distinctly less broad than the ischium ..... . pusillus.
3. Upper surface of the carapace, which is anteriorly roader than
that of pusillus, not granulated near the antero-lateral
margins; ridge behind the frontal margin contiguous to it
in the middle; exognath of outer footjaws just as broad or
very slightly broader than the ischium ....0.....00.000.......... barbatus.
PatezmMon (EupaL#@Mon) LAR Fabr. var.? (Plate XVIII.
figs. 7-19.)
One male and one female without eggs from a freshwater
pool, Christmas Island.
During the two or three last decennaries several carcinologists
have regarded a more or less large number of described species of
the subgenus Eupalemon as synonyms or, at the utmost, as
individual or local varieties of Palemon (Hupalemon) lar Fabr.
(confer: de Man, in ‘ Notes from the Leyden Museum,’ 1879,
pp. 168-173; Ortmann, in ‘Zoolog. Jahrbiicher (Spengel),’ v.
Abth. f. Syst. 1890, p. 724; Coutiére, in ‘Annales Sciences
Naturelles,’ Zool. 8™° série, t. xii. 1900, p. 292, and other papers
of the same authors). Several specimens of Pal. lar Fabr. from
1905. ] FROM CHRISTMAS ISLAND. 545
different localities of the Indian Archipelago, described, in 1892,
in my paper on the Decapod Crustacea collected by Prof. Max
Weber, are lying before me, as also are specimens from my own
collection. When the young male from the River Palopo on
the island of Celebes (de Man, in Max Weber, Zool. Ergebnisse,
ii. 1892, p. 447) is compared with the male from Christmas
Island, a doubt oceurs to me whether we are right in considering
these two Prawns as belonging to oneand the same-species. The
male from the River Palopo (P]. X VIII. figs. 16-19) is certainly a
typical example of Pal. lar Fabr., but in the male from Christmas
Island, the size of which is even a little smaller, all the legs have
a much stouter shape, and there are no doubt still other differences.
Specimens of Hupalemon, presenting the same characters as this
male from Christmas Island, have formerly been referred by me,
and no doubt also by other authors (because this form is probably
also widely distributed throughout the Indian Archipelago), to the
“well-known” Pal. lar Fabr.; but it appears to be a question
whether this form may still be regarded as a variety or not. I do
not venture to decide this question at present, because the speci-
mens are apparently young, but I wish to draw the attention of
carcinologists to it, confining myself at present to describing the
specimens from Christmas Island accurately.
These Prawns are, no doubt, young; the male is 62 mm. long
from the tip of the rostrum to the end of the telson, the female
43 mm. The carapace of both is smooth. The lanceolate rostrum
(Pl. XVIII. fig. 7) of the male is rather short, shorter than the
peduncles of the internal antenne, reaching but a little beyond the
penultimate joint of these peduncles. The upper border, slightly
arcuate above the eyes, is somewhat directed downward, though
the acute tip extends horizontally forward; it carries eight equi-
distant teeth, that reach to the tip. The first two teeth stand on
the carapace, the third just before the frontal margin, above the
insertion of the eye-peduncles, and these teeth diminish a little
in length from the second, that is the longest, to the last one.
The distal half of the lower border carries three equidistant teeth
that are smaller than those of the upper border, and the first of
which is situated just below the antepenultimate tooth of the
upper border; the acute tip of the 8rd is a little farther from
the extremity of the rostrum than from the tip of the 2nd
tooth. At the level of the 1st tooth of the lower margin the
rostrum is just as broad above as below the lateral carina, and the
height of the rostrum at its base is a little larger than its breadth
below that carina. Hepatic and antennal spines as in typical
specimens of Pal. lar. Of the two pairs of spinules on the upper
surface of the telson, the anterior is inserted on the middle,
the posterior midway between the anterior pair and the tip of
the telson. The telson ends posteriorly in a sharp tooth; the
inner of the two spines on either side projects haif its length
beyond the median tooth, whereas the outer spinule, barely half
as long as the inner, reaches not so far backward as the median
546 DR. J. G. DE MAN ON CRUSTACEANS | Dec. 12,
tooth. The short flagellum of the internal antenne, which is
just as long as their peduncle, is serrulate internally, and coalesced
for a very short distance, 7. e. for } of its length, with the outer
flagellum.
The legs of the first pair reach with their chele beyond the
antennal scales; the chela is @ litile more than half as long as the
carpus.
The legs of the 2nd pair (figs. 8 and 9) ave wnequal, the left
being a little larger than the other. The left leg (fig. 8), which
is somewhat shorter than the body, projects more than half
the carpus beyond the antennal scales. he cylindrical merus,
that slightly thickens distally, is fowr times as long as thick.
The carpus, which is a little shorter than the merus, has a rather
stout, conical shape; it thickens considerably towards the distal
end, appearing here more than twice as thick as at its base, when
looked at from above, and its width at the distal end measures
two-fifths of its length. The chela issomewhat longer than merus
and carpus taken together. The palm is nearly once and a half
as long as the carpus, and one-fourth longer than the fingers, which
are a little curved inward, so that the inner border of the chela
appears somewhat concave; the palm, distinctly broader than the
carpus, is somewhat broader than thick, though but very little, the
breadth in the middle being in proportion to its thickness as
15:13, so that it appears almost cylindrical. About at one-third
of its length from the articulation the immobile finger is armed
with a conical tooth (fig. 10), half as high as the finger is broad
at this place; behind it is seen a smaller rounded tooth and,
between the latter and the articulation, four or five extremely
small and low rounded teeth. The dactylus appears, at its base,
a little broader than the fixed finger (fig. 8), and is armed, just
in the middle, with a slightly curved, conical tooth, which is a
little larger than the foremost tooth. of the index; opposite to it
on the fixed finger is a small notch (fig. 10), that fits the
tooth. Between this tooth and the articulation there are still
five or six, much smaller, obtuse, somewhat unequal teeth. The
tapering fingers therefore do not shut close together ; between
the foremost teeth and the tip the cutting-edge is sharp. The
joints of this leg are everywhere covered with innumerable minute,
sharp spinules, except on the usual, naked lines; these spinules
are more crowded and a little larger on the outer and on the
inner border of the palm and near the finger-cleft on the upper
surface, whereas they are less numerous on the rest of the upper
and on the lower surfaces. They are few in number on both sides
of the fixed finger; on the outer margin of this finger they are
also few in number, but larger than on the inner border of the
palm. The outer side of the dactylus is thickly beset with
slenderer, larger spinules, the sharp tip of which is curved
upward, whereas the inner part of the upper and lower surface
is nearly smooth. A few microscopical hairs occur on the outer
and inner borders of the chela and of the other joints.
1905. ] FROM CHRISTMAS ISLAND. _ DAT
The right leg (fig. 9) resembles the one described (confer the
measurements), but the palm is a@ little less broad than the distal
end of the carpus, and the crowded spinules on the inner border
of the palm are decidedly larger than those on the outer border.
The toothing of the fingers is also different, the teeth being much
smaller. The fixed finger carries a minute, conical tooth at one-
third of its length from the articulation, and a smaller one behind
it; at two-fifths of its length from the articulation the dactylus
carries a similar, small, acute tooth, and between it and the arti-
culation four much smaller teeth, also sharp. The palm of both
legs is somewhat marbled by darker flecks; the fingers are bluish
on their lower side with yellow tips, whereas their pale yellow
upper surface is marked with three or four blue bands.
The three following legs are also of a stowter shape than in the
typical specimens of Pal. lav. The 3rd pair reach to the end of
the antennal scales, the 4th are a little shorter, and the 5th pair
reach to the distal third part of the scales. The breadth of the
meropodites of the 3rd pair (Pl. XVIIT. fig. 11) is little more
than 1 of their length, and that of the propodites little more
than 4 of the length of these joints. The basal joints and the
meropodites are smooth above, but thei lower surface is beset
with small spinules, a few of which occur also on their outer
surface. ‘The carpopodites are on all sides covered with similar
spinules, and the propodites are still more spinulose; the spinules
show here a tendency to be arranged in longitudinal rows. The
lower border of the propodites carries a row of larger spines, 9 or
10 on the propodites of the 3rd legs, which are 0°36—-0-4 mm. long;
on the propodites of the 5th pair these larger spines of the lower
border are 14 or 15 in number and become distally a little longer,
so that the last one near the articulation of the dactylus is
0-55 mm. long. The dactylopodites of the 3rd pair (fig. 11)
measure somewhat more than one third, the shorter dactyli of the
5th one-fourth of their propodites. The ambulatory legs are a
little hairy, especially the carpo- and propodites; the hairs, how-
ever, are short and fine. A tuft of hairs occurs at the distal end
of the upper border of the propodites, and those of the 5th pair
carry, moreover, a brush of hairs at the far end of the lower
border.
The rostrum of the female (Pl. X VIII. fig. 12) is slightly inclined
downward and reaches to the distal end of the peduncles of the
internal antenne. The upper border carries 9 teeth, the 3rd of
which is situated not before, but just above the frontal margin,
two standing also on the carapace; the teeth, which reach to the
tip, are a little unequal, the 2nd and the 6th being longer than
the rest, and the foremost tooth is smaller than the preceding.
The lower edge carries 5 smaller teeth, the tip of the 3rd tooth,
which is situated just below the middle of the penultimate tooth
of the upper border, is once and a half as far distant from the
extremity of the rostrum as from the tip of the 2nd tooth of the
lower border,
548 DR. J. G. DE MAN ON CRUSTACEANS [Dec. 12,
As regards the two spines on the carapace and the telson, the
female agrees with the male. The short flagellum of the internal
antenn, when put back, reaches to the Ist tooth of the upper
border of the rostrum.
The legs of the 1st pair agree also with those of the male; the
chela extends beyond the antennal scales and is distinctly more
than half as long as the carpus.
The legs of the 2nd pair are subequal, the left (Pl. X VIIL. fig. 13)
being very little larger than the right. They show a less stout
shape than those of the male, as is proved by the measurements.
For example, the width of the distal end of the carpus is but one-
fourth of its length, and the palm is also less broad in proportion
to its length. The dactylus carries one small obtuse tooth at the
end of the sharp cutting-edge (fig. 14), at one-third of the length
of the finger from the articulation, and four smaller teeth, also
obtuse, posterior to it; the fixed finger carries one single tooth
at the end of the cutting-edge. These legs are also covered with
small, slender spinules; those on the inner margin of the palm
are more prominent than on the outer and more numerous than
on the upper and lower surfaces, The ambulatory legs (fig. 15)
are also slenderer than in the much larger male.
When, however, the legs of the 2nd pair are compared with a
female from Kadjang of the same size which belongs to the typical
form (de Man, /. c. 1892, p. 449), then they appear in the female
from Christmas Island distinetly stouter, especially the carpus.
The male from the River Palopo (p.545) is 75 mm. long. The
rostrum (Pl. XVIII. fig. 16) reaches to the extremity of the an-
tennal scales. The upper border, which is slightly arcuate above
the eyes, carries 7 teeth; the 2nd tooth, situated above the frontal
border, is a little longer than the four following, which are sub-
equal; the foremost tooth is longer than the preceding and almost
twice as far distant from the penultimate tooth as from the
slightly upturned tip. The two teeth of the lower margin are
situated below the 5th and the 6th of the upper border. The chele
of the 1st pair are barely half as long as the carpus. There is but
one leg of the 2nd pair (fig. 17); this leg has a mach slenderer
shape than those of the male from Christmas Island (confer the
measurements). The carpus is, at the distal end, comparatively
only half as thick as in that specimen. The ambulatory legs
(fig. 19) are also mach slenderer than in the male from Christmas
Island.
I do not wish to go further into this question, but, at first
sight at least, it appears probable that under the name of Pal. lar
Fabr. two different species are confounded. The following may,
however, be added.
Specimens lying before me from a river near Mbawa in the
island of Flores (de Man, J. c. 1892, p. 449) belong certainly to
the same form as the male from Christmas Island. A male
71 mm. long fully agrees with it, as regards the shape and the
characters of the rostrum and of the ambulatory legs (the 2nd
1905. ] FROM CHRISTMAS ISLAND. 549
legs are unfortunately wanting); and likewise a female 50 mm.
long with the female from Christmas Island.
In a paper on some species of this genus (in the Transactions
of the Linnean Society of London, 2nd ser. Zool. voi. ix. pt. 8,
1904, p. 292), I have already alluded to the fact that in adult
specimens of Pal. lar Fabr. from Tahiti, described by me as a
variety spectabilis, the ambulatory legs presented a stouter shape
than in specimens of the same size from Halmahera; but I do not
venture to say now whether the Prawns from Christmas Island
belong to that variety or not, because they are considerably
younger.
Measurements in millimetres.
| 2 3. 4,
| 3 Bo)
| |
CER HE OLE THD WOCKY coassacascnacacace so0060 pon sda duo sesaannosllO2 | 43 75 43
Formula of the rostrum 8 y 7 9
Bos i.e 3
Length of the carpus of Ist pair of legs ..................) 75 5:3 9°3 5
a » Chela i" a ip SHEN OO BOSE AS PCTS dl lie 4e5 2:8
», larger leg of the 2nd pair..................| 49 255 |49 | 265
4 99 | WIKEHBIS) 5.0 cprcea spaces soqanosecasdcoscasseoeca|| ots 5°25 |105 | 55
Breadth of the merus proximally ........................| 15 05 12 06
9)» OUND’ Sooned snatmeucanasas Saneaoell GoRae 4) OFS) 17/1) Org)
TORT GH THOS GROWS .o5.00080 sce vaeose ays wacscccananoovacnonel| EOS || Zire) 95 57
Breadth of the carpus proximally .......................] 15 | 07 | 1:25 | 0-65
ue = oy GUISHRMU? syosocusscscassennocaccasonncell BOB | iss || The) 12
Length of the chela sepaaevanecee | 21 92 |185 88
5 Bye), TOENLGGY br oeeeanc tasienn aes te OmRese pa amner terre |e omen ts 10 4:75
Breadth ,, po Mav TCHS kes ctaococas easeesveall GP |S) 2°2 1:25
Thickness Fe we a sonpoganscss sed bbaaspana|| Grete || LIANE || ileal
Length of the shorter leg of the 2nd pair ...............)45°5 | 24:5 24
* Sry ul JK WUC np pp DoqopensaossHached tactan cseronsasena re slat | 5 5°25
Breadth ,, 6 TOROMTITEMIKT casscosenwsocooseacdeoooecell WB 1 OR 06
* a Bs distally . ‘| 24 | 0:9 09
IUESaYEAI A, HE GING CRUDE! cg enaco. s sssbecsqansasesegsonsiesnesoceal| 7s) || Zell 5
Breadth ,, i DROOTTMNY o soocoscensosssagosnccusl! 1 |) ORAS | 07
7 i ca GUNSEEMT Lage So edaeecseralnavenenewecs heey) [te cise. | 1:12
Length of the chela 185 | 8°65 | 8°75
= py) TEND Jossogsuobvassonse uence passuonbesersnosaaey| OAS. | 2S: | 4:75
Breadth ,, yi in the middle | 275 | 1°33 | 1:2
Thickness is os A Pct cee eit libel lial Wl gewe iil
Length of the meropodite * of the 3rd pair of legs sal 8 | 52 | 9-2 |
Breadth ,, De, 55 os Deo S| Oe OG) |
Length ,, propodite ss es ees G Alm | 77 | AD,
Breadth ,, x sees Be » ---| 0°78 | 0°38 | 0°65 | 0:35
Length ,, dactylopodite ,, Bs es | a3 | 14 | 9:9 |
Nos. 1, 2, Christmas Island ; No. 3, male from the River Palopo;
No. 4, female trem Kadjang, Celebes.
In another recent paper on species of this genus (in ‘Notes from
the Leyden Museum,’ vol. xxvi. 1905, p. 204, pl. 15. figs. 1-4)
I have proved that Pal. reuniannensis Hoffm., from the Island of
* The joints of the ambulatory legs are measured, their length along their upper
border, the breadth just in the middle,
550 MR. R, STAPLES-BROWNE ON [Dec. 12,
Reunion, ought to be regarded as a, probably local, variety of
Pal. lar Fabr.
The male from Christmas Island bears a close resemblance,
indeed, to Pal. altifrons Hend. from British India (Delhi, River
Jumna, Lahore), described and figured in Trans. Linnean Soc.,
2nd ser. Zool. vol. v. 1893, p. 444, pl. 40. figs. 4-6. The carapace
of Pal. altifrons is, however, slightly scabriculate anteriorly, and
the rostrum appears considerably higher above the lateral carina
than below it and than in the specimens from Christmas Island ;
the carpus of the 2nd legs, finally, has also a less stout shape.
EXPLANATION OF THE PLATES.
Prate XVII.
.1. Ptychognathus pusillus Heller, male from Christmas Island, x 2. Fig. 2.
Front, epistome &c., viewed from before, X 3. Fig. 3. External maxil-
lipede of the right side, xX 3. Fig. 4. Abdomen, X 3. Fig. 5. Chela
viewed from the outer side, X 3.
6. Ptychognathus barbatus A. M.-Edw., male from Atjeh, the cephalothorax
of which is 10°2 mm. broad; anterior half of the upper surface, X 3.
Ki
Wie}
Puate XVIII.
Fig. 7. Palemon (Hupalemon) lar Fabr. var. ?, rostrum of the male from Christmas
Island, x ¥. Fig. 8, left, fig. 9, right leg of the 2nd pair of the male,
x 2. Fig. 10. Toothing of the fingers of the left leg, x 8. Fig. 11.
Leg of the 8rd pair of the male, X 2. Fig. 12. Rostrum of the female
from Christmas Island, x 2. Fig. 13. Left leg of the 2nd pair of this
female, X 2. Wig. 14. Toothing of same leg, X 17. Fig. 15. Lee of
the 3rd pair of the female, x 4.
16. Palemon (Eupalemon) lar Fabr., rostrum of the male from the River
Palopo, Celebes, X 2. Fig. 17. Leg of the 2nd pair of the male, x 2.
Fig. 18. Toothing of the fingers of same leg, x 17 (the dactylus is a little
loose). Fig. 19. Leg of the 3rd pair, < 2.
7. Note on Heredity in Pigeons.
By RicHarp Srapies-Browne, F.Z.8.
[Received November 8, 1905. }
1. THE WEBBED Foot.
T received in 1902 a Pigeon with webbed feet, and, thinking it
would be interesting to investigate the inheritance of this
character, I made the following experiments with it.
There is no established strain of web-footed’ Pigeons, but
specimens so webbed are occasionally met with among domestic
birds. The character has been found in the Dove-cot Pigeon
and Working Homer, also in the Show Homer, Dragon, Magpie,
Tippler, Tumbler, Jacobin, and Pouter. I have myself bred birds
in the F. 4 generation of a cross between a Barb and a Fantail,
which showed this character to a considerable extent.
So far as I can at present judge from specimens recorded by
breeders, the most common type is a web between two digits
t
1905. } HEREDITY IN PIGEONS. 55
only on each foot, and it is more usual to find the development
of the web nearly symmetrical in the two feet.
It sometimes occurs between digits il. and ili. sometimes
between il. and iv., and sometimes between all three.
The instances in which it reaches the bases of the claws between
all the digits on both feet are rarer. It has occurred on one foot
only.
Though this character has been observed to occur in the
offspring of normal-footed parents, I have never heard of an
instance in which all the young so bred were webbed. It has
been found in a pigeon bred from parents of two different strains,
and I have also heard of cases in which it occurred from time to
time in the same strain, birds showing the character having
been discarded.
The general result of the experiments is that the inheritance
of the webbed foot is Mendelian.
It is recessive to the normal foot.
The character is not a thoroughly satisfactory one to work
with, as it is hable to considerable fluctuation in extent.
Extracted recessives, though all show webbing, have this
character In various degrees; in some if reached only to the first
interphalangeal joint of the second and third digits, or to the
second joint of the fourth digit.
On examining the normal population J find that birds ocea-
sionally, though rarely, occur with webs as extensive as this.
In the families here recorded I took the first interphalangeal
jomt of the second and third digits and the second joint of the
fourth digit as a minimum, and counted as “ webbed ” all birds
with a web reaching this minimum in the case of at least two
adjeining digits: all birds with less webbing than this being
iven as normal.
If a much greater series of numbers could be investigated,
undoubtedly there would be overlapping between the two classes
of normal and webbed birds.
On the other hand, the evidence, so far as it goes, does not
indicate that the degree of webbing in the parents closely limits
the amount in the offspring, for moderately webbed birds have
given birds more webbed, and fully webbed birds have given
offspring less webbed (see exp. 13 and 14).
I hope later to make further experiments with the lower states
of this condition.
Web-footed 3 wsed'in Experiments.
The Pigeon which I used in the following experiments
somewhat resembled an Antwerp in appearance, but was of no
distinct variety. The web extended to the base of the claws in
both feet, but the digits were rather closely webbed together
except ill. and iv. of the right foot, where the web was sufficiently
loose to allow the usual spread of the foot. The bird was of the
Proc. Zoot. Soc.—1905, Vou. I. No. XXXVIT. 37
DD2 MR. R. STAPLES-BROWNE ON [ Dec. 12,
ordinary blue colour found in Columba livia. The feathers on
the back of the head were perfectly smooth (cf. Nun Pigeon).
It was bred Ly Mr. Doggett, of Cambridge, in 1896, from a pair
of birds with perfectly normal feet. The parents produced several
offspring showing webbing in varying degrees. Three of these
birds were exhibited by Mr. Bateson at the Zoological Society, and
are described in the ‘ Proceedings’ for Dec. 15th, 1896, p. 989.
(The bird used is No. 3 in that description.)
si was also described and the right foot figured by Mr. Tegetmeier
1‘ The Field’ of Sept. 12th, 1896.
“it appears that some of these birds were bred together and
produced, among others, a bird with completely webbed feet, the
web being sufficiently loose to allow the normal spread of the foot
between every digit. This bird was exhibited by Mr. E. 8.
Montagu at a meeting of the British Ornithologists’ Club on
Jan. 22nd, 1902. It is described in the report of the meeting
(Bull. B. O. C. xii. p. 41), and again in ‘The Field’ of Feb. Ist,
1902 (vol. xeix. p. 177).
“ Nun” Pigeon 2° used in Hxperiments.
The Nun is an old established strain of Pigeons, originally a
variety of Tumbler. The feet are normal and free from feathering.
It exhibits a tuft of reversed feathers standing up at the back of
the head forming the “shell.” It is slightly larger than the peak
found in the Turbit and some similar varieties.
Crosses between the Web-footed Pigeon and the Nun Pigeon.
The experiments were begun in 1902. The original cross was
made between one pair of birds only, viz., those described above.
The subsequent experiments consisted of breeding from the birds
produced by the first cross.
The results of the experiments, so far as they concern the two
principal characters of web-foot and “shell,” are given in Table I.
The table is arranged in a similar manner to that used by |
Bateson and Punnett in the description of their experiments with
Poultry in the second report to the Evolution Committee of the
Royal Society. The ordinary Mendelian terms are used :—
D and R being the original dominants and recessives ;
DR is the first hybrid generation or F.1;
DR
a
the heterozygote dominant in F. 2;
DD : :
amr the homozygote dominant in F. 2; and
z the extracted recessive.
The same terms over 3 apply to similar forms in F. 3.
The asterisk shows that the bird is bred from a DR x R mating,
and not from a DR x DR.
NOEs OTN
HEREDIVY IN PIGEONS.
8 0
Soe wees
‘quasqy | “quesotg
eS ee
« TUS;
1905.]
Td xud
(LXUd
Wax ad
UAxXUd
CxXxuad
xU
‘Bue yY JO
9.14 B NT
|
« [US ,, JO V9 MOSalT
=d—~.. 112485,
G @
<= |
: g UKE | eo vi
€ G
== x —,
E e «OL os UE v
3 g wd X— || 9¥7¢@ Vv
e Ptal
—= < |
V € mT ud | €L Vv
Lo 8 =] es @
[0 L —] = d
6 G
2 v xo xt al VV
6 6
2K =
‘ - #1 «tf Vi
0 61 UdxXud | ELBE Vv
q v UxXud | ot V
g 6 |"uaxua | — Vv
0 IL | Waxuad || erv9 Vv
v g UXud | 9 PT Vv
0 9 aUxd | oes] Vv
PMPMITEEUION | suey | OX
(ee Ree eee ic a ut pasn | 7795's.
FOOT : | OSTY
|
MA
| =| eee) eRe ewe | ee
“qaaKT
“qooy [BULLION = N
|
G 61
8 0
T IV
8 0%
€ 8&
& VG
G 61
G 8g
I ly
40.530(]
I
I
440590]
4903.50(]
“dx
WOAz -
ULSIIG
‘T ATAV
GoM
‘dx
UL pasn
os[y
300f pag? AA = A —"29 90.
V M 8 pee PL
Vv M g Se alee weak €1
Vv M g Gin pores SL
Vv N T OF II
“SO6L
d N € Gite ii ee OL
d N V iia lies 6
Vv M S Te pees 3
W M 6 OF po L
(ee a)
Vv N T OF |< uorgtqedat
(Gas
Vv N I Cora G
“POBL
Vv ef Beye pi
V N I OF etwas e
V N I Cae ak b
“€06L
d
« 110US ” fF |
37#
DDA4 MR. R. STAPLES-BROWNE ON [ Dee. 12,
A discrepancy will be noticed between the numbers of birds
illustrating the foot character and those which show presence or
absence of “shell” in the same experiment. This is accounted
for by the fact that it is possible to recognise the webbed or
normal foot on hatching, or even in birds found dead in the egg-
shell if sufficiently incubated, whereas the presence or absence of
the “shell” can only be ascertained when the feathering of the
young birds is fairly advanced.
It was noticed that many of the young birds which were
webbed were extremely weakly in the nest, and several of them
died at a very early age. Of thethree extracted web-footed birds
bred in Exp. 4 from “the DRx DR mating, not one was reared.
The extracted webbed birds whose purity was tested were all
bred from the DR x R matings.
Discussion of Results.
Foot character —It will be seen from the foregoing table that
the feet of the F.1 generation, of which six birds were bred,
were all normal, the web character behaving as a recessive. Two
pairs of F.1 were mated, and in experiment 4 the webbed foot
reappears in three birds out of the twelve, this being the exact
proportion expected on the Mendelian hypothesis.
From the other pair (Exp. No. 3), however, no recessives
appeared, and the mating was repeated in 1904, as Exp. 6, with
the same result. During the two years that these birds were mated
together 29 eges were laid and 23 birds produced, all showing the
normal foot character. The absence of webbed birds in this
family was quite contrary to expectation, for 5 or 6 recessives
were to be expected. In order to test the matter further, in
1905 the two F.1 birds in question were mated to extracted
recessives, and, as will be seen on referring to experiments 11 and
12, webbed and normal offspring were then obtained in approxi-
mately equal numbers in accordance with Mendelian expectations.
The absence of recessives in the 23 birds in F.2. bred in
experiments 3 and 6, is very remarkable. Whether it arose
from any definite disturbing cause, or was merely a chance
aberration, cannot be asserted. The behaviour of the same birds
when mated to pure R clearly proves that their gametic production
was then normal.
In the matings of DR’s both with the original recessive web’
and with the extracted recessives eine results are simple. It will
be noticed that in experiments 2,5, 11, and 12 fifteen webbed
and fifteen normal birds were produced, the Mendelian expectation
of such a mating being equality.
It bemg imposeible to test the purity of webs bred by the
DRx DR mmatines as the birds died in the nest, the extracted
recessives from the DRx R matings were used, and experiments
7, 8, 13, and 14 show the results. Nineteen birds were raised in
these four experiments, all having the feet webbed.
HEREDIVY IN PIGEONS,
1905. ]
‘yeudou AT — IL ie
[BuO AL = — lit S i me OY I GA
. 2 tee . on Fe I ae,
jemsou AL — Ol = ou : Gc I T tH) UI “ve
‘jeuUMOU AL — bbs ee gm — gout foe geal ecereete he ialacgees™ Sabo = (8 a
-/wULLOU foe ae ®eom — Zo aa | (eumeu Ni = |i G
Be oid ele EY ‘(Ee dm — g¢ on yeutou AL — TL oe I tt
Mi b AL z ut mb i & } UL ‘TRULIOU AL — ae a z¢
AL ie @ ut ‘ ES enn Gara : : ee t) aces
ei RS Buta. oe pune Ee er en ee gon
Peers: oS Se SR yea ri 1¢!
c : oo8 pt = a NL ==
i ee SG ee pis Sethe 2s T én
WIN se 1¢éu Ne Oe = POU | a We = eq) ya oS ea
“ph At ae Ott edit — ¢ot GPa — [om Ae Joo ut
(@ ; oO Mt ‘op ut — ee oar —(*)géum G = ob it
(EO a = Owe ee Gout oop ae (oow “e att
‘Busou at — It or VE ra le —— Fe i j AL — @ Pit as col
‘yeMaou AL — ut (6 gir —(#) gor y b Area ORL 7c Zoi
2 wae - 0K ’ a tee 5 ~
poar — gem ROM fal ee oe ae é ao
Te ee 7 Pe (2)¢ 0) (iy, = but | —NIOT AL -— TIL (a) ¢ T ih l
. te ee | 2 sae 2 =
‘edgar —(2)a¢ ene pur — Zo | petom AL — Uy wks zo k
(8) oda T)GOM Gedm — gen ()goar — To € z 3
OO ee gi (2) 6 aa | $G al Tom yg 2 a
pear — edit 1G ft —(%)G ou nia at —. e oir (Ee ZO)
‘yeULIOU AL — eae a nk Fe a I ea NS ni Rae Get
year — oom Pp Oss ae te eae: eb mt Da Go!
Zoal — gout ee =. LOM GOAL So OU DE Gol
euoOu Av") Ts ie & F mm —(%)gou a A =O) ta I C l
v eee Oo \ io oC ;
eéoar — [Om OM aL ae oh ae —()edm (%)% Got
$host — e git cu = 2on Se — [om c BG bu
poar — oom ‘eo — Zou ON Se ie (Hae!
ae — II FW a TOA SC DSUE po (eeu
aa | ¢ IIL ‘a g Ge oe b At G Bate e oe
Zo Ar — To at & ir — got en — ed it re @ Ou
‘ 3 ind .. ‘ ai . a
‘oat — yor rE GOW tel ss oe —(F)eout e Eo
‘coal — Zoi Qe — Cow [be se See Hee ios e but as eeu
e b AT = © ee ‘e ) ul a: z @ i jeiatou Al Came sail On e Zz 6 Ul
. c ; ¢ i] 50 . tee
‘ZG AL -— Snes Ou — g¢ou a AL — gut e geu
; DW re s: -edat —(2)7 out ; SG
poar —()edm GO ONE | eae (Had ut o ae Hl
soar — edu oe edt — gol ee @Qat — oi c GePu
"]RULIOU al ene 505 (3 g Wy) tt = — Z db i [® VO UYAT ae ce iG ob l
‘juMAOU AL(E— UI & yin sy ia ae CEA Sere GRULT Ga got
ig Ea eomq— gen yemou AL — Ir & (3
ee aa oe ees jemuouatg— ul q ou z
“LOO LHOIY alete zoug-- %
‘LOOW Laary
‘TT STav L
506 MR. R. STAPLES-BROWNE ON | Dee. 12,
Variation in the Amount of Webbing.
T have stated that the webbed foot is subject to considerable
fluctuation, both when the character is observed to occur in
normal strains and when it appears as an extracted recessive
in these experiments.
Table II. is arranged to show the approximate stretch of the
web in the case of each bird recorded in the experiments. The
observations were made by bending the foot and noting to which
part of each digit the web was attached. In the table D
stands for the digit, and ¢ for the phalanx. Unless otherwise
stated, it should be understood that the web is attached to the
distal end of the phalanx in question ; but if a fraction is inserted
after the number of the phalanx, then the web is attached halfway
or three-quarters of the way up that phalanx. No very accurate
means of measurement were applicable, and the estimations
should be taken as approximate only.
The experiment numbers refer to Table I.
Brackets are placed round the number of a bird to signify that
the bird died either in the egg-shell or very soon after hatching.
In all 37 web-footed Pigeons have been raised in the experi-
ments, but upon such omally numbers discussion of the relationship
of the several graduations is impossible.
It may, however, be noted that some extremely small webs
were raised in experiments 7 and 8, although the birds were bred
from parents both showing the web character in a higher degree.
Experiments 13 and 14 have already been discussed.
Il. THe SHELL.
It will be seen from Table J. that this character behaves as a
simple recessive throughout the experiments with the webbed
strain (but v. infra).
In experiments 3, 4, and 6, out of the 29 birds bred, 6 show
the “shell” in F. 2, a sufficiently close result.
The extracted recessives bred true, as shown in Exp. 9.
In Exp. 10 the number of recessives (5:2) is too high for a
DRxR mating, which should have given equality, but the total
is very small.
Further Experiments with “ Shell.”
The same Nun female which was used in the foregoing
experiments was also mated to a Barb male.
There is no need to give here a description of the Barb beyond
the statement that the feathers on the head are always smooth
aid no crest or ‘‘shell” is ever found.
The results of the mating of Barb ¢ and Nun @ are recorded
in Table IIT.
1905. | HEREDITY IN PIGEONS. DoT
Taare ITT.
| Bhp Nsw nese AIson | e
peas | 9 ‘ S used 3 = S used | Netate sel.
@, | = OD in 1 ge in | bate Sik
| Og Exp. Se Exp. | Mating. Present. Absent.
| |
1901. | |
a i Nun — P ee Barb — A Y | RxD 2 2
|
1902. |
B 8 §o De Se eh = | @DEDR) 2 1
none a
1903 |
Y soa) Wi = ee P ee Barb — A a | RxD 0) 8
ahs é: |
1904.
|
Cis el lapie y A — | 8 y A — | DRX DR 1 10
P = Presence of “ shell.”
A = Absence of “ shell.”
It will be noticed that as a result of the mating of Nun 9°
x Barb ¢ in Exp. «, a mixed generation was obtained as regards
“shell” in F.1. The two birds in which the “ shell” was absent
were ¢, the two in which it was present were 2. It was thus
impossible to test the “shelled” birds by mating together, and
little or no clue is obtained as to their gametic constitution by
Exp. /3, as the numbers are so small. It may, however, be
recorded that both the ‘ shelled” females and one of the smooth-
headed males were mated subsequently to smooth-headed birds
which were crosses in F. 1 between a Barb and a Fantail. From
these matings :
Barb Nun 2 8 (shell) x Barb Fantail ¢ gave 8 young.
Barb Nun 92 18 (shell) x Barb Fantail ¢ gave 5 young.
Barb Nun ¢ 54 (no shell) x Barb Fantail Q gave 6 young.
Of these 19 birds so produced, none had “ shells.”
In view of these results, which indicate that “shell” is a
recessive character, the appearance of “ shells” in the two females
mentioned above is paradoxical. It is likely that this 1s some
failure of dominance and that the birds were gametically DR’s.
A similar irregularity is recorded in the Report to the Evolution
Committee of the Royal Society, i. p. 114, as regards extra toe
in fowls, which, though generally dominant, is sometimes
recessive.
It was found inconvenient to follow up the experiment at the
558 MR. F. E. BEDDARD ON A NEW (Deen;
time, but in 1903 the mating a was repeated in the experiment y,
in which the cdentical birds used in a were again mated together.
In this experiment a uniform generation was obtained. A pair
of birds bred in this F. 1 generation were mated together and the
result is recorded in exp. é.
The total results of the mating of Barb and Nun are :—
(Exp. a, y) F. 1: shell present 2; shell absent 10.
(Exp. (3, c) F. 2: shell present 3; shell absent 11.
I can also mention here that two birds which were crosses, in
the F.1 generation, between a Nun and a Fantail, kindly sent
to me by Miss Thiselton-Dyer, showed no trace of “shell.” These
birds were not bred from.
The experiments here recorded form part of a larger investi-
gation into heredity in Pigeons still in progress, which has been
subsidised by the Government Grant Committee of the Royal
Society.
I am indebted to Mr. J. Lewis Bonhote for raising and recording
birds bred in Exp. 14, also to Mr. R. J. Elwell for raising birds
in Exps. 9 and 12.
I have also to thank Mr. Bateson, who has most kindly
supervised all the experiments.
8. On a new Species of Worm of the Genus Pontodrilus from
the Shores of the Red Sea. By Frank H. Bepparp,
M.A., I'.R.S., Prosector to the Society.
[Received October 5, 1905. |
(Text figures 78 & 79.)
The specimens of Pontodrilus upon which the following
description is based were kindly placed in my hands by Mr. Cyril
Crossland, F.Z.8. They were collected by that gentleman “in clean
shell and coral sand on the shores of an islet in Khor Dongola,
on the Soudan coast.” Mrz. Crossland further informed me that
the worms “ live about the highest level at which the sand is kept
wet by the sea. As there is practically no rainfall the water in
which they live is undiluted by rain almost always. A species of
Nereis and some Crustacea share this habitat.” There is thus no
doubt about the purely marine surroundings of this Pontodrilus,
which so far agrees with the majority of the species of the
genus.
The general aspect of the worms was like that of the other
species of Pontodrilus with which I am acquainted.
Thelength of the largest and fully mature example was 102 mm.,
the size being thus about the average size of the species of this
genus.
1905. | SPECIES OF WORM FROM THE RED SEA. 559
The prostomium was frequently difficult to define accurately,
owing, of course, to a protrusion of the buccal cavity. In three
specimens, where its characters were very plain, | observed two
conditions. In two individuals the prostomium was continued
over the first segment of the body by grooves extending over about
half that segment; in the other there was no such extension
backwards of the prostomium. As both of these specimens were
immature, I have no positive reason for asserting that they are
not different species. But existing knowledge of “this genus does
not favour the supposition that two species live i in common in one
limited area. 1 should prefer, therefore, in the meantime to
regard the character of the prostomium as variable in this parti-
cular. The prevalent arrangement in the genus is an epilobic or
(as I prefer to call it) epicheilous prostomium. But one species,
P. insularis, is reported to have no process of the pecstomn ay
and also a v. aviety of the type form P. matsushimensis * described
by Dr. Michaelsen. But in this case the variety does not occur
in the same locality as the type.
The sete, as is usual or universal (?, in the genus, are paired, and
the two sete of the ventral pair clcse- together than those of the
lateral pair. On the xvilith segment, which bears, as in other
species, the male pores, the most ventral seta of each ventral
couple is present, but I did not detect the more dorsal seta of the
couple.
The clitellum in this genus usually embraces segments x1l1—XVil.
In the present species it very distinctly extends over the xviiith
and to the very end of that segment. This is the first external
feature which has led me to distinguish the present species as new
and undescribed.
The genital papille confirm by their arrangement this point of
view. Itis true that I have examined Dally one fully mature worm
and that the papille are known to vary fT among mature specimens.
I find, however, that in no species already known is there a close
appr oximation to the conditions which obtain in the species of
Pontondrilus which forms the subject of the present communication
For in the present species the genital papille are very distinctly paired
structures, and not single and median. Moreover, they lie in front
of the male pores, and there are no papille following the male
pores which are so prevalent in the genus Pontodrilus. The paired
pa pillee lie between segments xili/xiv and xiv/xv. They correspond
in position to the ventral sete. The anterior pair are decidedly
larger than the posterior pair. These papille are very flat and
hardly, if at all, project beyond the adjacent surface of the
hody. The appearance when seen through a hand-lens is shown
in the figure (text-fig. 78, p. 560). The centre of each papilla
is opaque, white, and either somewhat kidney-shaped (anterior
papille) or more rounded (posterior papillz). This is surrounded
* Michaelsen, Zool. Jahrb. Syst. Abth. xii. p. 220.
+ E.g. P. laccadivensis, see Beddard in ‘ Fauna of Maldive and Laccadive Arch.’
vol.1. pt. 4.
560 MR. F. E. BEDDARD ON A NEW | Dee. 12,
by a clear ring, and this again by a broader and opaque, white,
halo.
The male pores are very conspicuous upon the xvilith segment,
and, as in other species of Pontodrilus, the area upon which they
open is depressed in a sucker-like fashion. Each depression is
divided into two by a transverse raised fold. The actual pore
seems to correspond in position to the outer of the ventral seta
couple. Although the external characters are suflicient to define
the present as a new species of Pontodrilus, in the existing state
of knowledge of that genus it may be useful to give particulars
of certain internal organs which are known to vary from species
to species.
Text-fig. 78. Text-fig. 79.
to)
Text-fig. 78.—Ventral view of Pontodrilus crosslandi, sp. 0.
Some of the segments are numbered 7, 8, 9, &c.
Text-fig. 79.—Ventral view of Pontodrilus laccadivensis F. EK. i.
Some of the segments are numbered 7, 8, &c.,
The gizzard is not at all prominent.
The anterior intersegmental septa are as usual much thickened.
The last of these thickened septa divides segments xiii./xiv.; but
1905. | SPECIES OF WORM FROM THE RED SEA. 561
this septum is not quite so strongly developed as those which lie
in front. The last hearts lie in segment xii. The nephridia are
obvious 1n segment Xv.
The spermathece, which open in line with the male pores, 7. e.
with seta 5 of Michaelsen’s scheme * , havea single diverticulum of
about half the length of the pouch itself, Their pores are situated
between segments vii./vill. and viil./ix.
The spermiducal glands, like those of some, but not every, species
of the genus, possess a distinct duct separable from the glandular
and also tubular region by a constriction and by its nacreous
appearance due to the strong muscular coat. The elandular part 1s
fully six times as long as the muscular duct. The duct in the
fully mature is aioeret into a horseshoe- shape. It is of uniform
thickness thoughout, and does not increase in diameter towards
the external pore.
For the purposes of an easier comparison with other species I
append a definition of this new Pontodrilus, which I propose to
name after Mr. Crossland.
Pontodrilus crosslandi, sp. n. (Text-fig. 78.)
Length about 100 mm. Prostomiwm epicheilous (4-3). Sete
paired rather distant ; distance a—b less than e-d. Clitellum xitir.—
avi. Male pores (on xvii.) and spermathecal pores (vii./viii.,
viti./ix.) im line with seta b. Papille paired on intersegmental
areas wxtit./xiv., xiv. /av. Last thickened intersegmental septum
xiti./xiv. Last hearts i inaxiit. Spermathece with single diverticulum
half the length of the pouch. Spermiducal glands with distinct
muscular Hab. Shores of Khor Dongola, Red Sea.
In view of the cutting of the Suez Canal and the alleged and
consequent migration of the Wileu eines nen fauna eastwards and
of eastern at some to the same 7, it is important to note that the
species Pontodrilus crosslandi is by no means a variant of, or most
nearly related to, the Mediterranean P. littoralis. It comes
nearest, as I am inclined to think, to P. laccadivensis and P.
matsushimensis var. chathamiana by reason of its anteclitellian
papille, unknown in other species. It lacks the papille following
the male pores, which are so general in Pontodrilus.
To emphasise the likenesses and also the differences between
P. crosslandi and P. laccadivensis I add a figure of the latter
(text-fig. 79, p. 560) for purposes of comparison. This species has
not yet been figured, though its essential characters have been
described £.
* Oligocheeta, in ‘ Das Thierreich,’ 10 Lief. (Berlin, 1900).
+ E. A. Smith in P. Z. S. 1891, p. 396.
{ Beddard in ‘The Fauna and Geography of the Maldive and Laccadive Archipe-
lagoes,’ vol. iv. pt. iv. p. 374.
“62 MR. F. E. BEDDARD ON A (Dec: 12,
9, On a new Enchytreid Worm (Henlea lefroyi, sp. n.) from
India destructive to the Eges of a Locust ( Acridium sp.).
By Frank E. Bepparp, ‘M. A., I’.R.S8., Prosector to the
Society.
[Received October 5, 1905. ]
Dr. 8. F. Harmer, F.R.S8., of King’s College, Cambridge, was
so good as to forward to me recently a tube of small white worms
for identification and study. These had been sent to him from
India by Mr. H. Maxwell Lefroy, Entomologist to the Government
of India, who discovered that they attacked and destroyed the eggs
of a locust belonging to the genus Acridiwm when the ground in
which those eggs were deposited i is moist.
Dr. Harmer directed my attention to the fact that they were
Oligochetous worms; they prove to be a species of the family
Enchytrieide, and were in a good state of preservation for
microscopical examination. The family, as 1s well known, occurs
in damp earth as well as in water; it is not so purely aquatic as
are some of the families of the ‘ Microdrili.”
The species appears to be new, and presents a certain number
of characters which in combination render its inclusion in any
already defined genus difficult. I shall, however, describe its
characters before proceding to discuss its systematic position.
The species is smal], 3-4 mm. in length and, as, already mentioned,
white. The sete are curved and of the usual Enchytreeid form ;
they are, however, rather few in number in each bundle, though
present upon all the segments of the body, with the exception of
the first and apparently the twelfth (in the mature worm with a
clitellum). The lateral bundles possess two sete apiece, and the
ventral bundles three; very occasionally I observed three sete in
a dorsal bundle. This arrangement extends from end to end of
the body.
The number of segments in a large specimen is 27.
I could detect no dorsal pores.
The clitellum and other external characters call for no
remark.
The alimentary canal shows certain characters which assist in
the placing of the species. Peptonephridia are present and of
very small length, though I am unable to give any details con-
cerning them. The cesophagus appears to pass without any break
into the intestine; I can find no demarcation between these two
sections of the gut. Behind the clitellum the gut is of course
much wider than it is in front of that region of the body.
Furthermore, I can discover no ceca or pouches of any description
appended to the gut. It is a simple tube without outgrowths.
The septal glands of this species extend back as far as the sixth
segment, in which the last pair occur ; in front of this pair and
in segments iv. and v. are equally prominent pairs of septal
glands.
1905. | NEW ENCHYTREID WORM. 563
The dorsal blood-vessel is anteclitellian in origin and does notseem
to be connected at its point of origin with any dorsal diverticulum
of the gut such as exists in Buchholtzia. It arises in the xith
segment. I could see no “heart body.”
The exact origin of the dorsal vessel is rather difficult to locate
exactly in this very minute Enchytreid. I fix the xith segment
as the point of emergence from the intestinal plexus, since the
vessel is very much broader here than in the dorsal region of the
blood-plexus posteriorly * and stands out more from the walls of
the gut. The vessel is, in fact, in this segment quite twice the
width that it is anteriorly to the pont in question. Commonly,
for example in Henlea nasuta, the dorsal vessel is much wider at
its emergence from the intestinal plexus than it is anteriorly.
This is confirmed by an examination of a series of transverse
sections, from which it was evident that the dorsal vessel stood
away from the walls of the intestine in the anterior part of the
clitellum ; it was indistinguishable posteriorly.
Concerning the reproductive organs, it may be observed, in the
first instance, that the position of the various ducts and pouches
is perfectly normal. The external orifices of the atria are very
conspicuous upon the ventral surface of the twelfth segment, in
line or nearly so with the ventral setze of that segment. These
sete are, however, absent, and there are no penial sete of any
kind. The testes and the ovaries occupy their usual segments,
. é. Xi. and xii. Concerning the exact form of the sperm-duct
funnel I am unable to give details; but I have identified them
and satisfied myself that they are of the usual Enchytreid
pattern.
The spermathece offer characters of obvious systematic use.
They open on the one hand into the cesophagus in the fifth
segment, and on the other by a muscular duct on to the line dividing
segments iv. and v. I could not find any diverticula. There are
but a single pair of spermathece.
In the above description I have only been able to dwell upon
a certain number of facts which are of systematic importance in
the group. Of importance in determining the genus are: (1) the
presence of four bundles of curved sete on all the segments of
the body, save the first and the twelfth; (2) intraclitellian origin
of dorsal vessel; (3) absence of any diverticula to cesophagus ;
(4) simplicity of spermathece and their communication with
cesophagus.
Of the thirteen genera allowed by Michaelsen 7, 9, viz., Acheta,
Michaelsena, Mesenchytreus, Chirodrilus, buchholtzia, Hnchytreus,
Stercutus, Marionina, and Lumbricillus, are excluded by these
characters. Though I did not find any dorsal pores, it is clear
* It must be borne in mind that Pierantoni (“Studi anatomici su Michaelsena
macrocheta Pierant.,’ Mitth. Zool. St. Neapel, xvi. 1903, p. 409) traces a distinct
dorsal vessel in the intestinal plexus posteriorly to the region where the former is
said to commence. But this does not affect the point of emergence.
+ Oligocheta, in ‘ Das Thierreich’ (Berlin, 1900).
564 MESSRS. C. WARBURTON AND N. D. F. PEARCE oN [ Dec. 12,
that the present species cannot be safely referred to the genus
Fridericia, which is so distinctly characterised by the peculiar
paired character of its sete. There remains only Henlea and
Bryodrilus, from which, however, the species described in the
present paper differs im several points. With genera described
more recently than those included in Michaelsen’ s comprehensive
work just quoted, e. g. Hydrenchytreus*, 1 cannot identify this
semiparasitic Enchytrzid from India.
It is true that four species, viz., Marionina glandulosa, Enchy-
treus minimus, EH. parvulus t, pal E. twricensis, possess, as does
the species dealt with here, two sete in each lateral, and three in
each ventral, bundle ; but 1 do not regard those TB: opean species
as identical with the present Indian form.
Tn the meantime I place the species in the genus Henlea, where
the characteristic glandular pouches of the gut are occasionally
absent (e.g. Henlea dicksoni), in default of living material and
a more exhaustive examination. I propose to name it after
Mr. Lefroy, who first directed attention to the species.
10. On new and rare British Mites of the Family Oribatide.
By Cxcu, Warsurton, M.A., F.Z.8., and Nicen D. F.
Prarce, M.A.
[Received November 21, 1905. |
(Plates XIX. & XX. f)
Since the publication of Mr. A. D. Michael’s: Monograph on
British Oribatide in 1888, only a single new species, so far as we
are aware, has been described from these islands. This was a
Lohmannia taken in Ireland by Prof. Carpenter and described by
Berlese in ‘ Redia,’ vol. ii. fase. 1. (1904, Aug. 18), as LZ. insignis.
Curiously enough this mite was in our hands while the Italian
arachnologist was describing it, and narrowly escaped another
specific name.
No doubt the workers in this particular group have been Pa
but it is a striking testimony to the thor oug limes ss of Mr. Michael’s
work that so long an interval should have elapsed without
substantial addition to the British list of Oribatide, for the study
of which his labours have so admirably paved the way.
For two years we have searched pretty thoroughly the
neighbourhood of Cambridge, and especially of Grantchester, and
liens examined moss from many other localities, and we thare
hitherto met with 82 of the species described in the Monograph,
and the seven forms, new, we believe, to science, of which the
diagnoses are given below.
* Bretcher, Rev. Zool. Suisse, 1x. p. 208.
+ This worm is described by Friend (Irish Nat. xi, 1902, p. 110), though no
sufficiently to permit of any. certainty.
+ For explanation of the Plates, see p. 569.
PAS MOOS, voll tle.
E.Wilson,Cambridge.
BRITISH ORIBATIDA..
PAS. WO vol, PICK.
E.Wilson, Cambridge.
BRITISH ORIBATIDA:.
1905. | BRITISH MITES OF THE FAMILY OkIBATIDE. 565
Fam. ORIBATID2.
Subfam. ORIBATINA.
Gen. OrrpBata Latreille.
ORIBATA FURCATA, sp. nov. (Plate XIX. fig. 1.)
Adult. Length 500 gw. Colour dark brown, nearly black.
Surface polished. Lamelle, blades on edge with very long
cylindrical cusps, the whole extremity of the cusp being occupied
by the base of the long lamellar hair. Translamella an inverted V.
Interlamellar hairs present.
Pseudostigmatic organs long, sub-clavate, directed forwards and
upwards.
Pteromorphe small. Claws monodactyle. Genital and anal
orifices moderately far apart, shaped like the keystone of an arch ;
the anal considerably the larger.
Nymph and larva unknown.
Two specimens found in moss from Austwick Bog, Yorkshire,
in May 1904.
There is no danger of confusing this very distinct species with
either of the other two known British monodactyle Oribatas,
O. fusigera and O. parmellie. The first is very minute, while the
second has hairs on the notogaster, and short clavate pseudo-
stigmatic organs.
ORIBATA OMISSA, Sp. nov. (Plate XIX. fig. 2.)
Adult. Length 700 ». Colour dark brown. Surface highly
polished and shining. Body distinctly broadest in the middle.
Lamelle, blades on edge, with a long sharp-pointed cusp standing
free, the lamellar hairs springing from the inner angle of the
cusps. No translamella. Claws tridactyle. Not rare in moss, at
Cambridge.
Nymph and larva unknown.
We think it likely that this species kas hitherto been overlooked
on account of its resemblance to the common and extremely
variable species O. lapidaria, and in spite of the different facies, due
chiefly to its barrel-shaped body and polished surface (destitute of
a light spot), there seemed to be few clear distinctive characters.
The absence of any trace of a translamella, and the sharp-pointed
cusps, are, however, good characteristics. Though occurring in
the same neighbourhood their habitat is different, O. omissa being
exclusively found in moss, nor have we met with any intermediate
forms.
ORIBATA RUBENS C, L. Koch.
This very distinct species occurred in Sphagnum from heath-pools
at Bournemouth in October 1905. It is about 500 y in length,
chestnut-coloured, and with very long legs. It is now for the
first time recorded as British.
Ou
lor)
(or)
MESSRS. C. WARBURTON AND N. D. F. PEARCE ON | Dec. 12,
Subfam. SERRARIINA.
Gen. SerraArius Michael.
SERRARIUS MICROCEPHALUS Nicolet.
This interesting species, which Mr. Michael in his ‘ British
Oribatide’ describes as occurring rarely at Epping Forest, the
Land’s End, and Swanage, was found in abundance in the autumn
of 1904 in the moss of an osier-bed at Grantchester, Cambridge,
and several specimens of the nymph, hitherto unknown, were
discovered. ‘This is a remarkable creature, entirely unlike the
imago, and has the habit of carrying on its back the cast larval
and nymphal notogastral skins (Plate XIX. fig. 3). As each of
these skins bears round its edge eighteen conspicuous spines,
proceeding from short apophyses, the. fully-grown nymph has a
remarkably spiny appearance. The colour is pale yellow and the
surface finely punctate.
In 1879 Kramer (in the Archiv f. Nat., Jahrg. 45, Bd. i. p. 16)
described a new species of mite which he named G'ustavia sol,
which, so far as we have been able to ascertain, only Oudemans
has suspected of belonging to the Oribatide. He states that it
is probably the nymph of a Serrarius. A glance at Kramer’s
figure at once makes it perfectly clear that he was dealing with a
Serrarius nymph, and he even gives a drawing of the mandible,
perfectly characteristic in shape, but lacking the serration, which
is always difficult to see. He mentions no locality, and attributes
to the animal a size much too large (1:2 mm.) for either of the
known Huropean species of Serrariws. Possibly the length given is
intended to include the legs. In any case, Gustavia sol Kramer
can now be stated to be a nymph of Serrariws, as Oudemans
suspected.
Subfam. NovasPiIpIN2.
Gen. Liacarus Michael.
LIACARUS BICORNIS, sp. nov. (Plate XIX. fig. 4.)
Adult. Length 600 p. Colour red-brown. Surface highly
polished. Lamelle, large blades on edge, near together and
sub-parallel, but slightly converging anteriorly. Very long free-
projecting cusps, from the extremities of which proceed the long
lamellar hairs. Translamella and interlamellar hairs wanting.
Pseudostigmatic organs long, filiform, curved upwards and
slightly outwards.
Abdomen very globular, with rather prominent shoulders, and
with a few longish hairs.
The coxa of the 4th leg is almost as long as the femur, and is
produced anteriorly in a pointed blade.
Three specimens were found in moss from Austwick in May
1904, and one from moss from the river-bank near Ely, in July
1905.
Nymph and larva unknown.
1905. ] BRITISH MITES OF THE FAMILY ORIBATID#. 567
The appearance of the living mite strongly recalled Serrariws
microcephalus, but its chelate mandibles remove it from that
genus. It also bears some superficial resemblance to Votaspis
biprlis.
Gen. Noraspis Warren.
NorasPIs MACULOSA, sp. nov. (Plate XX. fig. 1.)
Adult. Length 520 p. Colour light brown. Surface spotted,
the spots being in the epiostracum and easily rubbed off. Cephalo-
thorax very long and pointed, nearly } the length of the abdomen.
Lamelle, long ridges, arising near the pseudostigmata, converging
at first, and then extending parallel for 2? the length of the
rostrum. Pseudostigmatic organs long and slender, very coarsely
pectinated on their anterior border. Claws monodactyle. Ab-
domen long oval, somewhat truncated at each end. Legs long
and slender, with globular joints.
Nymph and larva unknown.
Three specimens were taken in moss from Nine Wells, Cambridge,
in May 1905.
The nearest allies of this fine species are among the minute
forms of which WV. splendens is the type. Like them, it has a
peculiar habit of shaking its beaded legs asitruns. Its large size,
spotted surface, and pectinate pseudostigmatic organs render its
identification easy.
NorasPIS SCULPTILIS, sp. nov. (Plate XX. fig. 2.)
Adult. Length 330». This mite has a close general resemblance
to WV. splendens, but, on careful examination, may easily be
distinguished from that species by the peculiar design of the ridges
on the vertex and notogaster. These are best understood from
the figure, but may be described thus :—
The lamelle arise from the pseudostigmata, converge sharply,
and then continue forward and parallel. Atthe extreme point of
convergence there is a faint translamella, and from its extremities
ridges proceed backwards. On the notogaster there is a well-
marked transverse ridge close to its anterior border; the ends of
this ridge curve abruptly backwards, approach slightly, and then
separate again.
Pseudostigmatic organs long, rough and hairy.
Nymph and larva unknown.
Ten or twelve specimens were found in wet Sphagnum sent by
Miss Heath, of Crayford, from the Devil’s Punchbowl, Hindhead,
in June 1905.
This species seems to be allied to Hremaeus novus Oudemans.
Subfam. NotHRINz.
Gen. Notrurus C. L. Koch.
NovHRUS CRINITUS, sp. nov. (Plate XX. fig. 3.)
Length 900 ». Colour dark brown. Integument more fully
chitinised than is usual in this genus.
Proc. Zoou. Soc.—1905, Vou. Il. No. XXXVIIT. 38
568 ON BRITISH MITES OF THE FAMILY ORIBATIDE. [ Dec. 12,
Claws monodactyle. Pseudostigmatic organs long and fili-
form.
Nymph and larva unknown.
This fine species is closely allied to WV. targionti Berlese, but
may be distinguished from it by the much longer, wavy, wn-
pectinated hairs on the notogaster. The apophyses from which
these hairs spring are very small, while in WV. targiont they are
exceedingly conspicuous.
A single example was sent by Mr. W. Evans, taken at Loch
Gally, Fife, in May 1905. Another specimen was found by us in
Sphagnum from Blairgowrie, Perthshire, in November 1905.
This species, even more strongly than 1. targionit, recalls
Hermannia bistriata, and in these three forms the two genera
approach one another very closely. ;
Norurus TecroruM Berlese. (Plate XX. fig. 4.) (Hypocthonius
tectorwm Berlese, Acari Myriapoda et Scorpiones etc., fase. 78,
no. 8, 1896.)
This species, which we at first regarded as new to science and
which may be easily recognised from the figure (Pl. XX. fig. 4),
is no doubt identical with the Hypocthonius tectorum of Berlese.
That arvachnologist has, we believe, been misled by an apparent
segmentation artificially produced by slight pressure in mounting.
We have examined many living specimens, and specimens mounted
without pressure, and these present no trace of segmentation ;
but we find that a transverse furrow (varying slightly in position
and width) is readily produced in the soft integument when the
cover-slip is allowed to press somewhat heavily upon it. The
species must therefore be removed to the genus Nothrus, to
which it undoubtably belongs.
Not rare in moss from walls and house-roofs at Grantchester,
Cambridge.
NOTHRUS CRASSUS, Sp. nov. (Plate XX. fig. 5.)
Length 500 ~. Colour light yellow-brown. Integument smooth
and very imperfectly chitinised. Claws tridactyle. Pseudostigmata
fairly large but not very projecting. Pseudostigmatic organs
spindle-shaped, often directed backwards, and rather large.
Genital and anal plates large and close together.
An aquatic or amphibious species occurring in Sphagnwm in
heath-pools near Bournemouth, in company with 1. glaber and
N. monodactylus.
Of the not very well-defined genus NMothrus the five species
tectorum, turdus, glaber, monodactylus, and crassus form a compact
group, agreeing in the rounded form of the abdomen and in their
very slight degree of chitinisation. Tectorwm and tardus are
terrestrial species, while the other three always occur in or near
vater, and in glaber and monodactylus the pseudostigmatic organs
are absent.
1905. ] ON SOUTH AUSTRALIAN SPIDERS. 569
NovHRUS ANAUNIENSIS Canestrini & Fanzago.
There has always been some uncertainty with regard to this
species, which very closely resembles JV. sylvestris. On looking
over our British specimens of supposed sylvestris, however, we
find some which agree precisely with the description of anauniensis,
being tridactyle and having the abdomen rounded posteriorly, with
short spatulate hairs of about equal length.
This species is therefore for the first time recorded here as
British. The diagnosis is complicated by the fact that we find
some specimens of undoubted sylvestris which are didactyle, but
in no case have we come across a tridactyle specimen of the
form characterised by the more truncated abdomen and filiform
hairs of unequal length. The two species are, no doubt, closely
allied, but there appear to us good grounds for regarding them as
distinct.
EXPLANATION OF THE PLATES.
Prats XIX.
Fie. 1. Oribata furcata, p. 565. 1a, pseudostigmatic organ; 16, lamella.
2. Oribata omissa, p. 565. 2a, pseudostigmatic organ; 2 6, lamella ;
2c, tectipedinm ; 2d, femur of Ist leg.
3. Serrarius microcephalus, nymph, p. 566. 3a, markings on noto-
gaster more highly magnified.
4. Liacarus bicornis, p. 566.
PuatTE XX.
Votaspis maculosa, p. 567.
Notaspis sculptilis, p. 567.
. Nothrus crinitus, p. 567.
. Nothrus tectorum, p. 568.
. Nothrus crassus, p. 568.
Fig.
Oe whe
11. On some South Australian Spiders of the Family
Lycoside. By H. R. Hoge, M.A., F.Z.8.
[Received October 17, 1905.]
(Text-figures 80-89.)
The Spiders described in the present paper are from the
Collection of the 8. Australian Museum, Adelaide. I am indebted
for the loan of them to the kindness of its Director, Prof. E. C.
Stirling, F.R.S. They were collected, however, chiefly from the
north side of the River Murray in New South Wales.
This important group of roving Spiders ranges in great numbers
over every part of the known world, and the main features of the
type species, L. tarentula Rossi of the type genus Lycosa Latreille,
are so closely reproduced, even to the pattern on the back of the
abdomen, in the most widely separated countries (in Australia
with Z. obscura, L. godeffroyt L. Koch, LZ. hasseltii L. Koch,
etc.), that all attempts to divide them into subsidiary genera,
until we reach a few less numerous and quite outlying forms,
have proved unsatisfactory. Consequently many earlier genera,
38*
570 MR. H, R. HOGG ON (Dec. 12,
such as Pirata Sund., Trochosa C, Koch, Arctosa C. Koch,
Tarentula C. Koch, Potamia C. Koch, &c., have been abandoned
by later writers.
M. Simon (Hist, Nat. des Araign. vol. 1. pp. 317 e¢ segq., 1898)
separates the main group into those species following Lycosw
Latreille, but further divides it into a number of sub-types and
those following Pardosa C. Koch. The former comprises species:
which have the front aspect of the cephalothorax moderately
sloping at the sides and a lip longer than broad; the latter those
with the front aspect squarer with more perpendicular sides, the -
lip broader than, or at least as broad as, long, and having as a
subsidiary character the tarsal joint of the fourth pair of legs
longer than the patella cwm tibia of the same.
Some years ago, following these lines, I constituted a new genus,
which I called Venator (Proc. Royal Soc. Victoria, vol. xiii. pt. 1,
1900), for some species with a more extremely widened type of
frontal aspect, but with the lip clearly broader than long and the
tarsal joint of iv. not so long as tibia cum patella iv.
However, the more specimens I examine the more the only
tangible characteristics show themselves to be interchanged, and
I look on these two genera as no more distinctly definable than
M. Simon’s above mentioned other varieties of Lycosa (loc. cit.
pp. 346-349).
M. Simon further makes a division between those species with
two teeth on the inner margin of the falx-sheath and those with
three.
The bulk of the Australian species have three, but (in Horn
Exped. part ii. p. 349, 1896) I described Z. cowlei which had five
large equal-sized teeth on same, and no other specially marked
characteristic distinguishing it from the rest of the genus.
Out of about 60 specimens in the present collection there are
12 species of Lycosa, of which no fewer than 9 are new, and one
new Dolomedes. These I have described below.
Synopsis of Species.
In all. Three large equal sized-teeth on inner mar gin Os falx-sheath. Front row
of eyes shorter than middle row.
a. Eyes of front row of equal width. 3
Under side of abdomen wholly black. Clypeus wider
than the diameter of eyes of front row .. L. tasmanica, sp. nov.
6. Diameter of median eyes of front row larger than laterals.
a!, Clypeus wider than the diameter of the front median
eyes.
a*. No distinguishable pattern on under side of abdomen.
Abdomen underneath pale yellow-brown. Tibial
joint of palp longer than patellar. Cephalo-
thorax equal in length to patella eum tibia iv.. D. arenaris, sp. nov.
62. A shield-shaped or triangular field on under side of
‘abdomen.
a®, A fawn-coloured shield on a dark brown ground.
Cephalothorax shorter than patella cum ‘tibia i iv, LL. molyneuxi, sp. nov.
63, A black shield on yellow-brown ground.
Median eyes of front row barely their diameter
from eyes of second TOW sic. cee eeseeeeeeessees Le. Stirlinge, sp. nov.
1905. | SOUTH AUSTRALIAN SPIDERS. 571
61. Clypeus not wider than the diameter of the front
median eyes.
a4, Abdomen underneath wholly brown or black.
a. Black underneath; a dark pattern on buff
ground on upper side. Median and marginal
stripes on cephalothorax ..................-.004. -.... D obscura L. Koch.
6°, Brown underneath.
a®, Dull dingy brown underneath, yellow-brown
above; pale median and margmal stripes on
cephalothorax... us L, gilberta, sp. nov.
68, Bright chocolate-brown under neath, ‘with lars ze
buff spot on upper side at base. Legs brown
from base to middle of patella, remainder
buff . L. bicolor, sp. nov.
bt, A triangular shield pattern n underneath abdomen on
Pee -yellow ground.
. No pale median or marginal stripes on cephalo-
thorax.
a8. Shield brown.
a’. Shield long and narrow, pale chestnut.
Clypeus as broad as front median eyes ...... LD. castanea, sp. nov.
69, Shield broad oval, dark brown edged with
yellow stripes. Clypeus three-fourths the
diameter of front median eyes.................. LL. errans, sp. nov.
68. Shield black. ,
a, Shield reaching only about halfway to spin-
nerets. Eyes of second row less than half
their diameter apart ......... noose, EA UAE WEIS
610, Shield reaching near ly to ‘spinnerets. Eyes
of second row four-fifths of their diameter
apart ..... DL phyllis, sp. nov.
. Pale median and marginal ‘stripes | on n cephalo-
thorax.
A dark brown nearly black shicld halfway to
spinnerets. Clypeus ay Stan narrower
than front median eyes.. jacoconosecascsases — tom AMIRI? Wp NK
LyYCOSA TASMANICA, sp. nov. (Text-fig. 80, p. 572.)
Cephalothorax dark brown, with narrow paler marginal and
side stripes and only faint median stripe. The mandibles are
black-brown, with yellow-brown hair on upper and outer portions.
Lip, maxille, sternum, and coxe black-brown, with dark brown
hair. The upper side of the abdomen has a dark brown bell-shaped
pattern at the base marked out with yellow-brown streaks on
chocolate-brown ground. The posterior half is dark brown, with
faint traces of paler transverse stripes. There is a rather pale
stripe down each side separating the back colour from the wholly
black-brown field on the under side. The legs and palpi are
chocolate-brown all over, except the under side of the femora
which are paler yellowish grey.
The cephalothorax is of the broad frontal type, being three-fifths
of its greatest breadth at the base of the mandibles, and one-fourth
of the same only in height from the mandibles to the level of the
rear row of eyes.
The front row of eyes appears slightly procurved, the side eyes
being as broad as the median eyes, but oval. The latter are half
their diameters apart and rather less from the side eyes. The
clypeus is wider than the median eyes. The latter are their
572 MR. H. R. HOGG ON [ Dee. 12,
diameter from those of the second row, one of which, in this
specimen, is abnormally small. They are yellow on wide black
rings, and apparently two-thirds of their normal diameter apart,
and one-eighth of their length wider than the front row.
The mandibles are as long as the front of the cephalothorax,
and half their length in breadth.
There are three large teeth on the inner margin of the falx-
sheath and one large tooth between two smaller at irregular
intervals on the outer.
Text-fig. 80.
Lycosa tasmanica.
a, epigyne; 0b, eyes from front *.
The lip and mawille are covered with rough upstanding bristly
hair. The former is broader than long, slightly incurved in front
and less than one-half the length of the maxille. The sternwnvis
a broad oval; the hair on this and the cove thick, but shorter and
less erect.
The palpi are longer than the cephalothorax, and the legs have
two spines above on tibiz iii. and iv., none on tibie i. and il.
The hair on the abdomen is coarse and thickly laid. The
epigyne is arched but broader than long, the median ridge being
a broad flat plate fallmg from above.
* The measurements given for the eyes are, in all cases, in tenths of a millimetre.
1905. | SOUTH AUSTRALIAN SPIDERS. 573
Measurements in millimetres.
Long. © Broad.
Cephalothorax ... 13 \ a um Hanami
Abdomen yeu... Ils 9
Mandibles......... 6
Trochanter Patella Metatarsus
Coxa. & femur. & tibia. & tarsus.
Me ireracr ines ao fal 113 Lip Se ease
2. 42 103 11 IO. = Bes
3. 44 10 9 Qe), BS
Ae 12 124 Ce
IBEW) Leap aoce anpeae 23 6 4) A — eee
One female sent by Mr. Dove from Table Cape, Tasmania.
It may be worth noting that this Tasmanian species conforms to
the type of three species of my Venator class from Macedon,
40 miles north of Port Phillip Bay, Victoria. It was at Macedon
that I discovered a species of Peripatus new to Victoria, which
subsequently turned out to be the normal Tasmanian species.
Lycosa PHYLLIS, sp.n. (Text-fig. 81, p. 574.)
Cephalothorax dark brown, with chestnut-brown downlying
hair. No distinctly marked median or marginal stripes, but the
hair is rather thicker there. The side streaks nearly bave,
showing the under surface. :
Mandibles black-brown, covered all over with thick matted
buff-coloured hair.
Lip, maxille, sternum, and coxe dark reddish-brown with
brown hairs, the sternum thickly matted.
The abdomen on the upper side has a dark brown hair-pattern
of usual type on paler ground. Angular transverse stripes, six or
seven in number, with pale spots at each end. The sides pale
yellow-brown ; on the under side a broad shield-shape black-brown
field extends from the genital fovea nearly to the spinnerets,
where the buff ground of the sides comes across. Anteriorly of
the genital fovea clearly paler than the field, but still dark brown.
Spinnerets dark brown.
The legs and palpi are of a medium yellow-brown; the under
side of the femora more red-brown.
The cephalic fovea is short and shallow.
The eyes of the front row are ,one-half the diameter of the
median apart, and the same distance from the margin of the
clypeus and those of the second row. ‘The laterals are three-
fourths the diameter of the median; whole row slightly procurved.
The eyes of the second row are distant from one another four-
fifths of their diameter, which is 23 times that of the front median.
The mandibles are longer than the front patella. There are
574 MR. H. R. HOGG ON [ Dec. 12,
three large teeth on the inner edge of the falx-sheath, and a thick
fringe on the outer, which hides the teeth if any.
The lip is broader than long, slightly hollowed and bevelled in
front, constricted at base, and reaches to less than half the height
of the maxille through beginning below them.
The epigyne is longer than broad and narrowest anteriorly.
There are two spines above on tibie iii. and iv., none on
tibiee 1, and 11. '
The metatarsus of the fourth pair of legs is shorter than the
patella cwm tibia of same.
Text-fig. 81.
Lycosa phyllis.
a, eyes from front; 6, epigyne; c, upper, and d, lower sides of abdomen.
Measurements in nullimetres.
Long. Broad.
Cephalothorax ... 1] i : iupinon
Abdomen ......... 12 7
Mandibles......... 4}
Pat. & Metat.
Coxa. Tr. & fem. tib. & tars.
Weg somes ans. 1 ays gi 9 1 = 302
ish dns) gi 81 Queer Qu
Si en 8 8° Q 5. 9B"
4 3s 10 10 13 = 363
1905. | SOUTH AUSTRALIAN SPIDERS 575
Two females from the Gilbert River, Riverina, sent by
Mr. A. Molyneux. One female from Kangaroo Island (A. Zietz),
paler and rather smaller.
LycosA MOLYNEUXI, sp. nov, (Text-fig. 82.)
The cephalothorax is red-brown, with pale to darker yellow-
brown downlying hair intermixed with dark brown upstanding
hair; a paler marginal and median stripe with side-streaks the
same.
Text-fig. 82.
Lycosa molyneuxi.
a, eyes from front ; 4, epigyne.
The mandibles are black-brown, with yellow-brown hair except
on the lower inner edges of the falx, which are bare. The lip,
maxille, sternum, and coxe are reddish-brown with yellow-brown
hair. The legs and palpi yellow-brown; the under side of the
femoral joints much paler than above.
The abdomen is yellow-brown above, with a small darker patch
at the base and two pairs of darker spots near the middle. The
sides are pale. The under side of the abdomen is a bright rich
brown anteriorly, with two broad stripes of the same curving
inwards and joining in front of the spinnerets, which are of the
same colour. The space enclosed from the genital fovea to the
point of juncture is of a pale buff.
The cephalothorax is rather narrow in front and shorter than
patella cum tibia iv.
576 MR. H. R. HOGG ON [ Dec. 12,
The eyes of the front row are clearly procurved. ‘The side
eyes not quite = the diameter of the median, having their centres
on a level with the lower part of the latter. The median pair
are half their diameter apart, the same distance from the eyes of
the second row and slightly less from their own laterals. The
clypeus is broad, the distance to the root of the mandibles being
twice the diameter of the front median, but a transverse edge
marking runs across at more than half the distance away from
the eyes; the whole distance is of the same colour and covered
with hair.
The eyes of the second row are rather more than half their
diameter apart, their total width being 13 of that of the front
row, Those of the third roware three times their diameter apart
and = the diameter oF those of the second row.
The mandibles ave 3 longer than the front patelle, are thickly
covered with downlying matted hair, interspersed with upstanding
bristles; on the inner edge of the falx-sheath are three equally
large teeth, and on the outer edge one similar sized large tooth
between two smaller ones.
The lip is straight across the front, but the edge slightly
hollowed and bevelled forward ; it widens towards the base, where
it narrows somewhat suddenly. It is clearly less than half the
length of the maxille, which are broadest § of the distance from
she base; rounded in front and on the outside, and narrowed
considerably at the basal end.
The sternwm is broadly ovate, almost pointed at the base, thickly
covered with short coarse hair.
The abdomen is a long oval, thickly covered with short fine
downlying hair.
The spinnerets are rather prominent, covered with thick
coarse hair.
The epigyne is only slightly longer than broad and not much
narrower anteriorly than at its base; the median longitudinal
ridge broadens out considerably from the basal to the anterior end.
The legs are moderately long and stout, thickly covered with short
downlying hair and upstanding bristles. There are two median
spines on the upper sides of tibize 111. and iv., none on the same of
tibiee i. and 11.
The palpi are clearly longer than the cephalothorax.
In colouring, pattern, and size, this spider is very like Z. lewck-
artit Thor. fret Peak Downs, Queensland, as described by L. Koch,
but differs in having the pattern of the under side of the abdomen
bright brown instead of black-brown, The clypeus is much wider,
instead of slightly only, than the front median eyes, which are
rather wider apart than they are from the side eyes instead of
equidistant. The palpi are longer instead of shorter than the
cephalothorax, and the lip less instead of more than half the
length of the maxille. The epigynal ridge of leuchkartii is drawn
by L. Koch widest in the middle, while here it certainly widens
from the middle anteriorly.
1905. j SOUTH AUSTRALIAN SPIDERS. 577
Measurements in millimetres.
Long. Broad.
1.5 =;
Cephalothorax ... 10 | . an EEO,
‘Abdomen... -5.- 163 11
Mandibles......... 5
Pat. & Metat
Coxa. Tr. & fem. tib. & tars.
TES S50 BA 5-3 Ty ae gi 104 LSS Be
Deu 9 gi a 32
So, 2h 8: 82 91 = 304
4 4} 94 11 14 = 39
Pralpi. rat eiaes tess 2 5 3 Do = 143
One female sent by Mr. A. Molyneux from the Gilbert River,
Riverina, and I have named it after the sender.
Lycosa CASTANEA, sp. nov. (Text-fig. 83.)
Female. Cephalothorax and mandibles pale yellow-brown, with
pale yellowish-grey hair, without distinct marginal, median, or side
Text-fig. 83.
Lycosa castanea.
a, epigyne; 6, eyes from front.
stripes. Lip, maxille, and coxe bright yellow-brown. The
abdomen above bright chestnut-brown ground with pale creamy-
578 MR. H. R. HOGG ON [ Dee. 12,
yellow transverse stripes; underneath, a chestnut triangular
shield, broadest at base and narrowing to spinnerets, which lie at
its apex ; sides pale creamy-yellow.
Legs and palpi bright chestnut all over, except the under side
of the femora, which are of a pale cream-colour.
The cephalothorax is rather broad, being four-fifths of its
length at its greatest breadth, and in front one-half of its length.
The mandibles are also half the length of the cephalothorax and
proportionately stout. There are three large teeth of equal size
on the inner edge of the falx-sheath, and one as large between
two small on the outer edge.
The front row of eyes is straight, the median being 13 times as
far apart as they are from the laterals. Their diameters are in
the same proportion.
The clypeus is as broad as the front middle eyes ; the latter are
half their diameter from those of the second row, which are
slightly less than their diameter apart and twice that of the front
median.
The lip is broader than long, straight in front, and less than
half the length of the maxille.
The abdomen is a broad oval, thickly covered above and below
with short smooth downlying hair.
The epigyne is of a trapezoidal outline, broader than long, with
the broadest part anteriorly, where also the middle ridge is very
broad, tapering to where it springs from a base of the usual type.
The legs are long and powerful; and the palpi (from the
trochanter) longer than the cephalothorax.
There is one spine above on tibia 1., two on tibie ii., i11., and iv.
Measurements in millimetres.
Long. Broad.
Cephalothorax ... 1 | : ee front.
Abdomen ......... 13 1O- ;
Mandibles....... SDN Ween)
4 Pat. & Metat.
Coxa. Tr. & fem. tib. & tars.
ILS octioacess I 5 12 123 12 eel
2. 42 Wa 114 12 = BY
3. 4d 10 103 UO i B7/
Bh 5) 12 122 WG = ABY
Palliolicn aeetactterercctsce 24 5 54 35 = IGS
In measurements and pattern of epigyne and other points
this species differs but slightly from JZ. errans, sp.nov. The
coloration of the latter is, however, much darker. Its large
second row eyes are only % of their diameter apart, and the
median ridge of the epigyne in the female is broader anteriorly,
and the base of same reaches to 3 of the length. The clypeus
1905. ] SOUTH AUSTRALIAN SPIDERS. 579
also is not so wide as the front median eyes, instead of equal. It
has no spines on tibia i. or ii. above, and lip only as broad as long
instead of broader.
One female (without locality) sent from Adelaide, S.A.
Lycos ERRANS, sp. nov. (Text-fig. 84.)
The cephalothorax is red-brown, with yellow-brown downlying
hair; mandibles black-brown, with rather brighter coloured hair.
Lip, maxille, sternum, and cox dark chocolate-brown. The
abdomen above dark brown, rather thick coarse hair, with four
pale spots at the base and transverse stripes of bright pale buff
from middle to posterior end ; on the underside a broad dark brown
field reaching from base nearly to the spinnerets ; the sides light
yellow-brown.
Text-fig. 84.
SA
Saye es
Lycosa errans.
a, eyes from front ; 6, epigyne.
The legs are yellowish-brown, the patelle and tibie darkest,
and the underside of the femora almost silver-grey.
The cephalothorax is broad, being four-fifths its length in the
broadest part and two-fifths in front, and not so long as patella
cum tibia iv.
580 MR. H. R. HOGG ON [Bree Wy,
The eyes of the front row are in a straight line, the laterals half
their diameter from the median, which are 13 that distance apart,
their diameter being rather more than twice the same. The
clypeus is less than their diameter by one-third. They are half their
diameter from the eyes of the second row, whose diameter is twice
that of the front median, and this is 14 times their distance apart.
The mandibles are long and stout. There are three large teeth
on inner margin of falx-sheath, one large between two small on
the outer.
The lip is as broad as long, straight m front, and less than half
as long as the maxille.
The abdomen is a broad oval. In the female the epigyne is
of a trapezoidal outline, broadest anteriorly, where it is broader
than its length. The base of the median ridge reaches 3 of
the whole length, and is narrowest in the middle, the ridge being
broader anteriorly than the base.
The legs are long and stout. There are no spines above on
tibie i. and ii.; two each on tibie iii. and iv. The palpi (from
trochanter) are longer than the cephalothorax.
Measurements wa nuillimetres.
Long. Broad.
‘ nah 5 in front.
Cephalothorax ... 13 | 10
Abdomen ......... 104
Mandibles......... 6
Pat. & Metat.
Coxa. Tr. & fem. tib. & tars.
Tiegs ore ee en 122 ie es 42
2 eens 1 ees
Bahl tae 108 i 18 = 383
A. Ase 18 1st 162 = see
(11 & 42)
IBefilgesnsccncbookt- 23 61 pL AL = 82
One female, without locality or collector.
Lycosa BICOLOR, sp. nov. (Text-fig. 85.)
Cephalothorax bright yellow-brown (buff) all over, no side or
median streaks. Mandibles, with hair of the same buff colour,
dark brown underneath : fangs dark red-brown. Lip and maxille
dark olive-brown with dark brown hair. Coxee dark olive-brown.
Sternum black-brown. Abdomen rich chocolate-brown on upper
and under sides, with a bright buff field on upper side anteriorly,
reaching to the middle of the back where it ends in a point. It
is half as bread as long in the female, but in the male, which is
young, a narrow stripe only.
Legs deep chocolate-brown from coxe to near the anterior end
of the patella, which is buff. Tibia, tarsus, and metatarsus buff
1905. ] SOUTH AUSTRALIAN SPIDERS. 581
on both upper and under sides. Palpi: femur dark brown, other
joints buff.
The cephalothorav is square in front, the greatest breadth ‘io
thirds its length, covered with thickly matted coarse hair. The
front row of eyes is procurved, median pair larger than laterals.
Clypeus rather narrower than front median, which are only half
that distance from the second row eyes.
The two middle row eyes are more than 24 times the diameter
of the front median and 3 of their diameter apart. The eyes of
the third row are 3 times their diameter apart, and half that
distance from the eyes of the second row.
There are three large teeth on the under side of the falx-sheath,
one large between two smaller on upper side of same.
Text-fig. 85.
Lycosa bicolor.
a, eyes from front; 6, epigyne.
The lip is slightly broader than long and less than one-half the
length of the maxille.
The oval sternum is three-fourths as broad as long.
There are no spines above ol tibie i. and ii. of female. One
short one in male. On tibie iii. and iv. above there are two in
both male and female.
Tn the female the outline of the epigyne is oblong, rounded at
the corners, one and a half times wider than long. The median
ridge is narrowest in the middle, widening out at aco end.
The palps of the male specimen cremate a moult of development.
582 MR. H. R, HOGG ON [ Dec. 12,
The measurements of the female (in millimetres) are as
follows :—
Long. Broad.
Cephalothorax ... 12 | : tp earn
Loe
Abdomen ......... 123 9
Mandibles......... 6 longer than pat. 1.
Pat. & Metat.
Coxa. Tr. & fem. tib. & tars.
JUCEIS) sacbnenes Dae mtg 10 10 10 =& se
My Gh 93 94 Ms = 325
3 4. A 9 = 32
4 43 10 Ith. 13s = 39
Papi. scence 23 5 By , = 16
One male (undeveloped).
Two females. The locality is not given.
Lycosa GILBERTA, sp. nov. (Text-fig. 86.)
Cephalothorax brown with yellow-grey hair; a paler yellow-
Text-fig. 86.
Lycosa gilberta.
a, eyes from front; 6, epigyne.
grey median, marginal, and four side-streaks on each side, the
latter backed by darker brown. Mandibles black-brown with thick
1905. | SOUTH AUSTRALIAN SPIDERS. 585
yellow decumbent hair and long erect brown bristles. Lip,
maxille, and sternum dark red-brown, with dark yellow-brown
hair. Coxe with rather browner hair.
The abdomen above is yellow or grey-brown, almost orange on
the sides in some specimens, in others paler yellow-brown. The
whole of the under side from base to spinnerets of a dull dingy
brown, about the same colour as the coxe. Legs and palpi red-
brown, with pale yellow-grey hair somewhat darker underneath.
The cephalothorax is as long as patella cum tibia iv. ; as broad
as femur i. It is slightly wider in front than one-half the greatest
breadth.
There are three large teeth of equal size on the lower edge of
the falx-sheath, and one large tooth between two small teeth, the
lower of which is a little distance off, on the upper side.
The front row of eyes is straight along the lower edge, the
larger median being 14 times the diameter of the laterals ; they are
one-half the diameter of the larger apart. The clypeus is as broad
as the median front eyes, and they are the same distance from the
pair of the second row. The latter are § of their diameter apart,
and the row is one-third longer than the front row.
The lip is broader than ‘long, and barely half as long as the
maxillee.
There are two spines above on tibie 111. and iv., none on 1.
and 11.
There are five females from the Gilbert River, Riverina, all
fully developed. Two large and three smaller vary considerably
in size, but I can liseon er no structural differences between
them.
The epigyne is of a horseshoe-shape, slightly broader than long.
The median ridge broad at the base, and tapers to a narrow ridge
anteriorly.
Measurements in millimetres
(of a large and small specimen respectively).
Long. one F
( ae 3 in front.
Cephalothorax 14 10
INipdomienweeesree 17 13
Mandibles........ é 62
Pat. & Metat.
Coxa. Tr. & fem. tib. & tars.
Wegsiacacasp- le 12 13 1 ren}
De. 10) 114 12 12 = 404
Be ees) iil il 12 = 39
AL 14 14 Wi = 51
Ralloitescey Plaats 21 61 5 Ae — veel
Long Broad
Cephalothorax ... iii \ 5 1
Abdomen ......... 13 9
Mandibles......... S
Proc. Zoou. Soc. 1905, Vou. Il. No. XX XIX. 39
584 MR. H. R. HOGG ON [ Dec. 12,
Pat. & Metat.
Coxa. ‘Tr. & fem. tib. & tars.
ees sackets lain ace 9 10 Oertiee ae
oe Be es 9 Oe 0
Syaape eine 8 on eso
4, A 10 10 14 = 38
Lycosa STIRLING, sp. nov. (Text-fig. 87.)
Female. Cephalothorax brown, with paler median, side, and
marginal stripes. Mandibles black-brown, with red-brown hair.
Lip, maxille, and sternum red-brown, with dark red-brown hair.
Coxe dark red-brown, with paler yellow-brown hair at anterior
ends.
The abdomen above is black-brown, with dark red-brown hair
and with just a faint pattern. Underneath bright red-brown,
with black shield broadest at the genital fold and tapering to the
spinnerets.
Legs and palpi yellow-brown all over, lighter on the under sides.
Tn the male the stripes on the cephalothorax are more silvery,
and the hair on the coxe and legs generally paler yellow-brown.
The cephalothorax is of the high narrow type, the clypeus
being more than twice as wide as the front median eyes.
The front row of eyes is slightly procurved, the median eyes
slightly less than their diameter apart and the same distance from
those of the second row. The laterals have their diameter slightly
smaller than that of the median, and are # of it from the median.
The eyes of the second row are twice the diameter of the front
median apart, and their diameter slightly more.
The eyes of the third row are four times their diameter apart.
In the male the front row of eyes is rather more procurved than
in the female, and the eyes of the second row just their diameter
apart.
The mandibles are longer than the width of the cephalothorax
in front. They have three large equal teeth on the lower edge of
the falx-sheath and one large between two small on the upper
edge.
The lip is as broad as long and less than half the height of the
maxille.
The sternum is of a broad shield-shape, thickly covered with
coarse flatly placed hairs.
The legs are thickly covered with short flatly placed hairs, there
ave no bare long streaks, and a fair number of erect bristles. On
the upper side of the tibial joint the female has two spines on
the 3rd and 4th pairs. In the male two on all the tibie.
The tibial joint of the palpi is longer than the patella.
In the female the epigyne is narrowest anteriorly, and is
23 times as long as it 1s broad at the base. The median ridge is
be roadest at the base and tapers anteriorly, Outside the epigyne
proper, on each side of the base, is a darkened oval hollow, with
its longer diameter lying longitudinally.
1905. | SOUTH AUSTRALIAN SPIDERS. 585
This species in many points resembles Z. ramosa L. K., described
from an immature female, but besides being larger has no rings
Text-fig. 87.
Lycosa stirlinge, 6 & 2.
a, eyes from front of female ; 6, male palp; c, epigyne.
on ‘the legs. The front row of eyes is shorter than the second
instead of being equal, and the median eyes of the front row are
586 MR. H. R. HOGG ON [Dec. 12,
only one instead of two diameters from those of the second row ;
also the tibial joint of the palpi is longer than the patellar joint
instead of equal to it.
Measurements in millimetres.— Female.
Long. Broad.
fae
Cephalothorax ... 11 { = Ea ACT
Abdomen ......... 9 6
Mandibles......... D4 much longer than front patella.
Pat. & Metat.
Coxa. Tr. & fem. tib. & tars.
Degg rita Ee ti Oe os OF i = 325
By Be 9 9 9 = 303
3 Oey 83 83 8 = 283
Ae 10 10 2 363
Patlipincicac ae eee 2 5 44 3. eee Tee
Male.
Long re
Cephalothorax ... 8 16 q
Nibdomente ee. 8 5
Mandibles......... 4
Pat. & Metat.
Coxa. Tr. & fem. tib. & tars.
f Oey edie Aone 1 355 9 10 Ih = 334
2 3 8 9 105, = 303
} 3 94 i 10 = 292
a, 3a 92 Oe Set nee. Se
Palipiy Seen. eae of 4 on ous es le
One male and one female from Gilbert River, Riverina, collected
by Mr. A. Molyneux.
Liycosa ARENARIS, sp. nov. (Text-fig. 88.)
Cephalothorax yellow-brown ; hairs red, black, and white mixed
over cephalic part, behind this a white patch extending to middle
of rear slope, and less distinctly pale round the margin. Mandibles
dark brown, with erect brown and decumbent greyish-yellow hairs.
hip, maxille, and sternum yellow-brown, with pale greyish-yellow
hair. Coxe yellow-brown.
Abdomen dull grey-brown, irregularly spotted with small
patches of white hairs, the underside dingy brown, the centre
area rather paler than the sides.
The legs and palpi yellow, brown decumbent hairs and darker
brown erect bristles, with a ring of paler yellow round femur,
middle of tibia, and metatarsal joints.
The front of the cephalothoraz is high and narrow, with a clypeus
twice the width of the front middle eyes. The front row of eyes
1905. j SOUTH AUSTRALIAN SPIDERS.
is straight, the median larger than the laterals, all equidistant,
less than half the diameter of the median from one another. From
the second row to front median equals the diameter of the front
laterals. The eyes of the second row are rather more than half
their diameter apart, which is twice that of the front median ;
they are three diameters away from the rear row.
On the lower margin of the falx-sheath are three large teeth.
The mandibles are longer than the front of the cephalothorax.
The (ip is as broad as long and half the length of the maaile.
The sternwm is a broad oval, pointed posteriorly and thickly
covered with coarse hair. The coae have only short fine hairs
lightly spread.
Text-fig. 88.
Lyecosa arenaris.
a, eyes from front; 6, epigyne.
The abdomen is oval, rather pointed posteriorly. The epigyne
of the female broader than long, with a narrow middle ridge and
the basal part curling round outside the horseshoe-shaped middle.
The legs are rather fine. There aro two spines above on tibiz 1i1.
and iv., none on the first or second pairs. On the under side the
spines are long and stout.
The tibial joint of the palpi is longer than the patella.
Measurements in nullimetres.
Long. Broad.
1 in fr
fephalothorax ... 6 { re AON
/NISOMOUIETIY Bogogoace Z 4i
Mandibles......... 3)
4 Pat. & Metat.
Coxa. Tr. & fem. tib. & tars.
The gsi seas Ws es ») 54 ee!
Deri 2 Ad aa 5 = 162
Suet 43 43 5 = 163
4, 22 6 6 8 = 223
. . il 5) G 3 7,
Ballpl wes .csess nae. Be 3 21 ay 8
588 MR. H. R. HOGG ON [ Dec. 12
Two females brought by the Horn Expedition from the
MacDonnell Ranges.
This species rather closely resembles L. Koch’s Z. crispipes from
Rockhampton, though larger. It is more faintly marked on the
cephalothorax, and is without the pattern on the back of the
abdomem. The lower edge of the front row of eyes is straight
instead of procurved, and the epigyne is broader at the base,
which curls round instead of ending at the base of the horseshoe
parts.
In this species the cephalothorax is as long as patella cwm
tibia iv. L. Koch says that in Z. erispipes it is longer than
tibia iv.
DOLOMEDES HABILIS, sp. nov. (Text-fig. 89.)
Cephalothorax chocolate-brown, with a narrow pale yellow-
brown stripe reaching from the second row of eyes to the rear
slope, and a similar stripe on each side of the cephalothorax at
about one-third of the distance from the margin to the middle
line.
Text-fig. 89.
Dolomedes habilis.
a, eyes from front; 6b, epigyne.
The mandibles are black-brown, thickly covered with long
yellow-brown hair. The lip and maxille yellow-brown ; sternum
rather more yellow. Legs and palpi yellow-brown all over,
brighter underneath. The : abdomen is yellow-brown, of the same
shade as the upper side of the legs. The sides paler yellow- brown
in the front half, merging into the same colour as that of the back
towards the rear, the paler part being divided from the hack by a
1905. ] SOUTH AUSTRALIAN SPIDERS. 589
bright yellow-brown stripe of the same colour as on the cephalo-
thorax. The under side of the abdomen is yellow-brown, with
a faint shield-pattern marked out by paler side-lines and two
similarly coloured parallel lines inside.
The cephalothorax is moderately high in front, being two-thirds
as high as broad in that part and rather more than half as broad
as in its widest part ; the median line slightly slopes upwards as
far as the rear end of the longitudinal fovea, whence it falls
steeply down.
The front row of eyes is recurved or straight along the upper
edge, the median pair being their diameter apart; the laterals
are two-thirds the diameter of the median and the same distance
away from them. ‘The clypeus is twice as broad as one median
and lateral eye with the space between them. The eyes of the
second row are a diameter apart, larger than the front median and
their diameter from them. The eyes of the third row are as large
as the second, on rather large prominences, and 5 diameters apart.
The mandibles are as long as the width in front of the cephalo-
thorax, and have one small and three large teeth on the inner
margin of the falx-sheath, with one large between two small on
the outer.
The lip is slightly broader than long, straight in front and
half the length of the maxille.
The sternwm is nearly round, and thickly covered with short
downlying hair.
The abdomen is ovate, straight in front, with four prominent
muscle-spots in the anterior half above, with short decumbent hair.
The epigyne of the female is oval, the inside oval hollows being in
the anterior part of the arch.
The palpi ave longer than the cephalothorax, and the tibial
joint is longer than the patella.
The legs are covered with smooth decumbent hair, and there is
a not very thick scopula on the tarsus and metatarsus of all legs.
Measurements in millimetres.
Long. Broad.
y, dL 2 cee -
Cephalothorax ... 93 | e Iron
INbdomen\ + sesse cs. ele if
Mandibles......... 4i = longer than front patella.
2 5 i
Pat. & Metat.
Coxa. Tr. & fem. tib. & tars.
eos aa 1 4 gs 11 0 35
2 3d 9 10 10 = 33
3 34 9 10 Ss = Be
4 4 92 eS 13 2 38
(4.& 73)
Pallpibeeces. seer 2 43 43 Be gee Tal
590 ON SOUTH AUSTRALIAN SPIDERS. [ Dec. 12,
This species is rather close to L. Koch’s D. mstabilis, from
Mudgee, not very far north of Gilbert River ; but differs in having
scopule on the tarsus and metatarsus of each pair of legs, and
the first pair of legs longer than the second pair, instead of equal
in length. The clypeus, though very wide, is not so wide as the
front row of eyes, thus differing from the condition described by
L. Koch for his species. There is no scolloped pattern on the
back of the abdomen, and no paler coloured spots at the root of
the spines on the legs.
There are two females sent by Mr. A. Molyneux from the
Gilbert River.
Lycosa opscurA L. Koch, 1877.
Die Arachn, Austr. vol. 11. p. 954.
Gilbert River, Riverina, N. 8. Wales (Wolyneux); Kangaroo
Tsland, 8. Austr. (Zepper); Onkaparinga, 8. Austr. (Tepper).
15 males, 22 females.
Previously described from Bowen, Queensland, and Sydney.
Lycosa Lara? L. Koch, 1877.
Op. cit. vol, il. p. 944.
One female. Kangaroo Island (Zepper).
According to L. Koch, Z. deta has the palpal tibia longer than
patella of same; in this specimen the two joints are of equal
length.
Previously described from Rockhampton, Queensland, and Pahn
Creek, Central Australia.
Lycosa ciara? L. Koch, 1877.
Op. cit. vol. 11. p. 912.
Four females. Goolwa (4. Zietz).
In ZL. clara, according to Koch, the cephalothorax is equal to
patella ewm tibia iv., in these specimens it is slightly longer.
Previously described from Bowen, Queensland, and Macedon,
Victoria.
1905. ] ON NEW SPECIES OF PHYTOPHAGOUS COLEOPTERA. 591
The following descriptions of two new species of Coleoptera of
the genus Homopheta were inadvertently omitted from Mr. Martin
Jacoby’s paper supra page 399 :—
HoMOPHETA ARGUS, sp. n. (Plate XIV. fig. 3.)
Flavous, the antenne, knees, tibie, and tarsi black; thorax
with a transverse black band; elytra not perceptibly ee
each elytron with five round pale spots surrounded by a black
ring.
Length 6-7 millim.
Var. Thorax without the black band.
Head impunctate, the middie portion and the clypeus yellowish
white, the vertex and the labrum black; antenne extending
beyond the base of the elytra, black, the joints rather short ane
robust, third and fourth equal. Thorax strongly transverse, the
sides rounded, the anterior angles strongly thickened and produced,
the surface impunctate, with a transverse narrow black band not
extending to either margin. Scutellum black or piceous. Elytra
ilavous, each elytron with five round pale spots, each spot sur-
rounded by a black ring, and as follows—one at the base near the
seutellum, one at the middle near the lateral margin, a third
below the middle near the suture, and the others near the apex
and joined together transversely ; apex of the femora, the tibie
and tarsi black.
Hab. Sao Paolo, Brazil, also Bolivia.
This species must not be confounded with H. annulata Mlig.,
which it resembles somewhat in number and position of the
elytral spots; but these in the present species are of different
shape, round instead of transverse, always margined with black,
and the subapical spots joined at their inner margins. In
Gemminger’s Catalogue the name of Argus Chevr. 1. litt. is given
once as a synonym of H. annularis Nl. and again as Oedionych.
10-guitata Fab., but the species has evidently never been described.
I, 4-notata Illig. is a variety of H. wquinoctialis Fab. None of
these species has a black banded thorax like the present typical
form.
HoMoPH@TA ANGUSTOLINEATA, sp.n. (Plate XIV. fig. 1.)
Below and the legs fulvous, above bright flavous, entirely
impunctate, antenne dark fulvous, seutellum black; elytra with
the extreme margins, a ring-shaped band at the sides and another
transverse band near the apex, violaceous black or eeneous.
Length 63-7 millim.
Head entirely flavous ; antennz robust, entirely dark fulvous.
Thorax transverse, the anterior angles prominent and thickened.
Elytra shining; bright yellow, narrowly margined with purplish
or violaceous, with a narrow transversely rounded similarly
coloured band near the middle, nearly extending to the suture,
Proc. Zoou. Soc.—1905, Vou. Ii. No. XL. 40
592 ON NEW SPECIES OF PHYTOPHAGOUS COLEOPTERA.
nd an equally narrow transverse band below the middle, extending
to either margin.
Hab. Bolivia, Peru.
Closely allied to some of the varieties of the widely distributed
H. equinoctialis Linn., but evidently quite distinct, as I have many
specimens before me which show no variations. The species is
larger and of more elongate shape, the small flavous spot in front
of the humeral callus in H. equinoctialis is absent, the dark
elytral markings are linear and of different shape and entirely
separated, not confluent, and the antenne are more robust and,
like the legs, of a dark fulvous colour.
Ablabes, 517.
hermine, 512, 518,
515.
semtcarinatus, 512,
515.
Ablabophis
rufulus, 255.
Aceros
nepalensis, 180.
Acheeta, 563.
Acomys
cahirinus, 280-288.
dimidiatus, 321.
— minots, 315, 321.
Acontias
lineatus, 254.
Acridium
sp., 562.
Actinia
prehensa, 495.
Adamsia, 507, 509.
palliata, 501, 509.
Aenaria, 146.
/apyceros
melanipus, 187.
Agalychnis
callidryas, 206.
Agama
armata, 253.
atra, 258.
brachyura, 262.
hispida, 252, 253.
micropholis, 253.
microterolepis, 258.
Aipysurus
annulatus, 517.
Allactaga
williamsi, 527.
Alligator
luctus, 467.
Allocotus, 146.
Allolobophora
sp., 490.
Alpheeus, 505.
INDEX,
Alphenor, 146.
Amaurochrous, 147.
Amblyrhynchus, 212.
Amblyscelis, 279.
hemorrhous, 279.
Amblysomus
chrysillus, 58.
corrie, 57.
hottentottus, 57, 58.
arts, D7.
obtusirostris, 58.
Amblystoma, 200, 205.
altamirani, 193, 200,
201, 202, 232.
persimile, 200.
tigrinwm, 193, 200, 201,
202, 232.
Ameiva, 216, 221.
undulata, 195, 216.
Amphisbeena, 470, 480,
481, 482, 484, 485,
486, 488.
brasiliana, 461, 479,
480, 481, 485, 486,
487, 489.
cinerea, 480, 485, 488.
fuliginosa, 488, 489.
Amplorhinus
multimaculatus, 255.
Ancistrodron, 226.
bilineatns, 226.
blomhoffii, 511,
514.
Anelytropsis
papillosus, 195, 219.
Anemonia
suleata, 824.
Anguis, 467.
fragilis, 217, 258, 476.
Aniella
pulchra, 219.
texana, 219.
Anolis, 216, 221.
518,
carolinensis, 212, 216.
Anolis
gadovit, 195, 216, 238,
245, 247.
liogaster, 195, 216, 245,
247.
nebulosus, 195, 216,
231, 233, 246.
sallei, 195.
tropidonotus, 195.
Anomalepis
mexicana, 222.
Anthocomus, 275.
coriaceus, 275.
Anthropopithecus
troglodytes, 57.
Apteryx
mantellt, 295.
Arctictis
binturong, 26, 296.
Arctosa, 570.
Arthroleptis
wahlbergit, 251.
Arvicola
hatanedzumi, 386, 352.
montebelli, 352.
Ascaltis
cerebrum, 17.
contorta, 6, 17.
gegenbauri, 17.
Ascandra
angulata, 20.
contorta, 3, 5,6, 12, 15,
16, 17, 18.
densa, 10.
parus, 10.
Ascetta
spinosa, 3, 5, 12, 15,
14, 16, 17, 18, 19, 20.
Asphera, 398.
emula, 405.
albicincta, 409, 460.
albifrons, 401, 4038.
amabilis, 403.
apicalis, 411, 417.
40*
594
Asphera
basimaculata, 417.
biplagiata, 410.
bisbiplagiata, 409.
brevicollis, 407.
carilloensis, 4038.
chapuist, 406.
curialis, 405.
dejeani, 408.
dimidiaticornis, 408.
discicollis, 400.
discofasciata, 411.
divisa, 418, 460.
elegantula, 412, 460.
episcopalis, 410.
erichsoni, 410.
Stemorata, 400.
INDEX,
Batrachoseps
scutatus, 204.
Bipes
canaliculatus, 219.
Bitis —
arietans, 255.
caudalis, 255.
cornuta, 255.
| Blanus
cinereus, 220.
| Boa
Jerrugineo-vittata, 413. |
funerea, 406.
Fuscofasciata, 418.
glabripennis, 406.
hilaris, 401.
inequalis, 416.
lacerata, 414.
limitata, 405.
maculicollis, 411.
nasalis, 402.
nigrofasciata, 404.
mitidissima, 415, 460.
nobilitata, 411.
oblecta, 408.
ornata, 405.
pallida, 401.
separata, 405.
tarsata, 402, 408, 460.
tessellata, 416, 460.
tibialis, 413.
unicolor, 399.
variegata, 416, 417.
vernalis, 405.
viridicollis, 415.
zonulata, 404, 460,
(Aspicela) albomargi-
nata, 409.
Aspicela, 401.
Aspidelaps
lubricus, 255.
Atractes, 224, 227.
Austrocobitis, 365.
Baleenoptera
borealis, 490.
musculus, 490.
sibbaldii, 490.
Basiliscus, 212.
americanus, 215.
vittatus, 195, 215.
Batrachoseps, 204.
attenuatus, 193, 204,
205, 232.
diviniloqua, 296.
imperator, 195, 222.
mexicana, 222.
Borboroccetes, 207.
mexicanus, 194, 207,
232.
Brachylophus
fasciatus, 212.
Bryodrilus, 564.
| Bubalus
caffer radcliffei, 189.
| Buchholtzia, 563.
' Budorcas
taxicolor tibetana, 329,
300.
Bufo, 205.
angusticeps, 250.
canaliferus, 206.
carens, 250, 251.
coccifer, 206.
compactilis, 206.
compactus, 231.
debilis, 206.
dombensis, 250.
granti, 250.
intermedius, 194, 231,
232.
marinus, 194, 206, 240.
marmoreus, 194, 206.
punctatus, 206.
regularis, 250.
simus, 206, 232, 240.
sternosignatus, 206.
valliceps, 194, 206,
240,
vertebralis, 250.
viridis, 250.
Bungarus
candidus, 516.
Bunodeopsis, 498, 499,
500, 501, 507, 508,
510.
Buphaga, 191.
Caiman
punctulatus, 209.
sclerops, 194.
Calliste
guitata, 490.
Calomyscus, 524, 525.
bailwardi, 519, 524,
525, 527.
Calorhamphus, 42.
Calorhinus
ursinus, 33D.
Calyptomena, 31, 32, 33,
34, 35, 36, 37, 38,
39, 44, 45, 47, 48,
50, 51, 52, 56.
viridis, 56.
Canis
aureus, 522.
hodophylax, 333, 342.
Cantharis
nigrina, 272.
smaragdulus, 271.
viridescens, 271.
Capra
egagrus
323.
Cariama, 167.
Caridophthalmus,
147.
Celestus, 217, 218, 221.
Centrurus
insulanus, 184.
Cephalophus
coronatus, 180.
maxwell, 180.
Cercocebus
aterrimus, 187.
Cercopithecus
talapoin, 296.
wolfi, 295.
Cervicapra
sp., 187.
Cervus
elaphus, 1.
sika, 333, 334, 357.
cretensis,
146,
| Chalcocoris, 147.
Chameleon, 266.
quilensis, 254.
ventralis, 254.
_ Chamesaura
|
|
|
|
anguind, 253.
Charadrius, 162, 163, 164,
165, 166, 167, 168,
169.
plurvialis, 155.
Charina, 222, 223.
Chasmorhynchus, 32, 33,
35, 37, 38, 47, 48.
Chelone
viridis, 194, 210.
Chelydra
rossignont, 209.
serpentina, 209.
Chimarrogale
platycephala, 333, 334,
340.
Ohinchilla, 28.
Chionis, 159, 160, 161,
162, 168, 164, 165,
168.
alba, 155, 156, 161,
166
Chirodrilus, 568.
Chirotes, 220, 241, 243.
biporus, 220.
canaliculatus, 195, 219,
220.
tridactylus, 220.
Chrysemys, 210.
grayt, 194, 210.
ancisa, 210.
mobiliensis, 210.
ornata, 194, 210.
pulcherrima, 210.
wumbra, 210.
Cimex
celebs, 149.
Cinixys
belliana, 252.
Cinosternum, 209, 210.
effeldti, 194, 210.
hirtipes, 209.
integrum, 194, 210.
leucostomum, 194,
210.
pennsylvanicum, 194,
209, 230.
scorptoides, 210.
sonoriense, 210.
Cistudo, 210.
mexicana, 210.
Citellus
concolor, 528.
canthoprymnus, 528.
Clathrina
contorta, 3-20.
coriaced, 15, 16.
lacunosa, 20.
reticulum, 14.
spinosa, 18.
Claviglis
crassicaudatus, 492,
Cliona
celata, 14.
Cnemidophorus, 216,
221, 243.
bocourti, 195.
deppei, 195.
gularis, 195, 216.
guitatus, 195, 216.
mexicanus, 19D.
sealineatus, 216.
striatus, 195.
Cobitis
capensis, 367.
punctifer, 367.
INDEX.
Coccinella
septempunctata, 533.
Coereba
cerulea, 490.
Coleonyx
elegans, 194, 212.
Collops, 278.
Colobus
abyssinicus matschiet,
489.
albocaudatus, 328.
caudatus, 327, 328.
guereza, 187, 326.
palliatus, 326.
— cottoni, 326.
ruwenzorit, 326.
satanas, 325.
sharpet, 326, 327.
vellerosus, 328, 329.
Coluber, 223, 227.
chlorosoma, 233.
elimacophorus,
514,
conspictllatus, 511, 518.
corais, 196, 223.
quadrivirgatus, 511,
514
511,
schmackert, 512, 518,
515. :
triaspis, 239.
Columba
livia, 502.
Commius, 147, 150, 151.
elegans, 153.
minor, 152.
Connochzetes
gnu, 295.
Conolophus, 212.
Conophis, 225.
vittata, 196, 225.
Contia, 223, 227.
nasus, 196, 233.
Corallus, 222.
Coronella, 223, 225, 227,
517.
annulata, 228.
levis, 228. |
micropholis, 196, 223,
231.
regalis, 220. |
Corvus, 32, 34, 39, 39. |
corax, DA.
Frugilequs, 42. |
Corydon, 33, 34, 36, 37, |
38, 39, 44, 45, 46, 48, |
50, 51, 56.
Corythomantis
greeningt, 206.
Corythophanes, 212.
hernandezi, 195, 215.
Cricetodon, 524.
595
Cricetulus
lama, 302, 305.
pheus, 306, 526.
Cricetus, 524, 525.
Crocidura, 315.
cerulea, 334, 340.
dsi-nezumi, 333, 304,
340, 358, 361.
— chisai, 338, 340:
— winbrina, 361.
russula, 340.
umbrina, 334.
Crocodilus, 461.
acutus, 466, 467.
americanus, 194, 209.
moreleti, 209.
Crollius, 147.
Crotalus, 226.
horridus, 226, 230.
miliarius, 231.
salvini, 231.
terrificus, 231, 2383,
241.
triseriatus, 231, 233.
Crotaphytus, 212, 213.
collaris, 213.
wishizent, 213.
Ctenosaura, 212, 213.
acanthura, 195, 214.
quinguecarinata, 195,
215.
Cylidris, 272.
balteatus, 272.
Cymbirhynchus, 34, 36,
37, 38, 39, 44, 45, 46,
48, 56.
Cynictis
levaillanti, 26.
Dactylopsila
palpator, 297.
trivirgata, 297.
Dasypeltis
seabra, 235.
palmarum, 255.
Dendraspis
angusticeps, 259.
Dendrobates, 208.
Dermatemys
mawt, 194, 209.
Dermophis, 200, 203.
mexicanus, 193, 199.
Desmognathus, 202.
Diabrotica, 398.
Diaglena
jordani, 206.
Dicamptodon
ensatus, 200.
Dichoceros
bicornis, 57.
596
Dictyotus, 148, 150.
apicalis, 148.
confinis, 149,
detersus, 149.
discoideus, 149.
favillaceus, 149.
geniculatus, 149.
lineatus, 149.
semimarginatus, 149.
similis, 149.
transversus, 150.
truncatellus, 150.
ventralis, 150.
Dinodon
Japonieus, 511, 513,
514.
rufozonatus, 512, 518,
515.
semicarinatus, 512, 515.
Diplodocus, 289-294.
carnegu, 294.
Diploglossus, 217, 231.
steindachneri, 217, 238.
Dirosema, 224, 227.
Dispholidus
typus, 255.
Distira
ornata, 517.
Dolomedes
habilis, 588.
instabilis, 590.
Dorcatherium
aquaticum, 489.
Dozocolletus, 274.
brunneus, 274.
sordidus, 274.
Dromia, 509.
Dromicus, 224, 227.
laureatus, 233.
Drymobius, 224, 227,
231.
beddaerti, 196, 224.
margaritiferus, 196,
224, 233.
Dryomys, subg. n., 348.
Dryophis
acuninatus, 196.
Dryotriorchis
spectabilis, 296.
Dymecodon
pilirostris, 836, 342.
Elaps, 225, 227.
elegans, 225.
euryxanthus, 225.
Sulvius, 196, 225, 231.
Hliomys, 491, 493.
dryas, 348.
(Dryomys) xitidulus,
348.
EINDEX.
Elius, 348.
Hllobius
Fuscocapilius, 526, 527.
lutescens, 526, 527.
talpinus, 526, 52/7.
woosnamt, 526.
Enchytrzeus, 563.
minimus, 564.
parvulus, 564.
turicensis, O64.
Hngystoma, 208.
ustum, 194, 208, 240.
Wngystomops, 205.
pustulosus, 205.
Hpicrates, 222.
Kremaeus
novus, d67.
Krinaceus
europeus, 522.
— concolor, 522.
— ttalicus, 316, 317.
— nesiotes, 316.
— roumanicus, 317.
Hrythrolamprus, 225.
jissidens, 225.
Hryx, 464.
Hsox
alepidotus, 375.
Eublepharis
fasciatus, 211.
variegatus, 211.
Euchirotes
biporus, 219, 220.
Bucymatodera, 272.
cingulata, 272.
hottentota, 272.
Eumeces, 218, 257,
261, 265.
algeriensis, 61, 62,
260.
brevirostris, 238.
Fuscirostris, 195, 218.
lynxe, 195, 218, 235.
Hupemphix
gadovit, 194.
Hurylemus, 34, 36, 39,
42, 56.
ochromelas, 40, 41, 42,
52, 54.
258
?
Eurynannus, gen. nov.,
lippus, 154.
Eurypyga, 167, 168.
Hurystomus, 35, 36, 37,
Eyotomys
andersont, 354.
bedfordia, 383, 358,
304, 355.
glarcolus, 352, 353.
mikado, 338, 352.
260, |
Eyotomys
rufocanus,
355.
(Craseomys) anderson,
300, 304.
(—) bedfordie, 353,
304,
(— ) lataste?, 354.
(—) rufocanus, 358,
B04.
(Phaulomys) smithiz,
333, 234, 336, 355.
Hysarcoris
truncatellus, 150.
308, 304,
Felis
catus, 318.
Jaguarondi, 296.
manul, 302.
ocreata, 317.
— agrius, 317, 318.
— sarda, 318.
pardus, 295.
Ficimia, 223, 227.
Fridericia, 564.
Galaxias
affinis, 366, 380, 385.
alepidotus, 366, 375.
alpinus, 365, 368, 370,
371, 372.
atkinsonit, 377. ;
attenuatus, 364, 365,
366, 368, 369, 3870,
373, 384.
auratus, 366, 379.
bollanst, 364, 374.
bong-bong, 382.
brevipinnis, 364, 365,
366, 374.
brocchus, 379.
campbelli, 368.
capensis, 367.
coppingert, 370, o71.
corti, 366, 380.
cylindricus, 368.
delfini, 372.
delicatulus, 368.
dissimilis, 366, 383.
fasciatus, 365, 366, :
374.
findlayi, 365, 366, 382,
384.
forsteri, 375.
gracillimus, 364, 369,
370.
grandis, 372, 374.
huttoni, 366, 378, 3838.
kayi, 364, 381, 382,
384.
Galaxias
kokopu, 376.
kreffizi, 368, 369, 384.
lynx, 364, 366, 378,
383.
maculatus, 364, 365,
368, 370.
minutus, 368.
nebulosa, 368.
nigothoruk, 364, 380.
occidentalis, 364, 366,
376, 378, 384.
ocellatus, 378.
olidus, 364, 365, 366,
378, 381, 382, 384.
ornatus, 365, 366,
381.
planiceps, 382.
plate, 365, 372.
postvectis, 379.
punctatus, 368. 369.
punetifer, 365, 867,
383.
punctulatus, 370.
reticulatus, 375.
robinsoni, 374.
rostratus, 366, 378.
schomburgkii, 366,
382.
seriba, 365, 368, 369.
smithit, 365, 372.
truttaceus, 366, 368,
378, 379, 384.
versicolor, 369.
waitit, 366, 376, 378,
384.
waterhouse?, 364, 368,
369.
wecdoni, 366, 377,
384.
zebratus, 365, 367.
Galictis, 24, 25, 29.
barbara, 26, 27.
Gallinago, 162, 163, 164,
165, 166, 168, 169.
celestis, 155.
Geagras
redimitus, 196, 224.
Geophis, 224, 227.
chalybea, 231.
mesta, 233.
omiltemana, 2338.
semidoliatus, 196.
Gerrhonotus, 217, 218,
241.
antauges,
ceruleus, 217, 230.
deppei, 195, 233.
gramineus, 195, 217,
233
ol
195, 217,
INDEX.
’ Gerrhonotus
imbricatus, 195, 217,
239.
liocephalus, 195, 233.
Gerrhosaurus, 61, 462.
flavigularis, 62, 256-
267.
madagascariensis, 260.
Gilippus, 146.
Giraffa
camelopardalis peralta,
57
Giada, 169, 168, 16 |
165, 166, 168, 169.
pratincola, 155.
Glauconia, 222, 226.
albifrons, 195, 222.
dulcis, 195, 222.
humilis, 222.
Glirulus, gen. noy., 347.
Japonicus, 334, 335,
347.
Glis, 348.
Gonioctena, 529, 582,
Daas
variabilis, 528.
Graphiurus, 492, 493,
494.
Graptoclerus, 273.
quadripunctatus, 273.
Gustavia
sol, 566.
Gymnodactylus
sumichrasti, 211.
Gyponyx, 272.
algoensis, 272.
brawnsi, 273.
chinensis, 272.
marmoratus, 272.
retrocinetus, 272.
Haliaétus
albicilla, 189, 296.
Halteridium
crumenium, 297.
danilewskyt, 297.
Hapale ;
chrysoleucos, 296.
Haplocanthosaurus, 294.
Hatteria, 69, 256, 257,
461, 462, 463, 464,
465, 466, 470, 474,
484, 485.
Hedonistes, gen.
278.
letus, 279.
Hedybius, 271, 275.
amenus, 276, 277.
anceps, 276.
quadricornis, 276.
sculpticeps, 275.
noy.,
|
|
|
{
|
|
|
|
|
| Heloderma,
597
FHedybius
superciliosus, 277.
varticornis, 277.
Helictis
personata, 21-29.
subaurantiaca, 21, 24,
Dike
Heliornis, 163, 167.
221, 241,
242, 245.
horridum, 217.
suspectum, 217.
Hemibungarus
japonicus, 512, 51d.
| Hemichirotes
tridactylus, 219, 220.
| Henlea
dicksoni, 564.
lefroyt, 562.
nasuta, 563.
| Hermannia
bistriata, 568.
| Herpestes
albicauda, 489.
galera robustus, 188.
Himantodes, 224.
cenchoa, 196, 224.
gemmistriata, 224.
tenurssima, 224.
Himantopus, 157, 162,
163, 164, 165, 166,
167, 168, 169.
nigricollis, 155.
Hipposiderus
bicolor, 130.
Holbrookia, 212, 213.
maculata, 213.
propingua, 213.
texana, 194, 218.
Homalocranium, 225.
atrocinctum, 239.
bocourti, 231.
miniatum, 196.
Homo
sylvestris, 73.
Homopheeta, 393.
equinoctialis, 591.
angustolineata, 460,
HS.
annulata, 591.
argus, 460, 591.
boliviana, 399.
clavareaut, 398.
10-guttata, 591.
peruviana, 399, 460.
4-notata, 591.
Homopus
signatus, 252.
Hydrenchytreeus, 564.
Hydrocherus
capybara, 490.
598
Hydrophasianus, 157,
158, 159, 160, 163,
164, 165, 166, 167,
168.
chirurgus, 155, 158.
Hydrophis
melanocephalus, 516.
Hydrus
platurus, 516.
Hyla, 206.
baudini, 194, 207.
boucourti, 207.
cerulea, 206.
copei, 194, 207.
eximia, 194, 207, 251,
282. |
miotympanum, 207,
231, 240. |
stauffert, 194, 207.
venwlosa, 207. |
Hylella, 206. |
Hylobates |
agilis, 174, 175.
concolor, 171, 174.
hainanus, 169, 174, |
175, 176, 180.
harlant, \74.
hoolock, 175.
lar, V7, 175.
leuciscus, 173, 175.
nasutws, 171, 175.
niger, 174.
pileatus, 172, 175.
syndactylus, 174.
(Symphalangus) syz-
dactylus, 174.
Hylocherus
meinertzhagent, 182, |
310.
Hylodes, 207.
beate, 194.
calcitrans, 207.
meianostictus, 207.
palmatus, 207, 231,
232.
rhodopis, 194, 207, 231,
232, 240.
Hymenochirus, 250.
Hypocthonius
tectorum, 568.
Hypsiglena
torquata, 224, 240.
Ichnotropis
capensis, 254.
Iguana, 59, 60, 61, 212,
257, 268, 269, 270,
462, 467, 477.
rhinolophus, 195.
tuberculata, 60, 256,
270.
INDEX.
Tnuus
speciosus, dd4, 336.
Irrisor, 52.
Tschnognathus, 225, 227.
cope, 253.
Kobus
defassa, 186.
ellipsiprymnus,
296, 297.
187,
Lacerta, 257,
464.
agilis, 261.
muralis, 324.
ocellata, 258, 261, 262.
viridis, 485.
~-- major, 320.
Tachesis, 226.
atrox, 196.
Havoviridis, 612, 516.
lanceolatus, 196, 226,
243.
lansbergi, 226.
mucrosguamatus, O12,
515, 516.
okinavensis, 511, 512,
513, 516.
undulatus, 233.
Lamanctus, 212.
longipes, 216.
serratus, 216.
Lagomys
curzonieé, 308.
Laius, 278.
Lama
huanacos, 57.
Lankesterella
ranorum, 8.
tritonts, 58.
Lanthanotus, 217.
Larus, 162.
Leopardus
Japontcus, 339.
Lepidophyma
flavomaculatum, 219. |
Leptodactylus, 207, 208.
albilabris, 194, 208.
caliginosus, 194, 208.
microtis, 208.
Leptodira, 224.
albofusca, 196, 224,
231, 233.
guilleni, 196, 247.
nigrofasciata, 247.
personata, 196, 247.
septentrionalis, 224.
Leptognathus
elegans, 225.
261, 462,
| Leptophis, 224, 227, 231.
bilineatus, 233.
diplotropis, 196, 231,
UISs3),
Mexicand,
238.
prestans, 238.
Leptoptilus
crumentferus, 297.
Lepus
brachyurus, 333, 304,
301, 857, 359, 360.
— okiensis, 359.
craspedotis, 527.
curopeus creticus, 322.
otostolus, 308.
tibetanus, 527.
timidus, 322, 351.
GNU, 380,
306.
variabilis, 336.
Leucosolenia
botryoides, 4.
cerebrum, 6.
complicata, 4, 5, 8, 10,
15, 16, 18.
contorta, 3, 4, 5, 6, 8,
10; 11, 12; 13; 14, 15;
16, 17, 18, 19.
coriacea, 4, 5, 6.
reticulum, 6.
spinosa, 18.
variabilis, 5, 15, 16.
(Leuciria) eontorta, 17.
(Nardoa) contorta, 17.
Leyenna, gen. nov., 151.
salax, 152.
Liacarus
bicornis, 566, 569.
Lichanura, 222.
Limnotragus
gratus, 256.
speket, 187.
Lipaugus
‘cineraceus, 58.
Lobepomis, 147.
Lohmannia
insignis, S64.
Loxocemus
bicolor, 222
196, 2351,
29
306,
eds
Lumbricillus, 563.
Lutra
lutra, 295.
Lutronectes
whiteleyi, 339.
Lycoperdina
sericea, 28().
Lycosa
arenaris, 670.
bicolor, 571, 580, 581.
castanea, 571, 577.
Lycosa
clara, 571, 590.
cowle?, 570.
erispipes, 588.
errans, 571, 578, 579.
gulberta, 571, 582.
godeffroyi, 569.
hasseltti, 569.
hispanica, 8.
leta, 571, 590.
leuckartii, 576.
molyneuxt, S70, 579.
obscura, 569, 571, 590.
phyllis, 571, 573, 574.
stirlinge, 570, 584,
585.
farentula, 569.
tasmanica, 570,
572.
Lygodactylus
capensis, 252.
Lygosoma, 218.
laterale, 195, 218.
Lyriocephalus
seutatus, 290.
Diible
Mabuia, 218.
agilis, 195, 218.
striata, 254.
sulceata, 254.
trivittata, 254.
varia, 254.
Macacus
fuscatus, 333, 334, 361.
Macroscincus, 260, 261,
262.
coctequt, 257, 258, 259,
260.
Manolepis
putnaint,
233,
Marionina, 563.
glandulosa, 564.
Martes
Japonica, 335.
Mecidea, 146, 147.
Megadeuterus, 279.
Megaptera
longimana, 490.
Meles
anakuma, 9333, 334,
336, 344.
meles mediterrancus,
318.
196,
225,
Melia, 496, 497, 498, 499,
500, 501, 504, 505,
506, 507, 508, 509,
510.
tessellata, 494, 495, 496,
498, 500, 502, 510.
INDEX.
Mellivora
indica, 523.
Menura, 32, 34, 35.
Meriones
erythrurus, 628.
meridianus, 528.
persicus, 525.
Mesenchytraeus, 563.
Mesites, 365.
alpinus, 371.
attenuatus, 368.
gracillimus, 370.
maculatus, 370.
Michaelsena, 563.
macrochetu, 563.
Micromys
agilis, 394.
agrarius manchuricns,
385, 396, 397.
— ningpoensis, 385,
397.
— typicus, 397.
chevriert, 39D.
geisha, 333, 334, 2
390, 351, 359,
303.
— celatus, 359.
— hokkaida, 3338, 350.
— yakui, 362.
intermedius, 395.
minutus, 3d1.
— japonicus, 333, 334,
dol.
— pygmeus, 385, 396.
mystacinus, O24.
pygmeus, 301.
Speciosus, 333, 334, 348,
349, 350, 351, 358,
362.
— ainu, 333, 349.
— navigator, 358.
sylvaticus, 320, 395.
— arianus, 524.
— chevriert, 335, 395.
— draco, 385, 395.
— hay, 315, 320.
— witherby?, 524,
ussuricus, 301.
yakur, 363.
Microtus
spp., 526.
agrestis, 324.
montebelli, 333, 334,
335, 336, 352.
nivalis, 526.
(Phaiomys) wadtoni,
302, 306, 307.
Miniopterus
fuscus, 338.
schreibersi, 316.
-— japonie, 334, 338.
| Mus
599
Mocoa, 218.
| Mogera
hobee, 336, 361.
wogura, 333, 336, 341,
361.
— kana, 361.
— kobee, 333, 341,
358.
cristata, 58.
| Morenoa, gen. nov., 517,
518
orizabensis, 517, 518.
Mormidea
delersa, 148, 149.
ventralis, 150.
Murina
hilgendorfi, 334, 335.
agrarius manchuricus,
394, 396, 397.
— ningpoensis, 394.
— typicus, 396.
alexandrinus, 389.
argenteus, 334, 349.
badius, 395.
bowersi, 389.
canna, 389.
chevrieri, 395.
confucianus, 384, A86,
387, 388, 389, 394.
coninga, 386.
coxingt, 384, 386, 394.
cremoriventer, 388.
decumanus, 287, 392.
edwardsi, 384, 385,
394,
erythronotus, 334.
flavipectus, 384, 389,
390, 391, 3892, 394.
germaint, 330.
griseipectus, 385, 390,
391, 392, 393, 394.
hartt, 397.
huang, 384, 387, 388,
394
humiliatus, 385, 3592,
393, 394,
indicus, 392.
intermedius, 395.
jerdont, 385, 386, 387,
388.
latouchei,
394.
ling, 384, 388, 394.
losea, 348, 3885, 391,
392, 394.
minutus pygmeus, 394,
396
384, 389,
molossinus, 380, 334,
348, 361.
600
Mus |
musculus, 287, 321, |
385, 394, 523, 524, |
525. |
ningpoensis, 397.
niveiventer, 387.
norvegicus, 333, 348, |
389, 392, 393, 594.
ouangthome, 389, 391.
plumbeus, 890, 391.
pygmaeus, 396.
rapit, 388.
rattus, 320, 390, 393.
— flavipectus, 390.
rufescens, 390, 391,
392.
spectosus, 3d4.
spicilegus, 348.
sylvaticus, 821, 395.
— chevrieri, 394, 395.
— draco, 394, 395.
tanezumi, 338, 304,
348.
Mustela
alpina, 305.
brachyura, 304.
calotus, 346.
foina, 318.
— bunites, 318, 319.
— leucolachnea, 318.
— mediterraneus, 319.
melampus, 182, 185,
334, 335, 343.
— bedfordi, 183, 382, |
333, 336, 343, 563.
— tsuensis, 183.
Myotis
blythi, 522.
capaccinii, 337.
daubentoni, 337.
macrodactylus,
307.
myotis, 316, 521, 522.
— omari, 521.
natterert, 831, doe.
— bombinus, 384, 337.
thysanodes, 338.
Myoxus
elegans, 335, 347.
Javanicus, 347.
lineatus, 334.
Mystromys, 524, 525.
334,
Naia
melanoleuca, 296.
Nardoa
spongiosa, 17.
Nemorhdus
argyrochetes, 329, 331.
bubalinus, 331.
crispus, 338, 334, 357.
INDEX.
Neochanna, 365, 383.
apoda, 364, 383.
Neomys
fodiens, 522.
Neurotrichus, 335, 342.
Niarius, 146, 148, 130.
wluminatus, 150.
iryont, 150.
| Nicoria
rubida, 194.
rutila, 210.
Niphe, 146.
_ Notaspis
hipilis, 567.
maculosa, 567, 569.
seulptilis, 567, 569.
splendens, 567.
Nothrus
anauniensis, 569.
erassus, 568, 569.
crinitus, 567, 569.
glaber, 568.
monodactylus, 568.
sylvestris, 569.
tardus, 568.
targiontt, SG8.
tectorum, 568, 569.
Notostenus, 275.
viridis, 275.
Nototrema
oviferum, 206.
Nuecras
delalandii, 254.
tessellata, 254.
Numenius, 157.
Nyctereutes
albus, 336.
VIVETLINUS,
949
3543.
338, 334,
Ochotona
curzome, 308.
Gidiarthrus, 280.
angolensis, 28\).
natalensis, 280.
(idicnemus, 159, 160,
162, 168, 164, 165,
166, 168, 169.
scolopax, 155, 159.
Oedionychis, 398,
415, 419.
adjuncta, 449, 460.
ened, 443, 447.
alacris, 445.
albipennis, 419, 426.
apicicornis, 422.
arcuata, 439.
arcuatofasciata,
460.
argentinensis, 456.
414,
43],
Oedionychis
atroguttata, 455.
atropunctata, 456, 457.
balyt, 425.
basinotata, 453, 460.
bicolorata, 459.
bifasciata, 442.
bipartita, 439, 447.
bipunctata, 445.
bipunctulata, 452.
bishinotata, 428, 460.
bistrifasciata, 437.
biteniata, 440.
bolivianus, 459.
cardinalis, 489, 447.
catharine, 434.
centromaculata,
460.
cinctipennis, 450.
colombiana, 427, 445,
446.
conplanata, 452.
consimilis, 425,
cubana, 451.
decora, 458.
difficilis, 444.
dipus, 419.
dissepta, 441.
distincta, 421.
diversa, 428.
donckieri, 449,
duodecimnotata,
460.
ecuadoriensis, 423.
exclamationis, 436,
460.
JSenestrata, 454.
Jigurata, 437.
Hlavomarginata, 451,
431,
454,
Sulvotibialis, 448.
grayi, 48.
haagi, 449.
herbacea, 424.
humboldti, 435.
humeralis, 427, 458.
iligert, 441.
illustris, 440, 460.
inuperialis, 442.
inconspicua, 424.
indigosoma, 432.
informis, 438.
ingrata, 429,
insularis, 445,
interrupto-vittata, 436,
460.
intersignata, 433.
Jjaculus, 444.
labiata, 439.
maculatissima, 458.
millepora, 421.
Oedionychis
motschulsky?, 452.
nagrimand, 426.
nigrobasalis, 459.
migromaculata, 455.
nigropunctata, 457.
nigrosuturalis, 420.
nigrotibialis, 425.
nivicularis, 423.
obscuripennis, 421, 426.
occipitatlis, 442,
ocellata, 434, 460.
paltlescens, 422, 424.
pallidicincta, 450.
paraguayensis, 419.
parallina, 427.
puupera, 422.
persimilts, 450.
picifrons, 420.
plebeja, 426.
porosa, 451.
pretiosa, 451.
prominula, 460.
promta, 445.
pustulata, 434.
4-punctata, 458.
4-pustulata, 434.
5-maculata, 441.
regina, 444, 460.
rhodina, 423.
rotundicollis, 419.
rustica, 433.
sagulata, 450.
selecta, 446.
semifoveolata, 451, 460.
signifera, 441,
serdida, 422.
steinheili, 442, 448.
subcostata, 452.
subdilatata, 455.
succincta, 445.
tentolata, +49.
tenwicincta, 428.
torquata, 458.
13-maculata, 431.
triloba, 482.
turpis, 426.
variata, 429.
variolosa, 451.
venezuelensis, 430,
vittatipennis, 448.
waterhouset, 435.
weiset, 446.
Okapia, 410.
Oneocoris, 146, 147, 148.
apicalis, 148.
celebs, 149.
confinis, 149.
detersus, 149.
| Ophisaurus,
dimidiatus, 149.
discoideus, 149,
INDEX.
Oncocoris
Javillaceus, 149.
geniculatus, 149. |
insulanus, 149.
lethierryt, 149.
modestus, 149.
ovalis, 149, 153. |
punctatus, 146, 149. |
semimarginatus, 149, |
similis, 149.
subsimilis, 150.
transversus, 150.
truncatellus, 150.
ventralis, 150.
Ophiophagus, 488.
217, 461,
468, 469, 470, 471,
478, 474, 475, 476,
477, 488.
apus, 468.
ventralis, 217. |
Oribata
Surcata, 565, 569.
fusigera, 565.
lapidaria, 565.
omissa, 565, 569.
parmellie, 565,
rubens, 565,
Oryctolagus
cumiculus cnossius, 322.
Oryx
leucoryx, 296.
Otaria
gulespii, 295.
Otis, 165, 167, 168,
Ourebia
montana, 187.
Oxybelis, 225.
acuminatus, 225.
Oxyrhopus, 224, 226.
cloelia, 224.
petiolarius, 224.
plumbeus, 224.
Pachydactylus
bibronit, 252. |
mariquensis, 252.
Pagurus, 501, 509.
Palemon |
altifrons, 550.
lar, 544, 545, 547, 548,
550.
— spectabilis, 549.
reuniannensis, 549,
(Eupalemon) dar, 544,
550.
Paludicola, 207.
mexicana, 194,
Paradisea, 54.
Pardosa, 570.
| Pheilia,
601
Pentalagus
Surnesst, 357.
Pentatoma
semimarginata, 149.
truncatula, 149.
Peromyscus, 519, 9524,
526.
Petalognathus
nebulatus, 196, 225.
Petasophora
iolota, 324, 490.
Petaurista
leucogenys, 333, 334,
306, 344.
— tose, 344.
nikkonis, 336.
oreas, 336.
tosé, 330.
Pezoporus, 274.
Phacoecherus
ethiopicus, 188.
Phaiomys
blythi, 306, 307.
506, 507, 508,
510.
Philhedonus, 277.
coronatus, 277.
regulosus, 278.
sericeus, 277.
| Phrynobatrachus
natalensis, 251.
Phrynosoma, 212, 213.
asio, 194, 218.
cornutum, 213.
douglasi, 213.
modestwin, 194, 213.
orbiculare, 213, 231.
taurus, 233.
Phyllodactylus
tuberculosus, 194, 211,
240.
Phyllomedusa, 206.
dacnicolor, 194, 206.
Physignathus, 257.
| Pipa, 250.
| Pipistrellus
abramus, 388,
337.
akakomult, 334.
aladdin, 521.
kuhli, 520, 521.
mimus, 02).
nanus, O21.
334,
| Pirata, 570.
Piroplasma
bigeminum, 491.
canis, 491.
donovani, 491.
equi, 491.
hominis, 491.
ovis, 491.
602
Pithecus, 72.
troglodites, 302.
Pituophis, 223, 227.
Platurus
laticaudatus, 517.
schistorhynchus, 517.
Platycoris, 146, 147, 148,
150.
Plethodon, 205.
Plotus
sp., 189.
Podargus, 35, 36.
Podoecnemis, 244.
Peecilogale
doggetti, 188.
Polydectus, 498,
507, 509.
cupilifera, 506, 510.
Pongo, 70, 71.
Pontodrilus, 558.
erosslandi, 560, 561.
insularis, 559.
laccadivensis, 559, 560,
561,
littoralis, 561.
matsushimensis, 59.
— chathamiana, 561.
Potamia, 570.
Potamocherus
porcus, 310.
Procavia
bettont, 188.
Proenias, 31.
Proczelicus, 147.
Psammophis
sibilans, 255.
Pseudaspis
cana, 250.
Pseudocordylus
microlepidotus, 253.
Pseudopus, 217.
pallast, 468.
Pternobyla
JSodiens, 206.
Pteromys
leucogenys, 334.
momonga, 344, 340.
Pteropus
dasymallus, 334.
Pterygistes
molossus, 334.
Ptychognathus
affinis, 542, 544.
andamanicus, 542, 543,
544,
barbatus, 588, 589,
540, 541, 548, 544,
550.
dentatus, 542, 648,
544.
glaber, 041, 542, 548,
506, |
INDEX.
Ptychognathus
intermedius, 537, 542,
545.
onyx, 542, d44.
puipes, 587, 539, 541, |
542, 548.
pollent, 588, 542, 543.
pusillus, 537, 540, 541,
542, 548, 544, 550.
reidelti, 541, 542, 545,
544.
— pilosa, 541, 542,
544,
spinicarpus, 542, 543.
Putorius
alpinus, 300.
ermineus, 343.
itatsi, 333, 334, 348.
nivalis, 319, 622.
— atlas, 819, 320.
— galinthias, 319,
320.
— sicule, 320.
Pygopus, 266.
lepidopus, 464.
Python, 59, 65, 67.
molurus, 64, 6d.
sebe, 255.
Rana, 208.
angolensis, 251.
delalandti, 251.
Jasciata, 251.
Jorrert, 208.
Fuscigula, 251.
grayt, 251.
halecina, 194, 208, 230,
252.
mascarentensis, 251.
montezume, 194, 208,
230.
omiliemana, 208, 232.
palmipes, 194, 208.
pustulosa, 208.
Regenia
ocellata, 269.
Rhadinea, 224, 227.
clavata, 196.
decorata, 196.
vittata, 196, 231, 233.
Rbamphastos
carinatus, 180.
erythrorhynchus, 490.
Rhea, 293.
| Rhineura, 220.
Rhinoceros
bicornis, 297.
BRhinochetus, 168.
Rhinolophus
acrotis,7&, 94, 106, 112,
118, 120.
Rhinolophus
acuminatus, 96, 97, 98,
121, 182, 153, 134,
155, 136, 138.
— audax, 133, 134,
145.
— typicus, 133, 134.
ethiops, 137.
affinis, 76, 86, 87, 90,
93, 94, 95, 97, 98,
101, 102, 108, 104,
105, 106, 107, 108,
169, 112, 117, 118,
120, 121, 180, 134.
— himalayanus, 90,
102, 103, 104, 105,
106, 107, 108, 144,
145.
— macrurus, 103, 105,
144
— nesites, 104, 105, 144.
— princeps, 102, 105,
106, 144, 145.
— roux, 87, 100.
— superans, 104, 105,
144,
— tener, 103, 104, 105,
144, 145.
— typicus, 104, 105,
106.
andamanensis, 106.
audax, 96.
augur, 106, 110, 118,
119, 120.
bi-hastatus, 141.
— hisnyiresiensis, 142.
blasti, 121, 130, 1386,
137, 139, 144.
borneensis, 76, 78,. 79,
81, 82, 83, 84, 88,
86, 87, 88, 89, 90,
91, 92, 98, 94, 95,
99, 100, 101, 102,
107, 116, 117, 119,
120, 121, 122, 145.
— spadix, 81, 87, 88,
94
= typicus, 87, 88, 121,
145
brevitarsus, 126.
calypso, 96, 182, 133,
134, 186, 145.
capensis, 76, 117, 120,
121.
celebensis, 76, 81, 82,
83, 84, 85, 107, 116,
120, 122, 144, 145.
cinerascens, 98, 99.
clivosus, ‘76, 106, 117,
118, 120.
conchifer, 113.
Rhinolophus
cornutus, 128, 126, 127,
128, 135, 186, 145,
dod.
— pumilus, 121, 128,
127, 128, 129, 145.
-— typicus, 128.
darling. 106, 107, 118,
120:
deckeni, 106, 110, 118,
119, 120.
denti, 117, 120.
dobsont, 137.
empusa, 121, 130, 156,
137, 1388; 139:
euryale, 121, 137, 138,
142, 144.
— helvetica, 142.
— judaicus, 137.
ferruin-equinwin, 76,99,
94, 101, 106, 107,
LOSS OSM ao Sale
UND ey TUE Tas,
116, 117, 118, 119,
120, 121, 132, 142,
144, 315, 316.
— germanicus, 113.
—- ttalicus, 115.
— mippon, \10, 115,
145, 334, 337.
— obscurus, 114, 115,
116, 119.
— proximus, 112, 115,
145.
— reguius, 112, 115,
118, 145.
— tragatus, 111, 115,
145.
—— typicus, 118, 115.
fumigatus, 157.
garoénsis, 129,
131, 145.
gracilis, 129, 1380, 182,
186, 157, 139, 145.
hildebrandti, 137.
himalayanus, 104, 106.
hipposiderus, 86, 126,
130)
INDEX.
| Rhinolophus
127, 129, 1132, 139;
140, 141, 142, 143,
144, 145, 315, 316.
— alpinus, 142.
— ninimus, 139, 140,
143, 145.
—- minutus, 114, 142, |
148, 144, 145.
— pallidus, 142.
— troglophilus, 142.
— typicus, 141,143,144.
— typus, 142.
keyensis, 19.
landeri, 157, 188.
lepidus, 97, 120, 121,
122; 123, 124, 125
1265 27) 1285 129)
130, 181, 182, 138,
135, 136, 157, 138,
139, 144, 145,
libanoticus, 1138.
lobatus, 187.
maclaudi, 138.
macrotis, 137.
macrurus, 104.
malayanus, 76,77, 89,
SOMO 00S Oe
107, 120, 145.
megaphyllus, 76, 7
Te, 79, XO, Sil,
SS, $3, Oy, Ui
Ig, WeA0),
— monachus, 80, 81,
87, 144.
— typicus, 79, 145.
midas, 129, 1388, 139,
140, 143, 144, 145.
minis, 140.
minor, 83, 86, 87, 89,
WH, Ga, Wil 122,
WB BL I.
128, 129, 130, 131,
sm, Meio, Wei74" iste
139, 140, 148, 144.
minutus, 123, 129, 135.
monoceros, 121, 123,
GL, WBe, WG, Wels.
monticola, 97, 98, 122,
123, 124, 125, 130,
135, 145.
nanus, 76, 77, 81, 82,
85. 84, 87, 107, 116,
117, 120, 144, 145.
nereis, 90, 91, 92, 93,
HOW, WOR, Thay, 1240,
144, 145.
nesites, 104, 106.
nippon, 107, 108, 110,
Mis WN, Wales iG,
120, 334.
obscurus, 108, 119, 118,
114.
pearsoni, 97.
peterst, 86, 95, 96, 97,
98, 124, 130, 133, 145.
phasma, 141.
philippinensis, 78, 138.
princeps, 104, 106.
proximus, 107, 108,
WN, MI, WN
pusillus, 86, 126, 127.
rammanika, 98,99.
refulgens, 122,124,125,
133, 135, 1386, 145.
603
Rhinolophus
regulus, 107, 108, 110,
TN, 12; 214, 120:
roux, 79, 85, 86, 90,
92, 93, 94, 95, 96;
97, 98, 99, 100, 101,
MOP, MO, ily, Wil).
120; 121, 1245 33}
145,
— rubidus, 99.
— sinicus, 98, 99, 144.
— typicus, 98, 99, 145.
rubidus, 98, 99.
rufescens, 113.
simplex, 76, 77, 78, 79,
80, 81, 82, 83, 86,
89, 93, 94, 115, 117,
120, 121, 122, 135,
137, 138, 144, 145.
simulator, 117, 120.
spadiz, 87.
stheno, 77, 90, 91, 92,
935 LOM 02 LOT
117, 120, 121, 144,
145.
subbadius, 121, 122,
125, 124, 129, 130,
ISI, S22, Use, isi,
138.
sumatranus, 97, 98,
13%, 85) WS lees.
136, 145.
superans, 104, 106.
tener, 104.
thomasi, 90, 93, 94,
100, 101, 102, 107,
120, 144, 145.
trayatus, 107, 108, 110,
Td, 12, 114, 120!
truncatus, 76, 77, 80,
81, 82, 83, 84, 87,
WO, IMG, TN, 130),
145.
typicus, 108.
uni-hastatus, 113.
virge, 88, 107, 120,
144.
Rhinophryne
dorsalis, 193, 205.
Rhinopithecus
rocellane, 380.
Rhynchea, 161, 162, 165,
164, 165, 166, 168.
capensis, 155, 157.
Rupicola, 52, 55.
| Ruppia, 507.
Sagartia, 499, 500, 507,
508, 509, 510.
palliata, 507.
parasitica, 501, 509,
604
Satyrus, 70, 72.
indicus, 298, 299,
302.
Scaphiopus, 205, 208.
dugest, 193, 230.
hammondi, 205.
multiplicatus, 231.
Scaptira
ctenodactyla, 254.
knoxti, 254.
Sceloporus, 212,
231.
acunthinus, 194, 214,
23), 232.
e@neus, 194, 214, 232.
asper, 282.
bulleri, 232.
Jormosus, 194,
23), 232.
gadovie, 195, 246,
7.
218,
214,
heterolepis, 232.
melanorhinus, 195.
mucrolepidotus, 195,
214, 230, 232.
pyrrhocephalus, 194,
247.
scalaris, 195, 214, 230,
232, 240.
siniferus, 195, 232.
spinosus, 194, 214,
23).
torquatus, 194, 214,
216, 232.
variabilis,
231, 232.
yarrowt, 232.
Scelotes
bipes, 254.
Scincus
officinalis, 482.
Sciuropterus
momonga, 334.
— amygdali,
344.
Sciurus
lis, 333, 384, 347.
varius, 346.
vulgaris, 346, 351.
— calotus, 346.
— orientis, 383, 345.
Scolecophis
emule, 225.
atrocinctus, 225,
michouacensis, 225.
Seolopax, 157, 159, 162,
163, 164, 165, 166,
168, 169.
rusticola, 155.
Scotopelia
bouvieri, 296.
195, 214,
333,
INDEX.
Seyllium
canicula, 490.
Selenidera
maculirostris, 296.
Serrarius
microcephalus, 566, 567,
569.
Sinia, 70.
koolookamba, 70.
nkulunkamba, 70.
satyrus, 295, 296, 299,
300.
Sistrurus, 226.
ravus, 226.
Solenodon, 244.
Sorex
hawkeri, 333, 339.
macropygmeus, 338.
minutus, 339.
shinto, 333, 338.
wmbrinus, 340, 361.
Spelerpes, 202, 203, 205,
244
belli, 193, 208, 204,
232.
cephalicus, 203.
chiropterus, 198, 208,
232.
JSuscus, 202, 203.
gibbicaudus, 203.
infuscatus, 203.
leprosus, 193,
232.
lineolus, 203.
morto, 203, 231.
multiplicatus, 208.
orizabensis, 193, 203,
204, 232.
rufescens, 203.
uniformis, 203.
variegatus, 193, 203.
yucatanicus, 203.
Spherodactylus, 211.
anthracinus, 211.
glaucus, 194, 211.
notatus, 211.
torquatus, 211.
Spilotes, 223, 227.
Spongia
botryoides, 4.
complicata, 4.
Staurotypus
biporcatus, 209.
triporcatus, 209.
Stenorhina
dagenhardti, 225.
Stenorhynchus, 509.
Stercutus, 563.
Sternotherus
nigricans, 252.
sinuatus, 251.
203,
Streptophorus, 224,
227.
atratus, 196.
diadematus, 224.
Struthio, 291, 393.
molybdophanes, 295.
Sturnus, 54.
Suricata
tetradactyla, 28, 29.
Sus
leucomystax, 333, 334,
857.
Sycon
sp., 15.
Symphalangus, 170.
Syrrhopus, 207.
omiltemanus, 232.
verruculatus, 194.
Talpa
europed, 335.
mizura, 334, 335.
wogura, 3834.
Tarba, 148.
Favillacea, 149.
Tarentula, 570.
Tarsostenus, 273.
univittatus, 273,
Tatera
Jallax, 188.
teniura, 523.
Telephorus
bivittatus, 271.
incisus, 271.
migrinus, 271.
teter, 272.
viridescens, 271.
vitticollis, 271.
zonatus, 271.
Testudo, 69, 211, 243.
greca, 60.
polyphemus, 211.
tabulata, 211.
vicina, 59, 67, 68,
270.
Thalassia, 507.
Thecadactylus
rapicauda, 211.
| Thinocorus, 162, 163,
164, 165, 166, 168,
169.
sp., 155.
Thorius, 202, 241.
pennatulus, 193, 202,
232.
| Thriocera, 274.
bicinctella, 274.
pectoralis, 274, 275.
Thryonomys
swinderianus, 296.
Tiliqua, 257, 258, 260,
262, 266, 467, 487.
scincoides, 257.
Tityra, 37.
Toluca
lineata, 283.
Tomodactylus
amule, 232.
Tragelaphus
bor, 182.
haywoodi, 181.
knutsoni, 182.
scriptus, 181.
sylvaticus, 181.
Trapezia, 495.
Trimerorhinus
rhombeatus, 255.
Trimorphodon, 224.
biscutatus, 196, 224.
tau, 224.
upsilon, 196, 224, 231,
233.
Triprion
petasatus, 206.
Triton
cristatus, 58.
Trochosa, 570.
Tropidodipsas, 224
227.
Tropidonotus, 225, 227.
chrysocephalus, 195
233.
fasciatus, 225.
godmani, 233.
melanogaster, 195, 230,
233.
natri«, 60.
ordinatus, 195,
230, 233, 240, 241.
— eques, 1995.
marcianus, 195.
pryeri, 512. 518, 515.
sealaris, 195, 238.
sealiger, 195, 231.
sipedon, 225.
tagrinus, 511, 518.
validus, 223, 280.
variabilis, 231.
wibakari, 511, 5138.
Oo
bo
ww)
=~]
Tropidurus
hispidus, 61, 265,
269.
223,
INDEX.
Tupinambis, 268, 269,
nigropunctatus, 62, 65,
268.
' Typhlops
tenuis, 222.
Typhlotriton
speleus, 202.
Unealia, 222.
Upupa, 52.
Urotheca, 224, 227.
elapoides, 196, 224.
Urotragus
evansi, 314.
Urotrichus
gibbsi, 339.
talpoides, 338, 334, 335,
336, 341, 358.
— pilirostris, 333, 342.
Ursus
arctos, 339.
Japonicus, 334, 335.
torguatus, dd4.
Uta, 212, 213.
auriculata, 213.
hicarinata, 194, 218,
230, 240.
elegans, 14, 218.
irregularis, 194.
lateralis, 213.
stansburiana, 218.
Vanellus. 157, 162, 163,
164, 165, 166, 167.
vulgaris, 155.
Varanus, 61, 462, 485.
albigularis, 253.
| exanthematicus, 59,267,
| 268, 269.
griseus, O9.
niloticus, 254.
Venator, 570.
Vespertilio
sp., 020.
| abramus, 337.
africanus, 522.
| akokomuli, 337.
| blepotis, 338.
| blythi, 522.
equinus, 113, 141.
| ferrum-equinum,
a healt
THE END.
605
Vespertilio
Serrum-equinum major,
113.
— minor, 141.
hippocrepis, 113, 141.
hipposideros, 141.
muatschiet, 520.
— pellucens, 520.
minutus, 129.
mirza, 520.
serotinus, 520.
shiraziensis, 520.
subbadia, 180, 131.
turcomanus, 520.
Vulpes
ferrilatus,
304, 505.
flavescens, 303.
japonicus, 335.
vulpes flavescens, 303,
302, 303,
522.
— waddelli, 303, 304,
305.
Xantusia, 219.
Xenodon, 227.
rhabdocephalus, 231,
233.
Xenopus
calcaratus, 249, 250.
elivii, 249, 250.
Fraseri, 250.
levis, 248, 249, 250.
muelleri, 249, 250.
petersti, 249.
_ Xenosaurus, 221,231,242.
i
grandis, 2\7, 238,
Zamenis, 223, 227, 231.
constrictor, 223.
grahami, 225, 233, 240.
lineatus, 196.
mentovarius, 196, 225,
Zole2oo:
MeEXICANUS,
240.
ornatus, 225.
pulcherrimus, 196, 223.
semilineatus, 223.
teniatus, 223.
196,
W8, Zonurus
polyzonus, 253.
Printed by Taytor and Francis, Red Lion Court, Fleet Street.
No. 19.
ABSTRACT OF THE PROCEEDINGS
OF THE
ZOOLOGICAL SOCIETY OF LONDON.
May 2nd, 1905.
Dr. W. T. Buanrorp, C.I.E., F.R.S., Vice-President,
in the Chair.
The Secretary exhibited three large photographs, presented
to the Society by Mr. Howard B. Turner, of Hippopotamuses
swimming in a river in their native haunts.
Mr. R. BE. Houprne exhibited and made remarks on a series of
antlers, of the first year, of the Roebuck, Red-Deer, Fallow- Deer,
and Wapiti.
Mr. R. I. Pocock, F.Z.8., exhibited and made remarks on a
specimen of the Spanish Tarantula, Lycosa hispanica, that had
died in the Society’s Gardens.
Mr. W. Barsson, F.R.S., exhibited a series of specimens of
domestic chicks to illustrate peculiarities in the hereditary
transmission of white plumage.
Mr. Grorce R. Atrorp communicated a paper by Prof. EK. A.
Mincuin entitled “On JLeucosolenia contorta (Bowerbank),
Ascandra contorta Haeckel, and Ascetéa spinosa Lendenfeld.”
The author pointed out that the nomenclature of the Calcarea
Homocela was in a more tangled state than that of any other
group of the animal kingdom, with, perhaps, the exception of the
malarial parasites. Dr. Bowerbank, who founded the species,
* This Abstract is published by the Society at 3 Hanover Square, London,
W., on the Tuesday following the date of Meeting to which it refers. It will
be issued, free of extra charge, to all Fellows who subscribe to the Publications,
along with the ‘ Proceedings’ ; but it may be obtained on the day of publication
at the price of Sixpence, or, if desired, sent post-free for the sum of Sex
Shillings per annum, payable in adyance. ;
2
gave a diagnosis that would fit any Ascon, and his type specimens
were jumbles of three or four species ; consequently Prof. Minchin
declared his name to be of no systematic value whatever. To
Haeckel’s name Ascandra contorta, Prof. Minchin referred a
sponge extremely abundant on the Mediterranean coasts of
France. Haeckel also pointed out that Dr. Bowerbank’s diagnosis
was not definitive of the species, and diagnosed the species
by details of spiculation. In this he was incorrect in saying
the monaxons were possessed of lance-head distal ends, and that
gastral rays of the quadriradiates ‘ curved.”
Prof. Minchin preferred to name Ascandra contorta H. as
Clathrina contorta, having a closely reticulate mode of growth,
equiangular triradiate systems, collar-cells with basal nucleus, and
parenchymula larva.
He showed that the monaxon spicules were very variable—so
much so, as to explain the name Ascetta spinosa Len. All
specimens of spinosa examined by him were of small size, not
like the broad spreading growth of contorta containing monaxon
spicules; and having examined a slide labelled Ascetta spinosa
in Lendenfeld’s handwriting, and having found the triradiate
systems exactly similar to those of the true contorta, he came
to the conclusion that the Ascetia spinosa was only an age
variation of Clathrina contorta, not yet possessing monaxon
spicules.
He discussed the question whether there was justification for a
new species or whether this should be regarded as a variation
only, on the grounds of the formation of spicules, and which were
primary monaxons and which were secondary.
Mr. F. E. Bepparp, F.R.S., read some notes on the Anatomy
of the Ferret-Badger (Melictis personata), based on a dissection of
a specimen that had recently died in the Society’s Gardens.
Mr. W. P. Pycrart, F.Z.8., read a paper on the Osteology of
the Hurylenide, and briefly discussed the question of the
systematic position of this group.
While agreeing with the general concensus of opinion as to the
primitive character of these birds, he held that the isolated
position which they were supposed to occupy with regard to the
remaining Passeres was by no means justified by facts.
The pterylography, osteology, and myology of the Hurylemide
all tended to show that the nearest allies of these birds were the
Cotingide.
Although undoubtedly primitive, the group, Mr. Pyeraft pointed
out, presented a number of specialised characters, which were
especially marked in the skull and muscles of the wing.
3
The next Meeting of the Society for Scientific Business will
be held on Tuesday, the 16th May, 1905, at half-past Eight~
o'clock Pp M., when the following communications will be made :—
1. Mr, F. E. Bepparp, F.R.S.—A Contribution to the Know-
ledge of the Encephalic Arterial System in Sauropsida.
2. Dr. E. Bercroru, C.M.Z.S.—On Stridulating Halyine, with
Descriptions of new Genera and Species.
3. Sir Harry Jounston, G.C.M.G., K.C.B.—On the Classification
of the Anthropoid Apes as proposed by the Hon. Walter Rothschild.
Communications intended for the Scientific Meetings of the
ZOOLOGICAL Socinry oF Lonvon should be addzessed to
P. CHALMERS MITCHELL, Secretary.
3 HANOVER SQuARE, Lonpon, W.
9th May, 1905.
No. 20.
ABSTRACT OF THE PROCEEDINGS
OF THE
ZOOLOGICAL SOCIETY OF LONDON.*
May 16th, 1905.
G. A. Bovtencrr, Esq., F.R.S., Vice-President,
in the Chair.
The SECRETARY read a report on the additions that had been
made to the Society’s Menagerie during the month of April 1905,
and called special attention to a young female Chimpanzee (Anthro-
popithecus troglodytes), deposited ; to a young female Giraffe from
Northern Nigeria, probably belonging to the race known as
Giraffa camelopardalis peralta, purchased ; toa young male Huanaco
(Lama hwanacos) from Punta Arenas, Tierra del Fuego, presented
by Mr. Moritz Braun and Capt. R. Crawshay; and to a pair of
Conecave-casqued Hornbills (Dichoceros bicornis) from India,
purchased.
Mr. OuprieLD THomas, F.R.S., exhibited examples of a new
Golden Mole which had been obtained in connection with
Mr. C. D. Rudd’s exploration of South Africa, and which he pro-
posed to call
AMBLYSOMUS CORRIA, Sp. Nn.
Smoky blackish above and below, darker than in A. ais. Skull
less broadened behind than in A. hottentottus.
Head and body 129 mm.; hind foot 13; greatest skull
length 28.
Hab. Knysna, Cape Colony.
Type. Male. B.M. No. 5.5.5.5. No. 1021 of the Rudd collection.
* This Abstract is published by the Society at 8 Hanover Square, London,
W., on the Tuesday following the date of Meeting to which it refers. It will
be issued, free of extra charge, to all Fellows who subscribe to the Publications,
along with the ‘ Proceedings’ ; but it may be obtained on the day of publication
at the price of Sixpence, or, if desired, sent post-free for the sum of Sir
Shillings per annum, payable in advance.
6
Mr, H. B. Fanruam, B.Sc., F.Z.S., exhibited and made remarks
upon microscopic slides of Lankesterella tritonis, a Hemogregarine
parasitic in the blood-corpuscles of a Newt, Viton cristatus.
This parasite was recently found by Mr, A. 8. Hirst, F.Z.S., and
the exhibitor, and their observations had since been independently
confirmed by Dr. A. C, Stevenson.
Mr, F. EK. Bepparp, F.R.S., read a paper entitled “ A Contri-
bution to the Knowledge of the Encephalic Arterial System in
Sauropsida,”
Sir Harry Jounsron, G.C.M.G., K.C.B., read a paper con-
taining criticisms of the Hon. Walter Rothschild’s proposed
classification of the Anthropoid Apes. He was disposed to agree
with Mr. Rothschild’s classification of the African Apes, but
suggested that the proper transcription of the native name for
the Bald Chimpanzee should be nkulunkwmba-instead of (as
Du Chaillu wrote it) koolookamba. Sir Harry, however, could
not agree with Mr. Rothschild’s proposed change of the generic
name of the Orang from Simia to Pongo; and although con-
sidering him right in applying the former name, at present used
for the Orang, to the Chimpanzees, he was of opinion that either
Satyrus or Pithecus was a far preferable name to Pongo for the
Orang. He concluded the paper with a list of words used in
several African languages for the name of the Chimpanzee, and
with a précis of the history of European knowledge of the
Anthropoid Apes down to the Eighteenth Century.
Mr. Knup ANDERSEN contributed a paper on some ‘species of
Bats of the genus Rhinolophus, in the course of which he showed
the progressive evolution from the Austro-Malayan 2. simplex
(allied to megaphyllus), through a long series of Oriental forms,
to the W. Palearctic &. ferrwm-equinum, and a similar chain from
the Oriental 2. lepidus (allied to minor) to the W. Palearctic
Lh. blasti and R. euryale. RK. hipposiderus was traced back to the
Oriental A. minor. <A slight difference between the British
colony of &. hipposiderus and the Central European form of the
same species was pointed out. All the Ethiopian species of
Rhinolophus were shown to be of Oriental origin.
A paper was read from Dr. EK. Bercrorn, C.M.Z.8., containing
the results of his observations on the stridulating-organs and
descriptions of five new species (two of which were referred to
new genera) of the Hemipterous family /alyine.
Dr. P. Catmers Mircneny, Secretary to the Society, read a
° 2 . . . 3 . . d .
paper entitled “On the Anatomy of Limicoline Birds, with
special reterence to the Correlation of Modifications.” The paper
dealt with the anatomy, chiefly muscular, of Charadriide, Chioni-
dide, Glareolide, Thinocoride, @dicnemide, and Parride,
? ? ? ?
a
Mr. R. I. Pocock, F.Z.S., Superintendent at the Gardens,
read a paper containing results of observations made upon a
female specimen of the Hainan Gibbon (Hylobates hainanus),
now living in the Society’s Gardens,
The next Meeting of the Society for Scientific Business (closing
the Session 1904-05) will be held on Tuesday, the 6th June,
1905, at half-past Eight o’clock p.m., when the following com-
munications will be made :—
1. Col. C. Detmn-Rapciirre.—Notes on the Natural History
of Western Uganda. (Illustrated by lantern-slides.)
2. Mr. Martin Jacopy.—Descriptions of new Species of
@dionychis and allied Genera.
3. Dr. P. Caoatmers MircHetyt.—On the Intestinal Tract of
Mammals.
Communications intended for the Scientific Meetings of the
ZOOLOGICAL Society or Lonpon should be addressed to
P. CHALMERS MITCHELL, Secretary.
3 HANOVER Square, Lonpon, W.
23rd May, 19095.
No. 21.
ABSTRACT OF THE PROCEEDINGS
OF THE
ZOOLOGICAL SOCIETY OF LONDON.
June 6th, 1905.
Dr. Henry Woopwarp, F.R.S., Vice-President,
in the Chair.
The SEcRETARY read a report on the additions that had been
made to the Society's Menagerie during May 1905, and called
special attention to a Crowned Duiker (Cephalophus coronatus)
from West Africa, deposited on May Ist; to a Maxwell’s Duiker
(Cephalophus maxwelli) from West Africa, presented by Lt.-Col.
Bartlett, R.A.M.C., on May 16th; toa Nepalese Hornbill (Aceros
nepalensis) from the Himalayas, received in exchange on May
18th ; and to two Sulphur-breasted Toucans (Rhamphastos cari-
natus), purchased on May 13th and 23rd respectively.
Mr. OuprieLD THomas, F.R.S., exhibited a specimen of a new
Bushbuck, which he proposed to call
TRAGELAPHUS HAYWOODI, sp. 0.
Neck well-haired, without short-haired collar. Colour very
dark, belly black. Dorsal crest black anteriorly, white on hinder
back. Transverse stripes only three, very inconspicuous. Only
‘three or four white spots on haunches. Horns very powerful.
Greatest length of skull 265 mm. Length of horn on curve
470 mm.; basal circumference 171.
Hab. Nyeri, British Kast Africa.
Type. Male. B.M. 5.5.16.3, Presented by C. W. Haywood,
Esq.
Mr. OLDFIELD THomAs also exhibited some mammals and birds
from Japan which had been obtained by a collector sent out by
the Society’s President, His Grace the Duke of Bedford, K.G.,
* This Abstract is published by the Society at 3 Hanover Square, London,
W., on the Tuesday following the date of Meeting to which it refers. It will
be issued, free of extra charge, to all Fellows who subscribe to the Publications,
along with the ‘ Proceedings’ ; but it may be obtained on the day of publication
at the price of Sixpence, or, if desired, sent post-free for the sum of Six
Shillings per annum, payable in advance,
10
who, in order to show his sympathy with the technical side of the
Society’s work, proposed to further Zoological Science by having
systematic collections made in that part of the world. The speci-
mens would be laid before the Society from time to time, and
after being worked out by specialists, would be presented to the
National Museum.
Of the present series Mr. Thomas drew attention to a fine
Marten which appeared to be different from the true J/ustela
melampus, and which he proposed to call
MUSTELA MELAMPUS BEDFORDI, subsp. n.
General colour olivaceous isabella, quite different to the golden
yellow of true melampus. Throat and neck with a strongly con-
trasted yellow patch.
Hab. Nava district, Southern Central Hondo.
Type. Adult male. Original number 213. Collected by M. P.
Anderson.
Mr. R. I. Pocock, the Superintendent of the Gardens, exhibited
a female specimen of the Jamaican Scorpion, Centrurus insulanus,
carrying its young on its back. The specimen had been presented
to the Society by Mr. H. Munt, F.Z.8.
Dr. P. Cuaumers MircHeE.t, Secretary of the Society, read a
paper entitled “On the Intestinal Tract of Mammals,” and
illustrated it by lantern-slides prepared from some of the drawings
which he hoped would accompany the memoir on publication.
Tn the course of the last eight years, the Author had taken every
possible opportunity of studying the alimentary tract of Mammals
from specimens that had died in the Society’s Gardens, and had
obtained additional material elsewhere, with the result that his
investigations covered over two hundred individuals, and included
the greater number of the Mammalian Orders. The paper
described the Mammalian Intestinal Tract as being composed of
three definite morphological regions :—the duodenum ; Meckel’s
tract, which was derived from the pendent loop of Mammalian
embryology, and was an outgrowth corresponding to only a very
short part of the primitive straight gut; and the hind-gut. As
compared with the disposition in Birds, the Mammahan duodenum
was less specialised; Meckel’s tract, which in Birds the Author
had already shown fell into a series of patterns of systematic
importance, was much more homogeneous throughout the Mam-
malian series; the hind-gut, which was of little importance in
Birds, was developed in Mammals in varied patterns which had
systematic importance. The Author showed that the single cecum
which was characteristic of Mammals was probably one of an
original pair, and that the traces of this paired origin were much
more frequent in Mammals than had been supposed. He stated
that the primitive paired ceeca of Mammals were homologous with
those of Birds, The paper then gave a systematic account of the
11
characters of the intestinal tract in the different Mammalian
groups, and concluded with the inferences as to the affinities of
these groups that the patterns supplied.
Lieut.-Col.C. Deumé-Rancuirrs, M.V.O., ¥.Z.S., gave an account,
illustrated by a fine collection of specimens anda series of lantern-
slides, of the Natural History of Western Uganda, deduced from
observations and collections made by him while acting as British
Boundary Commissioner on the Uganda frontiers.
Dr. H. Gavow, F.R.S., read a paper on the Distribution of
Mexican Amphibia and Reptilia. After a critical revision of the
species recorded from Mexico, the Author stated that he grouped
them according to the prevailing physical features of the country.
It was found that Mexico had received its present fauna from both
the Northern and the Southern Continents. The Northern
immigrants had spread over high tablelands and mountains, whilst
not a few species had descended into the hot lowlands, even into
Central America and still further south. On the other hand, the
Southerners were divided by the plateau into an Atlantic and a
Pacific mass, each having had time to modify many of its members
according to the very different physical features. Scarcely any of
these Southerners had ascended the plateau, but they were not
averse to ascending high outlying mountains. A comparative
list of species confined to high altitudes was given, and the con-
clusion arrived at, with the help of geological data and the fauna
of the Antilles, was that the exchange between the North and
South took place during the Miocene epoch, at which period alone
the Antilles were connected with Central America.
Mr. G. A. Bounnncer, F.R.S., described the new species of
Reptiles discovered in Mexico by Dr. H. Gadow.
Mr. G. A. BouLENGER also presented a paper containing an
account of the Batrachians and Reptiles collected in South Africa
by Mr. C. H. B. Grant and presented to the British Museum by
Mr. C. D. Rudd.
Mr. F. E. Bepparp, F.R.S., communicated some notes on the
Anatomy of the Yellow-throated Lizard, Gerrhosaurus flavigularis.
Mr. BEDDARD also presented notes on the Cerebellum in the
Exanthematic Monitor, Varanus exanthematicus, and on the
Cerebral Hemispheres in the Taraguira Lizard, Tropidurus
hispidus.
Mr. Ricuarp AssHEton, F.Z.8., communicated a paper on the
Foetus and Placenta of the Spiny Mouse, dAcomys cahirinus.
The paper pointed out that the foetus, received from the Society’s
Gardens, was covered by a thin epitrichium which was. perforated
12
by the stouter hairs. The placenta was discoidal and closely
resembled that of the Mouse (JZws musculus). The trophoblast
was greatly thickened, and formed a distal portion which was
broken up into a system of large irregular spaces containing
maternal blood, and a proximal portion with more regular
channels containing maternal blood between which fcetal vessels
extended. The proximal wall of the yolk-sac was very vascular
and much folded, but the folds did not become involved in the
placental tissue as in some other Muride. The course of the
blood-circulation and details of histology were also described.
A paper was communicated by the Rev. H.8. GorHAm on some
new Coleoptera from South Africa. The Beetles referred to were
of the families Malacodermata, Cleride, and Hrotylide ; and had
been collected by Dr. H. Brauns of Willowmore, in Cape Colony,
either at Willowmore or at Delagoa Bay in 1900 or 1901 ; and
indicated that the Fauna of South Africa was rich in species of
the two first families, and more so than had been supposed in
members of the latter family. One new genus was described.
Dr. A. Smira Woopwarp, F.R.S., communicated a paper by
Baron Francis Nopcsa entitled ‘“‘ Remarks on the supposed
Clavicle of the Sauropodous Dinosaur Diplodocus.”
This Meeting closes the Session 1904-1905. The next Session
(1905-1906) will commence in November next.
The following Papers have been received :—
1. Mr. Marrry Jacosy, F.E.S.— Descriptions of new Species of
Oedionychis and allied genera (Phytophagous Coleoptera).
2. Dr. Water Kipp, F.Z.8.—On the Papillary Ridges in
Mammals, chiefly Primates.
3. Mr. F. E. Bepparp, F.R.S.—On some points in the Vascular
System of Hatteria compared with that of the Lacertilia and
Crocodilia.
Communications intended for the Scientific Meetings of the
ZooLoctcaL Society oF Lonpon should be addressed to
P. CHALMERS MITCHELL, Secretary.
3 HANOVER SQuaARE, Lonpon, W.
13th June, 1905,
No. 22.
ABSTRACT OF THE PROCEEDINGS
OF THE
ZOOLOGICAL SOCIETY OF LONDON.
November 14th, 1905.
G. A. Bounencrr, Esq., F.R.S., Vice-President, in the Chair.
The Secrerary read a report on the additions that had been
made to the Society's Menagerie during the months of June,
July, August, September, and October, 1905.
Col. W. H. Broun exhibited the mounted head and skin of a
white Water-buck (Kobus ellipsiprymnus) from British East
Africa ; and two mounted heads of the Rhinoceros, one of which
showed abnormal growth of the anterior horn, whilst the other
bore four horns, viz. two on the nose, one between the ears, and
one nearly at the back of the head.
The Hon. Waurrr Roruscuinp, F.Z.8., exhibited specimens of
a very rare and interesting Marsupial, hitherto unique, in the
Paris Museum, viz. Dactylopsila palpator Milne-Edw., which
differed from D. trivirgata by the extremely thin prolonged
second finger.
Mr. Roruscsrmp also exhibited two tusks which had been
obtained by Baron Maurice de Rothschild during his recent
expedition to Abyssinia. They were so unlike the normal tusks
of any known animal that Mr. Rothschild was of opinion they
might belong to some new form.
Mr. A. 8. Hirsr, F.Z.8., exhibited microscopic preparations
of a new Heemosporidian from the blood of an African Stork
* This Abstract is published by the Society at 3 Hanover Square, London
W., on the Tuesday following the date of Meeting to which it refers. It wil
be issued, free of extra charge, to all Fellows who subscribe to the Publications,
along with the ‘ Proceedings’; but it may be obtained on the day of publication
at the price of Sixpence, or, if desired, sent post-free for the sum of Sie
Shillings per annum, payable in advance.
14
(Leptoptilus crumeniferus). He pointed out that this parasite
belonged to the genus Halteridiwm, but differed from H. dani-
leawskyi in its greater size (stade moyen 7-10 yp), and also in its
method of sporulation, in which the merozoites were more
numerous, smaller, and arranged in a ball-like rounded mass.
The name Halteridium crumenium was proposed for the new
species.
Dr. P. L. Scuater, F.R.S., read a letter addressed to him by
Mr. William Rodier, of Tambua Station, Cobar, N.S.W., con-
cerning the continued success of Mr. Rodier’s plan for counter-
acting the Rabbit-pest, and explained the plan, which consisted
simply m catching the rabbits alive and killing the females only,
letting the males go free.
Mr. Henry Scurrren, F.Z.S., made some remarks, illustrated
by lantern-slides, on the Satyrus indicus of Tulpius, said to be
the type of the genus Simia, with the view of showing that the
animal was a Ganies and was recognised before the middle of
the eighteenth century as differing from a Chimpanzee. The
distinction between the fschego and the ngina was, he said,
known in England in the first quarter of the nineteenth century.
Dr. Watrer Kipp, F.Z.8., read a paper, illustrated by lantern-
slides, “‘ On the Papillary Ridges i in Mammals, chiefly Primates.”
The arrangements of the ridges on the hand and foot of. 24
species were shown and described, and their functions discussed.
Arguments were brought forward to show that their primary
function was to increase the delicacy of the sense of touch.
Mr. J. Lewis Bonuors, F.Z.8., communicated a paper on the
Mammals brought back by the Tibet Mission. The collection
was very small, containing examples of only some eight species
three of which were described as new, viz. :—
1) VuLPES VULPES WADDELLI, subsp. n. Similar to J. v. fla-
vescens, but the whole coloration much brighter, especially the
median dorsal area, which was deep red and markedly distinet
from the colour of the flanks.
(2) CriceruLus LAMA, sp.n. Allied to C. pheus, but much
greyer in general coloration, and the tail somewhat longer and
stouter.
(3) Mrcrotus (PHACOMYS) WALTONI, sp.n. Closely allied in
skull-characters to PA. blythi. The general coloration, however,
was fulvous-grey, slightly greyer over the anterior part of the
body.
A communication from Dr. Eryar Lonnpere, C.M.Z.S., con-
tained notes on the geographical distribution of the Okap1.
a
>
A communication from Major G. F. Evans contained notes on
observations he had made en the Goral (Cemas gorat) in Burma.
A paper by Miss Dorornzsa M. A. Bare contained an account
of a collection of the Mammals of Crete. Examples of sixteen
forms, of which six were described as new subspecies, were con-
tained in the collection, and these were enumerated and remarked
upon in the paper.
The next Meeting of the Society for Scientific Business will
be held on Tuesday, the 28th November, 1905, at half-past Hight
o’clock P.m., when the following communications will be made :—
1. Mr. Oxpriezp Tuomas, F.R.S—The Duke of Bedford’s
Exploration in Eastern Asia. List of Mammals obtained by
Mr. M. P. Anderson in Japan.
2. Mr. C. Tare Recan, F.Z.8.—A Revision of the Fishes of
the Family Galaxide.
3. Mr. J. Lewis Bonuors, F.Z.8.—The Mammalian Fauna
of China.—Part I. Murine.
4, Mr. R. LypexxKer, F.R.S.—On Colour-evolution in Guerezas,
The following Papers have been received :—
1, Mr. Martin Jacosy, F.H.8S.—Descriptions of new Species of
Oedionychis and allied Genera (Phytophagous Coleoptera).
2. Mr. Basprorp Dran.—Notes on the Living Specimens of
the Australian Lung-fish (Ceratodus forstert) in the Zoological
Society’s Collection.
3. Dr. Atrrep Ducés.—Description dun Ophidien nouveau
du Mexique (Morenoa orizabensis, gen. et sp. nn.).
4, Mr. L. Doncaster, F.Z.8.—On the Colour-variation of the
Beetle Gonioctena variabilis.
5. Capt. F. Watn, C.Z.M.S.—Notes on a Collection of Snakes
from Japan and the Loo Choo Islands.
6. Mr. Percy I. Latsy, F.Z.S.—On Three new Forms of
Butterfly of the Genus Heliconius.
7. Mr. Frank HE. Bepparp, F.R.S.—On some Points in the
Vascular System of Hatteria compared with that of the Lacertilia
and the Crocodilia.
8. Mr. Frank HE. Bepparp, F.R.S.—On anew Species of Ponto-
drilus fvom the Shores of the Red Sea.
16
9. Mr. Frank E. Bepparp, F.R.S.—On an Enchytracid Worm
(Henlea lefroyi, sp. n.) from India, destructive to the Eggs of a
Locust (Acridiwm sp.).
10. Mr. Frank E. Bepparp, F.R.S.—-Further Contributions to
the Anatomy, especially of the Vascular System, of Lacertilia.
11, Mr. H. R. Hoee, F.Z.S.—On some Spiders of the Family
Lycoside from South Australia.
12. Dr. J. G. pr Man.—On Species of Crustaceans of the Genera
Piychognathus Stimps. and Palemon Fabr., from Christmas Island.
13. Mr W. Srorrs Fox, F.Z.S.—On Bones of the Lynx from
Cales Dale, Derbyshire.
14. My. Otpriztp THomas, F.R.S.—On a Collection of Mam-
ma!s from Persia and Armenia presented to the British Museum
by Col. A. C. Bailward.
15. Mr. G. CanpLer.—Field-notes on the Habits of the Vulture.
16. Mr. R. Srartes-Browne, F.Z.S.—Note on Heredity in
Pigeons.
17. Mr. R. Lyprxxsr, F.R.S.—The White-maned Serow.
18. Mr. E.S8. Russett.—On Trichorhiza, anew Hydroid Genus
Communications intended for the Scientific Meetings of the
ZooLoGICAL Socimry oF Lonpon should be addressed to
P. CHALMERS MITCHELL, Secretary.
3 HANOVER Square, Lonpon, W.
21st November, 1905.
No. 28,
ABSTRACT OF THE PROCEEDINGS
OF THE
ZOOLOGICAL SOCIETY OF LONDON.
November 28th, 1905.
Dr. Henry Wcopwarp, F.R.S., Vice-President, in the Chair,
Mr. J. T. Cunnincuam, M.A., F.Z.8., exhibited some photo-
graphs of a horse bearing incipient horns. ‘They were about
# inch in length, the left being slightly larger than the right, and
there could be no doubt that they were outgrowths of the frontal
bone. The growths were covered with normal skin and hair.
Mr. Frank Suave, ¥.Z.8., exhibited photographs, which had
been taken in the Horniman Museum at Forest Hull, of a Sea-
Anemone (Anemonia sulcata) in the process of division.
Mr. Dovenias Eneuisn exhibited and made remarks upon a
living albino specimen of the Field- Vole (Jficrotus agrestis) which
had been captured last July in Wales.
Mr. G. A. Bousncsr, F.R.S., exhibited a living lizard, Lacerta
muralis, from Brozzi, province Florence, which he had received
from Dr. A. Banchi, through the mediation of Dr. J. de Bedriaga,
C.M.Z.8. The lizard belonged to the typical form of the Wall-
Lizard, but was remarkable for its black coloration, above and
below. Melanistic forms of the Wall-Lizard were well known on
small islands in the Mediterranean, but, so far as Mr. Boulenger
was aware, no black specimen had ever been recorded from the
mainland. The scales across the body numbered 58 and the
lamellar scales under the fourth toe 25 in the specimen exhibited ;
these two numbers being sufficient to distinguish the Brozzi
lizard from the melanotic insulars previously described.
Capt. ALBrrt Pam, F.Z.S., made some remarks on a living
specimen of the Violet-cheeked Humming-bird (Petasophora
iolota) which he had recently brought home from Venezuela and
presented to the Society’s Menagerie. He also gave a general
account of the babits of these birds, as observed by him, in a wild
* This Abstract is published by the Society at 38 Hanover Square, London,
W.., on the Tuesday following the date of Meeting to which it refers. It will
be issued, free of extra charge, to all Fellows who subscribe to the Publications,
along with the ‘ Proceedings’ ; but it may be obtained on the day of publication
at the price of Sixpence, or, if desired, sent post-free for the sum of Six
Shillings per annum, payable in advance.
18
and captive state, and notes on they management and feeding
. . »
while in confinement.
Mr. W. R. Ogityie-Grant, F.Z.8,, sent for exhibition a named
set of the Birds collected in Japan by Mr. M. P. Anderson in
connection with the Duke of Bedford’s Exploration in Eastern
Asia. No new species were obtained, but several of the specimens
were of special interest as illustrating stages of plumage not
represented in the British Museum.
Mr, R. Lypexxer, F.Z.8., contributed a paper in which he
described a transition in the general type of colouring from the
wholly black Colobus guerezw in one direction, through several
intermediate forms, towards the black-and-white C. caudatus,
and in another direction towards C’. vellerosus.
Jn a second communication Mr. LypexKer described a mounted
specimen of the White-maned Serow (Vemorhedus argyrochetes
Heude), of Szechuen, the first example of the species ever re-
ceived in England, and perhaps in Europe.
Mr. Ouprietp Tuomas, F.R.S., F.Z.S., read a paper on the
Mammals collected in Japan by Mr. M. P. Anderson for His Grace
the Duke of Bedford, and presented by the latter to the National
Museum. The collection was one of the most valuable for scientific
purposes which had ever been received from any one region.
Over 600 specimens had been obtained, belonging to 50 species
and subspecies, of which several were described as new. But
the chief value of the collection lay in the fine series of properly
localised specimens of species which had not been sent to Europe
since the time of Temminck’s ‘ Fauna Japonica.’ By the help of
these specimens the distribution of the species was fairly well
shown, while the Museum would now possess examples of all the
older known species suitable for comparison with their allies from
other parts of Eastern Asia, such specimens having been hitherto
conspicuous by their absence.
Of the new forms special attention was directed to the fol-
lowing :—
Evoromys BEDFORDI®, sp. n.
A Craseomys allied to H. rufocanus, but coloured more like
£. glareolus, and with a longer, less hairy tail.
Dimensions of the type :—Head and body 119 mm. ; tail 47;
hind foot 20.
fab. Shinshinotsu, Hokkaido.
Type. Male. Original number 23.
Eyvoromys ANDERSONT, sp. n.
Allied to £. bedfordic, but with longer tail and conspicuously
less powerful teeth.
Dimensions :—Head and body 120 mm.; tail 54; hind foot
18°5
Hab, Tsunagi, N. Hondo.
Pype. Male. Original number 76.
19
EvoroMys MIKADO, sp. n.
A true Hvotomys, coloured very like the European Z. glareolus,
though more strongly rufous.
Dimensions :—Head and body 104mm.; tail 34; hind foot 17.
flab. Aoyama, Hokkaido.
Type. Female. Original number 107,
SOREX SHINTO, sp. n.
A small species allied to S. minutus, but with an unusually
long tail.
Dimensions :—Head and body 50 mm. ; tail 49; hind foot 11:5.
Hab. Makado, N. Hondo.
Type. Male. Original number 47,
Mr. C. Tare Reeay, B.A., F.Z.S., read a paper entitled “A
Revision of the Fishes of the Family Galaxiide.” Two genera
were recognised, Galaxias and Veochanna, the latter consisting of
a single species only. Twenty-eight species of Galaxias were
described, including G’. attenwatus Jenyns, found on the coasts
and in the rivers of Australia, New Zealand and Chili, Patagonia,
and the Falkland Is., and two peculiar to the Cape of Good Hope,
five to New Zealand and the neighbouring islands, five to Chili,
Patagonia, and the Falkland Islands, and fifteen to Australia and
Tasmania. Five species were described as new to science.
Mr. J. Lewis Bonnors, F.Z.S., communicated the first of a
series of papers dealing with the Mammalian Fauna of China.
The present part dealt with the Murine, containing the genera
Mus and Micromys, giving descriptions and synonymy as well
as emphasising the distinctive characters by which the various
species might be easily distinguished. Two species were described
as new, of which the following are preliminary descriptions :—
MUS HUANG, sp. n.
Similar to Mus confucianus, but general colour much brighter
and tail without white tip.
MUs LING, sp. n.
Smaller than J/ws huang and paler in general coloration. Very
similar to dfus cremoriventer Mill., but with bicolor instead of
unicolor tail.
Mr. F. KE. Bepparp, F.R.S., read a paper entitled ‘Some
Additions to the Knowledge of the Anatomy, principally of the
Vascular System, of Hatteria, Crocodilus, and certain Lacertilia.”
A communication from Mr. Marrin Jacopy, F.E.S., contained
descriptions of 111 new species of Phytophagous Coleoptera of
the family Halticide.
20
Tne next Meeting of the Society for Scientific Business will
be held on Tuesday, ‘the 12th December, 1905, at half-past Hicht
o'clock P.m., when the following communications will be made :—
1. Dr. J. KE. Duerpen.—On the Habits and Reactions of Crabs
bearing Actinians in their Claws. (Illustrated by lantern-slides.)
2. Capt. F. Wat, C.M.Z.8.—Notes on a Collection of Snakes
from Japan and the ‘Loo Choo Islands.
3. Mr. H. R. Hoae, F.Z.8.—On some Spiders of the Family
Lycoside from South Australia.
4, Mr. Otprintp Tuomas, F.R.S.—On a Collection of Mammals
from Persia and Armenia presented to the British Museum by
Col. A. C. Bailward.
The following papers have been received :—
1. Mr. Basurorp Dean.—Notes on the Living Specimens of
the Australian Lung-fish (Ceratodus forstert) in the Zoological
Society’s Collection.
2. Dr. AurreD Ducks.—Description d’un Ophidien nouveau du
Mexique (Morenoa orizabensis, gen. et sp. nn.).
3. Mr. L. Doncaster, F.Z.8.—On the Colour-variation of the
Beetle Gonioctena variabilis,
4. Mr. Percy !. Laruy, F.Z.8.—On Three new Forms of
Butterfly of the Genus Heliconius
5. Mr. Frank E. Bepparp, ERS. On a new Species of
Pontodr ilus from the Shores of the Red Sea.
6. Mr. Frank E. Bspparp, F.R.S.—On an Enchytracid Worm
(Henlea lefroyi, sp. n.) from India, destructive to the Hegs of a
Locust (Acridiwm sp.).
7. Dr. J. G. pp May.—On Species of Crustaceans of the Genera
Piychognathus Stimps. and Palemon Fabr., from Christmas Island.
8. Mr. W. Storrs Fox, F.Z.S.—On Bones of the Lynx from
Cales Dale, Derbyshire.
9. Mr. R. Srapies-Browns, F.Z.8.—Note on Heredity in
Pigeons.
10. Mr. EK. 8. Russety.—On TZrichorhiza, a new Hydroid Genus.
11. Messrs. Cectn Warsurton, F.Z.8S.,and N. D. F. Pearce.—
On new and rare British Oribatide.
12. Dr. J. W. Jenxinson.—Notes on the Histology and
Physiology of the Placenta in Ungulata.
Communications intended for the Scientific Meetings of the
ZOOLOGICAL Soctery oF LonpDoN should be addressed to
P. CHALMERS MITCHELL, Secretary.
3 HANover Square, Lonpox, W.
oth December, 190d.
No. 24.
ABSTRACT OF THE PROCEEDINGS
OF THE
ZOOLOGICAL SOCIETY OF LONDON”
December 12th, 1905.
Howarp SauNDERS, Esq., Vice-President, in the Chair,
The Srcrurary read a report on the additions that had been
made to the Society’s Menagerie during the month of November
1905.
The Secrerary also exhibited a coloured print, published by
R. Ackermann in July 1812, of Polito’s Royal Menagerie at Exeter
"Change, London.
Mr. A. H. Cocks, F.Z.S., exhibited twelve enlarged photographs
of Whales taken by him at the Finwhaling Factories in East
Finmarken in 1883-89. The species represented were Megaptera
longimana, Balenoptera sibbaldii, B. musculus, and B. borealis.
Mr. Grorce P. Mupes, F.Z.S., exhibited and made remarks
upon a Dog-fish with an apparently abnormal disposition of the
digestive viscera, and an Earthworm with bifid tail.
Mr. H. B. Fanruam, B.Sc., F.Z.S., exhibited and made remarks
upon a new Hemosporidian parasite from the blood of a white
Rat.
Mr. Ouprietp Tuomas, F.R.S., exhibited the tail-vertebre of a
Dormouse of the genus Hliomys, which showed the phenomenon,
hitherto unrecorded among Mammalia, of the regeneration of a
bony structure in case of accident.
The caudal vertebra, in this case the twelfth, which had been
originally broken across, had grown out into a slender styliform
appendix, 15 mm. in length, and rather less than | mm. in
diameter, the normal vertebre of this part of the tail measuring
about 6 X 2 mm,
* This Abstract is published by the Society at 3 Hanover Square, London,
W., on the Tuesday following the date of Meeting to which it refers. It will
be issued, free of extra charge, to all Fellows who subscribe to the Publications,
along with the ‘ Proceedings’ ; but. it may be obtained on the day of publication
at the price of Sixpence, or, if desired, sent post-free for the sum of Siz
Shillings per annum, payable in advance,
99
fd el
On further search two other specimens exhibiting the same
structure had been found, and it appeared therefore that Dormice,
like Lizards, were able partly to regenerate their tails, when
these important balancing-organs got accidentally broken.
Dr. W. G. Ripewoop, F.Z.8., exhibited microscopic sections of
the skeletal tube found in the restored tail of one of the Dormice
(Graphiurus) exhibited by Mr. Thomas. He showed that the
wall was made up of close-set lamellee, producing in a transverse
section a fine concentric striation. Lacune with numerous
branching canaliculi were disposed regularly in relation with the
concentric striations, and the general effect was that presented by
a transverse section of the humerus or femur of a Frog. Internally
to the bony layers and contiguous with the central jelly was a
moderately thick layer, which was clear, homogeneous, and highly
refractive.
Dr. Ridewood also exhibited, by way of contrast, slides of the
skeleton of the restored tail of an Iguana Lizard, the skeletal
tube in this case being composed of calcified fibro-cartilage and
not of bone.
In a paper communicated to the Society by Prof. Hicxson,
F.R.S., and illustrated by lantern-slides, Prof. J. HE. DurrpDmEN, of
the Rhodes University College, Grahamstown, Cape Colony, gave
an account of his observations and experiments on the habits and
reactions of Crabs bearing Sea-Anemones in their claws.
A communication from Capt, F, Watt, O.M.ZS., contained
notes on a large collection of Snakes made by Mr, Alan Owston
in Japan and the Loo Choo Islands.
Mr. H. R. Hoce, F.Z.8., read a paper on a collection of South
Australian Spiders of the family Lycoside contained in the
Museum at Adelaide. He stated that this was one of the most
widely distributed families of Arachnida, but that, except in size,
the many forms varied but very little in general characteristics
from the type species found in Italy and Spain, Thirteen species
were remarked upon, ten of which were described as new,
Mr. OLDFIELD 'THomAs, F.R.S,, read a paper on a collection of
Mammals which had been obtained by Col. A. C. Bailward during
a shooting-trip through Persia and Armenia during the past
summer, and which had now been presented to the National
Museum. The specimens had been trapped and prepared by
Mr. R. B. Wocsnam, who accompanied Col, Bailward.
31 species were enumerated, and special attention was drawn to
the discovery of Calomyscus, a primitive Murine the only ally of
which, amongst recent forms, was the N. American Peromyscus,
The following novelties were described :—
29
CALOMYSCUS BAILWARDI, g. et sp. nn.
Teeth as in Peromyscus. Tail long, heavily pencilled. Ears
very large. Colour rich sandy buff above, white below.
Dimensions :—Head and body 78 mm.; tail 87; hind foot
20-5; ear 21:5. Skull: greatest length 26; length of upper
tooth-row 3°3.
Hab, Mala-i-Mir, N.E. of Ahwaz, Persia.
Type. Male. B.M. No. 5.10.4.68.
PIPISTRELLUS ALADDIN, sp. n.
A very small species allied to P. nanus and P. mimus. Small
anterior premolar in the tooth-row. Colour pale.
Forearm 31 mm. Greatest length of skull 11°3,
Hab. Derbend, W. of Isfahan,
Type. B.M- No, 5.10.4.13.
ELLOBIUS WOOSNAMI, Sp. n.
Colour as in #. lutescens. Teeth of much simpler pattern, the
last molar, above and below, nearly as simple as in Z. talpinus.
Head and body 112 mm.; tail 16; hind foot 23. Greatest
length of skull 32.
Hab. Dumbeneh, N. of Isfahan.
Type. Female. B.M. No. 5.10.4.65,
A communication from Dr. AuFreD Ducks contained the de-
scription of a new Mexican Snake.
Mr. Lronarp Doncaster, F.Z.8., contributed a paper on the
colour-variation of the Beetle Gonioctena variabilis. The material
on which the paper was based was collected almost entirely at
Granada, and the Author found that, although the insect was
extraordinarily variable, when a large collection was examined
the beetles could be classified into two chief groups with but few
intermediate forms.
Mr. F. E. Bepparp, F.R.S8., contributed two papers describing
two new species of worms, one a Pontodrilus from the shores of
the Red Sea, and the other an Enchytreid of the genus Henlea
from India, which was destructive to the eggs of the Locust.
A paper was read from Dr. J.G. DE Man, in which he described
two species of Decapod Crustacea, a Crab and a Prawn, collected
by Dr. R. Hanitsch, of Singapore, from a small artificial fresh-
water pool on Christmas Island, The interest of their occurrence
lies in the fact that previous to the construction of the reservoir, a
few years ago, there seems to have been no possible habitat for
these animals on the island, and they must have been introduced
since that time, perhaps by migration from the sea. The Crab
was referred to Ptychognathus pusillus, a species described by
Heller from the Nicobar Islands forty years ago and not since
24
found. The Prawn was made the type of a new variety of Paleemon
lar, both the variety and the typical form having a wide distri-
bution in countries bordering the Indian Ocean.
Mr. RicHarp SrapLes-Browne, F.Z.8S., contributed a paper
containing the results of experiments he had made in connection
with the heredity of webbed feet in Pigeons.
Mr. Cecin Warburton, F.Z.8., read a paper, prepared by himself
and Mr. N. D. F. Parcs, on new and rare British Oribatide.
Eleven species were remarked upon, of which seven were described
as new to science, and two were recorded for the first time as
being British. The nymph of Serrarius microcephalus was de-
scribed for the first time, and it was pointed out that Gustavia sol
of Kramer was a nymph of an unknown species of Serrarius,
The next Meeting of the Society for Scientific Business will
be held on Tuesday, the 16th January, 1906, at half-past Hight
o'clock Pp M., when the following communications will be made :—
1. Mr. W. Srorrs Fox, F.Z.8.—On Bones of the Lynx from
Cales Dale, Derbyshire.
2. Mr. J. Lewis Bonnorts, F.Z.S.—On Mammals from South
Johore and Singapore collected by Mr. C. B. Kloss.
3. Mr. F. E. Bepparp, F.R.S.—Contributions to the Anatomy
of the Ophidia.
4. Mr. Cuarues 8. Tomus, M.A., F.R.S.— On the Minute
Structure of the Teeth of Creodonts, with especial reference to
their suggested Resemblance to Marsupials.
The following Papers have been received :—
1. Mr. BasHrorp Dran.—Notes on the Living Specimens of
the Australian Lung-fish (Ceratodus forsteri) in the Zoological
Society's Collection.
2. Mr. Peroy I. Latruy, F.Z.S.—On Three new Forms of
Butterfly of the Genus Heliconius.
3. Mr. B.S. Russett.—On Trichorhiza, a new Hydroid Genus.
4. Dr. J. W. Jenxryson. -— Notes on the Histology and
Physiology of the Placenta in Ungulata.
5. Miss Gerrrupe Ricarpo.—Description of a new Genus of
the Tabanide.
6. Dr. Jean Roux.—Synopsis of the Genus NVectophryne.
7. Mr. J. S. Spurrery.—On the Angle of the Jaw.
Communications intended for the Scientific Meetings of the
ZooLoGIcAL Society OF Lonvon should be addressed to
P. CHALMERS MITCHELL, Secretary,
3 HANovER Square, Lonpon, W.
19th December, 1905.
THE ZOOLOGICAL SOCIETY OF LONDON.
Tuts Society was founded in 1826 by Sir Sranrorp Rarrtes,
Mr. J. Sasinz, Mr. N. A. Vieors, and other eminent Naturalists,
for the advancement of Zoology and Animal Physiology, and for the
introduction of new and curious subjects of the Animal Kingdom,
and was incorporated by Royal Charter in 1829.
COUNCIL.
HIS GRACE THE DUKE OF BEDFORD, K.G., President.
Srr ALEXANDER Barrp, Br.
Greorck A. Boutsenerr, Esea.,
F.R.S., Vice-President.
Tuomas H. Burroveuss, Ese.
F. G. D. Drewirr, Ese., M.A.
WEDS 1) ea Gal es
Hersert Druct, Ese., F.LS.,
Vice-President.
Cuartes Drummonp, Ese.,
Treasurer.
Sir Epwarp Duranp, Br., C.B.
Freverick Ginter, Esa.
F. Du Cane Gopman, KEsa.,
D.C.L., F.R.S., Vice-President.
W. R. Ocitvie-Grant, Ese.
J. Jackson Lisrer, Esq., M.A,
F.RS.
Srr Epmunp Gitus Loprr, Br.
FE. G. B. Meavr-Watpo, Esa.
P. Caatmers Mrrcuent, Hsa.,
M.A., D.Sc., Secretary.
K. Lorr Purzrres, Ese.
Howarp Saunpers, Esa., Vice-
President.
H.S.H. Privce Francis or Trcr.
Cuartes §. Towns, Ese., M.A,,
F.R.S., Vice-President.
Aveustus F. Wiener, Esa.
Henry Woopwarp, Ese., LL.D.,
F.R.S., Vice-President.
2
The Society consists of Fellows, and Honorary, Foreign, and
Corresponding Members, elected according to the By-Laws.
The Gardens in the Regent’s Park are open from Nine o’clock a.m.
till Sunset.
The Offices (3 Hanover Square, W.), where all communications
should be addressed, are open from Ten till Five, except on Satur-
days, when they are closed at Two o’clock p.m.
The Library (38 Hanover Square), under the superintendence of
Mr. F H. Warernovss, Librarian, is open from 10 a.m. to 5 P.M.,
on Saturdays to 2 p.m. It is closed in the month of September.
The Meetings of the Society for General Business are held at the
Office on the Thursday following the third Wednesday in every
month of the year, except in September and October, at Four P.M.
The Meetings for Scientific Business are held at the Office twice
a month on Tuesdays, except in July, August, September, and
October, at half-past Hight o’clock p.m.
The Anniversary Meeting is held on the 29th April, at Four p.m.,
or the nearest convenient day (April 28, 1905).
TERMS FOR THE ADMISSION OF FELLOWS.
Frttows pay an Admission Fee of £5, and an annual Contri-
bution of £3, due on the Ist of January, and payable in advance,
or a Composition of £30 in lieu thereof; the whole payment,
including the Admission Fee, being £35.
No person can become a Frttow until his Admission Fee and
First Annual Subscription have been paid, or the annual payments
have been compounded for.
Frtiows elected after the 30th of September are not liable for
the Subscriptions for the year in which they are elected.
PRIVILEGES OF FELLOWS.
Frttows have Personal Admission to the Gardens with Two
Companions daily, upon signing their names in the book at the
entrance gate.
Frxtows receive a Book of Saturday and a Book of Sunday Orders
every year. ‘These Orders admit two persons to the Gardens on each
3
Saturday and fwo on each Sunday in the year. But the Saturday
Orders are not available if the Frttow shall have used his privilege
of personally introducing two companions on the same day.
Fettows also receive every year Twenty Free Tickets (Green),
each valid for the admission of one adult any day of the week,
including Sunday. Children’s Tickets (Buff) can be had_in leu of
Green Tickets in the proportion of two Children’s Tickets to cne
Adult’s. These Tickets, if not made use of in the year of issue, are
available for following years.
In no case can two children be passed through the gates as
one adult.
Fettows, if they wish it, can exchange the Book of Saturday
Orders for Twenty Green Tickets available for any day. The Book
of Sunday Orders can also be exchanged for a similar packet of
Twenty Tickets. These books must, however, be returned entire,
and the exchange can only be made during the year of their issue.
The annual supply of Tickets will be sent to each Frttow on the
Ist of January in every year, on his filling up a form of Standing
Order stating in what way they should be made up, and to what
address they should be sent. Forms for this purpose are supplied
on appleation.
The Wire of a Fexttow can exercise all these privileges in his
absence.
Fetiows have the privilege of receiving the Society’s Publications
on payment of the additional Subscription of One Guinea every
year. This Subscription is due upon the Ist of January and must
be paid before the day of the Anniversary Meeting, after which
the privilege lapses. Frtrows are likewise entitled to purchase the
Transactions and other Publications of the Society at 25 per cent.
less than the price charged to the public. A further reduction of
25 per cent. is also made upon all purchases of Publications issued
prior to 1871, if above the value of Five pounds.
Frttows also have the privilege of subscribing to the Annual
Volume of the Zoological Record for a sum of £1, payable on the
1st July in each year, but this privilege is forfeited unless the
subscription be paid before the 1st of December following.
4
Frttows may obtain a TransrerarLA Ivory Ticker admitting
Two, Persons, available throughout the whole period of Fellowship,
on payment of Ten Pounds in one sum. A second similar ticket
may be obtained on payment of a further sum of Twenty Pounds.
Any Frtrow who intends to be absent from the United Kingdom
during the space of one year or more may, upon giving to the
Secretary notice in writing, have his name placed upon the
“ dormant list,” and will be thereupon exempt from the payment of
his annual contribution during such absence.
Any Frttow, having paid all fees due to the Society, is at liberty to
withdraw his name upon giving notice in wreting to the Secretary.
Ladies or Gentlemen wishing to become Fellows of the Society
are requested to communicate with the undersigned.
P. CHALMERS MITCHELL, M.A., D.Sc.,
Secretary.
3 Hanover Square, London, W.,
October, 1905.
MEETINGS
OF THE
ZOOLOGICAL SOCIETY OF LONDON
FOR
SCIENTIFIC BUSINESS.
(AT 3 HANOVER SQUARE, W.)
1905.
Tunspay, NovemBer 14 and 28 | Turspay, December 12
1906.
Tourspay, January 16 Wgimsmice, supe 5, IO
be Frprvary 6 and 20 i Wie go6 4 Il, La armel 2S)
sm INT ANE Cig sien © elena) iy JUNE ena 9
The Chair will be taken at half-past Fight o'clock in the Evening
precisely,
LIST OF THE PUBLICATIONS
OF THE
ZOOLOGICAL SOCIETY OF LONDON.
Tue scientific publications of the Zoological Society of London
are of two kinds—“ Proceedings,’ published in an octavo
form, and ‘‘ Transactions,” in quarto.
According to the present arrangements, the “ Proceedings”’
contain not only notices of all business transacted at the scien-
tific meetings, but also all the papers read at such meetings
and recommended to be published in the ‘‘ Proceedings ” by
the Committee of Publication. A large number of coloured
plates and engravings are issued in the volumes of the
“ Proceedings,” to illustrate the new or otherwise remark-
able species of animals describedin them. Amongst such
illustrations, figures of the new or rare species acquired in a
living state for the Society’s Gardens are often given.
The ‘ Proceedings” for each year are issued in four parts,
on the first of the months of June, August, October, and
April, the part published in April completing the volume
for the last half of the preceding year. From January 1901
they have been issued as two half-yearly volumes.
.The “‘ Transactions”? contain such of the more important
communications made to the scientific meetings of the Society
as, on account of the nature of the plates required to illustrate
them, are better adapted for publication in the quarto form.
They are issued at irregular intervals.
Fellows and Corresponding Members, upon payment of
a Subscription of One Guinea before the day of the Anni-
versary Meeting in each year, are entitled to receive the
Society’s Publications for the year. They are lkewise
entitled to purchase the Publications of the Society at 25 per
cent. less than the price charged for them to the Public. A
further reduction of 25 per cent. is made upon purchases of
Publications issued prior to 1881, if they exceed the value of
five pounds.
Fellows also have the privilege of subscribing to the
Annual Volume of the Zoological Record for a sum of 380s.
(which includes cost of delivery), payable on the Ist July
in each year; but this privilege is forfeited unless the
subscription be paid before the Ist of December following.
The following is a complete list of the publications of the
Society already issued.
| October, 1905. ]
TRANSACTIONS OF THE ZOOLOGICAL SOCIETY OF LONDON,
4to. 16 vols. and Index. ate
Vell ey containmeroveblares: 9) ae (lsos=30) ieee lO Gee
les i lane ponlsseeAUl i gona Zoe) O.,
elu i GB) oy Mea Gilet ey eee Sn ee toh he
sre INE - Te SCSI) com OG 2 O,
EBSA Ds OT 8 esse ROLES). a a,
eV t C1e Oo doe CECE) coc. Ile HO.
Bevis, * G3. ¢ jg CUSI=72) oaen IO 4 O,
op WAU em oa 6 (START) soos OS B
ee Toker me ee Oe 5 USB) buco ID 1G.
Wem rte COs. SOS 12.5 10 0 8.
index wlViolls SISNeT in! elas elan (1833-79) .. ONG BGhe;
Wolk 2Xib, Contianonne O7 Pikes, (AS80385) ..4, 9 12 oO .
5 OU en COn ee ae TS SG—00))irar. 5s 8 ©.
oe OUI, Ol ees mem ( LOIN OD) Ste On. Oo oie
eV a Pf ia (UO RO, 6
A aexave Sb. CRON). Ie 6.
One BO A CROI-AICOS) 9. oR 3 0.
PON Let eel e, Don oo (Aue OUR) Se 1 DB Bs,
oO OU AUEy aes Bn oo (Came IO) 66 O18 G..
ONO noe ye la oak ha (Oct O04 ie emily 22h Ge.
ONC VAL ay WAS aet Saye (Oct, 1905) Meare sli OG Res
PROCEEDINGS OF
CORRESPONDENCE OF
THE COMMITTEE OF
THE ZOOLOGICAL
LONDON. 8vo. 2 vols. (Letterpress only). 2%
Tap lh UGROBL, Myo Gye, “Guogeneveses on 4s,
Oe Si oi gt mt icy ice tt ate aah yeas As,
9”
ce to
lows.
6d.
Price to the
Public.
. £4 18
6
IIL
2
19
0
12
JUL
QOoqQeoeoceQoqgqgoeoEeqe
HHOH NI AINON
SCIENCE AND
SOCIETY OF
Price to the
Publie.
68.7
6s.
PROCEEDINGS OF THE ZOOLOGICAL SOCIETY OF LONDON.
8vo. 15 vols. (Letterpress only) and Index. (First Series.)
Price to Price to the Price to Price to the
Fellows. Public. Fellows. Public.
Part I. 1833.1 vol. 8vo. 4s. 6d. .. 6s.f | Part IX. 184]. 1 vol. 8vo. 4s. 6d. .. Gsst
i IO, Wee 95 4s (i oo (OS ‘cy X. 1842. Bs Asm OG OS*
4 JUL, Weise 90 Als. (eh, on (BS % XI. 1848. 95 As. 6d. .. 6s.
op WW TReraey 9 4a, Gd oo Os 90 IL. 1844. ‘ AUS, (BY, oq (BS
= Wo ISB Als. (Gd, 5 OB » AIT, 1845. 99 Alo, Gh, oo OS:
o Wl, TSBIS: 5 4S, Gls oo OS yy OL VEaLS4G: 99 ASHGCieOStat
PNAS 30. Sp 4s, Gh, oo GSP XV. 1847, 9» 4s. 6d. .. 6s.>
» VIII. 1840. 99 ASSOC OSs Indies 1830-1847. 90) AG, Gi, 5, OX
8vo. 13 vols. and Index. (Second Scries.)
Letterpress only. With Plates coloured.
Price to Price to the Price to Price to the
Fellows. Public. Fellows. Public.
Part XVI. 1848. 1 vol. 8vo. 4s. 6d. GSaee wane 21 @ & sel FG
9% XVII. 1849. 95 4s. 6d. GS antec tes: i @ l Gr
Bs XVIII. 1850. 0 4s. 6d. OS Favait vache I 8 6 LS Or
on XIX. 1851. 7 4s. 6d. OS suena Ols g Ho i Op
9 OX, US. ; 4s. 6d. OS eee es 015 9 ak hp
59 X XI. 1858. 90 As. 6d. Oy th Ae Rader ts 018 O I A OF
r. MAIL. 1854, 99 As, 6d. GSE a One eee O19 1G np
% WMI. 1855. 99 4s, Gd. Gist eee Woke tl & 6 118 OF
0 XXIV. 1856. 99 As. 6d. Oss ieiotran yes l @ 8 lL 4 Gr
‘ XXV. 1857. 5 4s, 6d. Gseinnenersa eae tl @ 8 o@. Gp
; XXVI. 1858. 5 As. 6d. (Gisse Wea, havens Rina i Wk & 22 Op
op OWT WS), 6 4s. 6d. Ogee. Bee einer: I it 2 20;
gy SOA WIOUL, WSICO), ~ As, 6d. OS Steet e as eet Wi One
Index 1848-1860. % As. 6d. Os.
il Out of print.
PROCEEDINGS OF THE SCIENTIFIC MEETINGS OF THE
ZOOLOGICAL SOCIETY OF LONDON. 8vo. 40 vols. and 4 Indices.
Letterpress only. With Plates uncoloured. With Plates coloured.
Price to Price to the Price to Price to the Price to Price to the
Fellows. Public. Fellows. Public. Fellows. Public.
NSCs IGG ee lOSs dca oien 9s. creer) chDeR enone Bee Wh anon ei
USE, 5941 Ge obb5 GS Soares 9s. eet etleal ane, Bierce B35, Oh cooo SORT
1863 AAO mer OSS wane ios 9s. ale) Sia eet irs 30s. 9d. Ads.
1864 AS OY ooo) O88s on G00 9s. ay DS Rete anes Ba, Oh cooo SORA
1865 4a, 6th oooc Gseaes 9s. Pesaran naan Bah Bs coon 25S
1866 AS, Gh oo00 Oe saocc 5 Bhi Dera voa lets BEG, Oh coco ZS
HS Geren tan AOL sree ge ts ebsie Qs, Re Bis'b c Bah Bh cose AHS
PBS Se arsucutyaaneren vatetcuaisustotareeene cts 9s HD seomae Be Ch sooo 455
AS GOP eirencncvn eccentric nancy oahene 9s. an LS eee BO Cth aooa 4S
MS AO aires ce genes heresies rare omesteiets 9s. Ere amnel ek Maen ee BO, Oth ooo 4Hoe
Iiaglerc, USGIAUEVO soacsaacacoc AS OOS coccone 6s
SUT Grain adler sa aieactsiva teresa site lonahoaeuels 9s SoD Sicke ohne SBkh Be soon 458
AS Die rrccn cele seaver cere cuca area osee hee eects 9s 5 esis O66 Be Oh sooo LOST
Siamese es sec crtentuc ces ahaa sieiede 9s Aen DIG Risin ren a, OU seco. tise
TS AN RI Oe ei cc oe ee ileal te Qs a ZF so 36s 48s.F
AES (ORL are sone econo Ama eer a ntien Slee steals 9s Nl sa MAE ars 36s 48s.
TS AB rece edhe Pet see een Rl vtes ue eeu 9s red OSes ara § 36s 48s.
WS lore te cveyra esas eatie Guiaitonenctorleus waecerereys 9s Sal Sor sate 36s 48s.
BSUS area ereccn era ee epee encworsisusieis ake 9s Fe Oe A ee 368 48s.
TSN G) ce cath teeth 1 ean eee Re ree he 9s. Bil ean (LOUK en Ae met he 36s. 48s,
BUSS Ome emer naiscanivne siekive sias memos 9s. ae D635 AS ea OOS .. 48s.
Ibagless, keys ge douooo8 PASH OMe 6s.
SBM Natacha ashame 9s. st STN) Sa eee. 36s. Mesos
BU SSD retary clara dedecin eenay ousbonek eevee 9s OS) eRe OOS 48s
SBS ie ero cae orn cacy Sa eT Nts 9s see] WS aaa nae 368 48s
AS SA erected 2.0 at ico pear ee Srata fouetintens 9s ea etnies eee 36s 48s
ASS) Boaters Auton aacot Maar ore 9s 5 Is 36s 48s
SSC ig treo oan one 9s LOST eer oe 36s 48s
MES Bye meet corse etc ees Ome eon eeoeeatoes 9s Bh NS ee es 36s 485
SSS tert miahlorertana knee os ch ameneres 9s Sls: 368 48s
TUNG). 2 eee eecpus ea uted Mma ya near Aictac 9s. Behipes al LOG 368 Sue nA SSE
AS OO Wee pavtenceaat peop ronek chet eevee omerene 9s: a cere LO) Sree ice ees 36s. AlBiotg ako,
Index, 1881-1890 ............ 45, Gt ocoo GS
HS Oi Mies se takes th hea Coen aK motschin wen sten amelie tcieaem ace Mtemene erect meecKonchcacmste 36s, anu0 aes,
BS OT Ge 8 Bree aiincess ch taba Tanti alae) arate sie tise sete nore aeMAItS Tee feN oT 36s 485
1 LEYS RN ae rete AR Seon ee, MEAS ore ur each CNA nan UATE nue. ceotaaTe et o6s 48s
ASC a ea ae ee EG enc, . eaeln tmnt cdo Groton oO ale 36s, 48s
ENS OP ivesreyiersocsschaeak a Sepa route a6, ap Taties colic al Oars reSce gen eaeT else ta AMELIE er eenGEeES 36s, 48s
BIS OG ase ce ates Scat tease cos acu one eh discon ecert vats ae Ra NECR ements 36s. 48s
BOE Macca nitnce Guan: Se acavaras heey sear tdartevmatatiny ak Soe ee Maa eNSGh enaLe nets Stokoe 36s 48s
SOS ees Race siclecad nici cae are tapes aaron aceon ones ee aM UTE CUNT onal Ree 36s A8s
LGA gra” Aiea es PER enna an UAme ety Men EET CUM MeTe nO icrieriorGan Centon 36s. 5560 Ate5o
NO OO pats eA ME A Ne rons aden ae tisaant MRR peeuene a a away eth ee ners 36s, soon 44s,
JtnGlers, SOIC ecagaodsooe Ale, (S@ oooo GS
* No perfect copies in stock. t Out of print.
PROCEEDINGS or tar GENERAL MEETINGS ror SCIENTIFIC
BUSINESS or tut ZOOLOGICAL SOCIETY OF LONDON.
8yvo. 9 vols.
Price to Price to the
Fellows. Public.
MOOI Fevolrilce nce cud eet mond eta enMnay ern Upenerr isso eee ee 24s,
ma Ph Erg a reap an ra ame CME AA oto BA A 1 a ie Tike k eee Saba i 24s,
TUCO) ik 2 ad a Annis eat Me wene PIE Ret Lec A ie IBS ieee 24s
Dy Mee Rueherarcncvedele s abeleldit eyataliwavkaienrcieycameteewcrt ade roe LSSs steeaet, 24s.
TSIOEE Scrat Us tes Aen eee em Beat eo eee ery oy Oude Game LSS rere tees 24s.
deere Bees NaI Rae nn UAE em (es eee 24s
AOA Saar puller vote on cet ct c-sfeRa le ncies PMR to meets toe eats aheriak or ROR MSS. we Raker 24s
POR Ty Pe race ine ete Pere ere 18s ene ee 24s
TUGLOE. | Sieg SIERA Oe ce ene Ne et com si PN ane ei 18s. 24s
f pel ap Ele arecramre nite cc lc enckeis tate eis wean Osi aac 12s
LISTS OF THE ANIMALS IN THE SOCIETY’S GARDENS.
List of the Vertebrated Animals now or lately Living in the Gardens
of the Zoological Society of London, (Highth Edition.) 8vo.
1883. Cloth, 4s. 6d.
List of the Vertebrated Animals now or lately Living in the Gardens
of the Zoological Society of London. (Ninth Edition.) 8vyo.
1896. Cloth, 6s.; Paper, 5s.
Catalogue of the Library of the Zoological Society of London.
(Fifth Edition.) 8yvo. 1902. Cloth, 6s.; Paper, 5s.
These publications may be obtained at the Socrery’s OFFICE
(3 Hanover Square, W.), at Messrs. Lonemans’ (Paternoster Row,
E.C.), or through any bookseller.
ae ZOOCOGTE Min RECORD
—059500——
‘HE object of the Zootoercat Recorp is to give, by means of an
annual Volume, complete lists of the Works and Publications
relating to Zoology in all its branches that have appeared during
the year preceding the issue of the Volume, together with full
information as to the points they deal with, arranged in such a
manner as to serve as an Index to the literature of Zoology in all
parts of the globe, and thus to form a repertory that will retain its
value for the Student in future years.
The ‘Zoological Record,’ after Vol. 40, will be published by
the Society at the price of 40s. per volume. But all Members of the
Zoological Society of London will have the privilege of receiving it,
including the cost of delivery, at a subscription price of 30s. per
annum. ‘This Subscription is due on the Ist of July in every year,
and the privilege of Subscription is forfeited unless the amount be
paid before the 1st of December following.
The Zoological Society, having purchased the entire stock of
the ‘ Zoological Record,’ is able to supply complete scts. The
thirty-seven Volumes to the end of the nineteenth century, and the
Index-Volume (1880-1900) in addition, will be supplied for £15
net (or without the Index-Volume, for £14 10s. net). Volumes of
any single year (exclusive of the last five volumes and Vol. 6) can
likewise be supplied at 10s. per volume net.
The price of the Index Zoologicus (Index-Volume 1820-1900)
is 20s., to Fellows 18s.
Members of the Society wishing to subscribe to the ‘ Record °
are requested to apply at this office for a Form, to be returned
when filled up and signed by the subscriber. In order to facilitate
the payment of the subscription, a Banker’s Order Form is also
supplied to those who prefer that mode of payment. This order,
when filled up and signed, should be sent to the Society’s office for
registration ; it will then be sent to the Agents named therein.
Learned Societies and Institutions and members of the former
Zoological Record Association are permitted to subscribe to the
‘Record’ on the same conditions as are accorded to Members of
the Zoological Society.
The divisions of the ‘Zoological Record’ may be obtained
separately as shown on the next page.
SEPARATE DIVISIONS OF THE ZOOLOGICAL RECORD.
At present each Volume of the Zoonogicat Recorp consists of
~0 separately paged Divisions. These may be obtained separately,
in paper covers, stitched and lettered.
The following are the Divisions and their net prices, viz. :—
Ss
List of abbreviations of journals, ete. 20
Special Records, viz. :—
I. General Subjects .. 26
II. Mammalia 2 6
HII. Aves ee ae 60
TV. Reptilia and Batrachia.. BG
VY. Pisces BS
VI. Tunicata 160)
VII. Moilusea 4 0
VIII. Brachiopoda .. 10
IX. Bryozoa I 9
X. Crustacea Bie (S
XI. Arachnida x
XII. Myriopoda 6
XIII. Insecta .. 12 0
XIV. Echinoderma 3 6
XV. Vermes .. Bie
XVI. Coelenterata .. i ©
XVII. Spongice 2 0
XVIII. Protozoa 270
20
Index of new names of genera and subgenera
On receipt of the price any Division will be forwarded as soon
as ready.
These separate Divisions can be obtained from the Zoological
Society, 3 Hanover Square, London, and also from the following
Agents: Friedlinder & Sohn, 11 Carlstrasse, Berlin; Librairie —
A. Hermann, 6 rue Sorbonne, Paris. Cheques and Post-Office
Orders should be made payable to ‘‘ The Zoological Society,” and
crossed ‘* Drummond’s,”
P. CHALMERS MITCHELL,
Secretary.
October, 1905.
ZoonoGcicaL Sociery or Lonpon,
3 Hanover Square, W.
LIST OF VOLUMES or rae ‘ZOOLOGICAL RECORD.’
The Record of Zoological Literature, 1864-1868, Vols. 1.-v.
Edited by Apert C. L. G. Gunruer, M.A., M.D., Ph.D., F.Z8., &.
Price 10s. each Volume. Net.
The Record of Zoological Literature, 1869, Volume Sixth.
Edited by Arberr C. L. G. Gtnruer, M.A., M.D., Ph.D., F.RB.S.,
¥.Z.8., &e. Tondon, 1870. Price 30s.
The Zoological Record for 1870-1872, Vols. vir.-1x. Hdited
by Atrrep Newton, M.A., F.R.S., F.LS., V.P.Z.S., &e. Price 10s.
each Volume. Net.
The Zoological Record for 1873-1883, Vols. x.-xx. Edited by
Epwarp Carpwett Rye, F.Z.S., M.E.8. Price 10s. each Volume. Net.
The Zoological Record for 1884, 1885, Vols. xx1., xx. Edited
by F. Jerrrey Bert, M.A. Price 10s. each Volume. Net.
The Zoological Record for 1886-1890, Vols. xx11.—Xxxvit.
Edited by Frank E. Bepparp, M.A., F.Z.S8. Price 10s. each
Volume. Net.
The Zoological Record for 1891-1898, Vols. xxvi1I—xxxv.
Edited by D. Suarr, M.A., F.RS., F.Z.S., &e. Price 10s. each
Volume. Net.
The Zoological Record, Volume the Thirty-sixth ; being Records
of Zoological Literature relating chiefly to the year 1899. By
J. A. Thomson, R. Lydekker, R. Bowdler Sharpe, G. A. Boulenger,
W. A. Herdman, E. R. Sykes, E. A. Smith, G. C. Crick, A. W.
Brown, D. Sharp, F. A. Bather, A. Willey, and R. v. Lendenfeld.
Edited (for the Zoclogical Society of London) by Davin Saarp, M.A.,
F.RS., F.Z.S., &. London, 1900. Price 30s.
The Zoological Record, Volume the Thirty-seventh ; being
Records of Zoological Literature relating chiefly to the year 1900.
By J. A. Thomson, R. Lydekker, R. Bowdler Sharpe, G. A. Boulenger,
W. A. Herdman, E. R. Sykes, E. A. Smith, G. C. Crick, A. W.
Brown, D. Sharp, F. A. Bather, A. Willey, and EK. A. Minchin.
Edited (for the Zoological Society of London) by Davip Suarp,
M.A., F.BS., F.Z.S., &c. London, 1901. Price 30s.
The Zoological Record, Volume the Thirty-eighth; being
Records of Zoological Literature relating chiefly to the year 1901.
By J. A. Thomson, R. Lydekker, R. Bowdler Sharpe, G. A. Boulenger,
Alice L. Embleton, E. R. Sykes, E. A. Smith, §. Pace, Albert
Brown, D. Sharp, F. A. Bather, and E. A, Minchin. Edited (for
the Zoological Society of London) by Davin Suarp, M.A., F.R.S.,
T.Z.8., &c. London, 1902. Price 30s.
The Zoological Record, Volume the Thirty-ninth ; being Records
ef Zoological Literature relating chiefly to the year 1902. By
D, Sharp, R. Lydekker, R. Bowdler Sharpe, G. A. Boulenger, W. T.
Calman, E. R. Sykes, E. A. Smith, Alice L. Embleton, F. A. Bather,
di. A. Minchin, and H. M. Woodcock. Edited (for the Zoological
Society of London) by Davin Suarp, M.A., F.R.S., F.Z.S., &.
London, 1903. Price 30s.
The Zoological Record, Volume the Fortieth; being Records of
Zoological Literature relating chiefly to the year 1903. By DE
Sharp, Rt. Lydekker, R. Bowdler Sharpe, G. A. Boulenger, W. T.
Calman, KE. R. Sykes, E. A. Smith, Alice L. Embleton, F. A. Bather,
i. A. Minchin, and H. M. Woodcock. Edited (for the Zoological
Society of London) by Davin Suarp, M.A., F.RS., F.Z.S., ce.
London, 1904. Price 30s.
Index Zoologicus, An alphabetical list of names of genera
and subgenera proposed for use in Zoology, as recorded in the
Zoological Record, 1880-1900; together with other names not
included in the ‘ Nomenclator zoologicus’ of S. H. Scudder. Com-
piled (for the Zoological Society of London) by Cuarres Owen
WarerHouse and edited by Davip Suarp, Editor of the Zoological
Record. London, 1902. Price to Fellows, 18s.; price to the
public, 20s.
These publications may be obtained at the Socrety’s Orricr
(3 Hanover Square, W.).
THE ZOOLOGICAL SOCIETY OF LONDON.
————___2¢ £6733 F_ ——
In consequence of a re-arrangement of the stock of the ‘ Transactions,’
the Society is now able to offer for sale at the reduced price of £30
sets from Vol. V. to XVI. inclusive; also the following
separately, at the price stated against each.
MAMMALS,
Apams, A. LEItH.
On a Species of Dormouse (My-
oxvus) occurring in the Fossil
State in Malta. (1 plate.)
vi. 807.
On the Dentition and Osteology
of the Maltese fossil Elephants,
being a Description of Remains
discovered by the Author in
Malta between the years 1860
and 1866 (22 plates.) .. ix. 1.
Auman, Guoreu J.
On the Characters and Affinities
of Potamogale, a Genus of
Insectivorous Mammals. (2
PlAbeS NF s cineca ene eree
ANDERSON, JOHN.
On the Osteology and Dentition of
Hylomys. (1 plate.) vill. 453,
Bupparpd, Frank E.
On the Structure of Hooker’s Sea-
Lion (Arctocephalus hooker).
(2 OEMS) ooh ao omoe xii. 360.
Contributions to the Anatomy of
the Anthropoid Apes. (9 plates.)
xii. 177.
Contribution towards a Know-
ledge of the Osteology of the
Pigmy Whale (Neobalena mar-
ginata). (3 plates.) .. xvi. 87.
Sir
and TREVES, FRE-
DERICK, Bart.
On the Anatomy of the Sondaic
Rhinoceros. (5 plates.) xi. 185,
ho
Lo
co
Busk, Grorce.
Description of the Remains of
three extinct Species of Ele-
phant, collected by Captain
Spratt, C.B., R.N., inthe Ossi-
ferous Cavern of Zebbug, in the
Island of Malta; partly from
the Notes of the late H. Fal-
coner, M.D. (10 plates.)
vi. 227.
On the Ancient or Quaternary
Fauna of Gibraltar, as exem-
plified in the Mammalian
Remains of the Ossiferous
Breccia. (27 plates.) .. x. 53.
Frownr, Sir Witritam Henry,
K.C.B.
On the Brain of the Javan Loris
(Stenops javanicus Illig.). (1
PLACES) mami tarche wegen v. 105.
Description of the Skeleton of
Inia geoffrensis and of the Skull
of Pontoporia blainvilliit, with
Remarks on the Systematic
Position of these Animals in
the Order Cetacea. (4 plates.)
Wale (oe
On the Osteology of the Cachalot
or Sperm Whale (Physeter
macrocephalus), (% plates.)
vi. 309.
Description of the Skeleton of
the Chinese White Dolphin
(Delphinus sinensis Osheck).
(2iplatesh) hese. ces eters vil. 151.
On Risso’s Dolphin (Grampus
griseus,Cuy. (2 plates.) vill. 1.
memoirs,
Or
bo
(a)
d.
Frownr, Sir W. H. (cont.).
On the Recent Ziphioid Whales,
with a Description of the Ske-
leton of Berardius arnoust.
(BEES) a onocops vil. 205.
A further Contribution to the
Knowledge of the existing
Ziphioid Whales. Genus Meso-
plodon. (3 plates.) .. x. 415.
On the External Characters of
two Species of British Dolphins
(Delphinus delphis Linn., and
Delphinus tursio Fabr.). (1
Places) Sea eye nse es xi dlp
Forsus, W. A.
On the Male Generative Organs
of the Sumatran Rhinoceros
(Ceratorhinus sumatrensis). (1
PIAA Ae teuse sun snctr eine sat, OZ,
Notes on the External Characters
and Anatomy of the Californian
Sea-lion (Otaria gillespii\. (3
plates.) xi, 225.
Garrop, ALFRED Henry.
Notes on the Manatee (Manatus
americanus) recently living in
the Society's Gardens. (3
| OILTUGISS Yorn co acer ae Cena x. 137.
On the Brain of the Sumatran
Rhinoceros (Ceratorhinus su-
matrensis). (1 plate.) x. 41].
On the Brain and other parts of
the Hippopotamus (Z. amphi-
bius). (2 plates.) a sal ILI
Harmer, Sipney F.
On a Specimen of Cervus bel-
grandt Lart. (C._ verticornis
Dawk.) from the Forest-Bed
of Hast Anglia. (1 plate.)
xv. 97.
Lanxestmr, EB. Ray.
On Okapia, a new Genus of
Giraffide, from Central Africa.
(Gupleitess) premier xvi. 279.
Miyvart, St. GHorGE.
Contributions towards a more
complete Knowledge of the
Skeleton of the Primates.
Part I. The Appendicular
Skeleton of Sima, (9 plates.)
vi. 175,
bo
co
5
| Mivart, Sr.Gzor@e, and Morte,
JAMES.
On the Anatomy of the Lemu-
roidea, (6 plates.) .... vii. 1.
Morin, JAMES.
Researches upon the Anatomy of
the Pinnipedia. Part I. On the
Walrus (Trichechus rosmarus
Linn.). (5 plates.).. vii. 411.
Part II. Descriptive Ana-
tomy of the Sea-Lion (Otaria
gubata), (7 plates.) vii. 527.
Part III. Descriptive Ana-
tomy of the Sea-Lion (Otaria
Jjubata). (8 plates.) viii. 501.
On the Female Generative Organs,
Viscera, and Fleshy Parts of
Hyena brunnea Thunberg. (1
plate. ) vii. 503.
On the Form and Structure of the
Manatee (Manatus americanus).
(LOsplabess) Maem ee vill. 127.
On the Organization of the Caaing
Whale (Gilobiocephalus melas).
(Ohplatesh) encase vill. 235.
Further Observations on the
Manatee. (6 plates.).. xi. 19.
eee to ee ee eee
, and Mivarr, Sz. G.
On the Anatomy of the Lemu-
roidea. | (Guplates)) ee eeayinele
Newron, E. T.
On a Skull of Trogontheriwm
cuvtert from the Forest-Bed of
East Runton, near Cromer.
(1 plate.) xili. 165,
Ownny, Sir Ricuarp, K.C.B.
Contributions to the Natural
History of the Anthropoid
Apes. No. VII. Comparison
of the Bones of the Limbs of
the Troglodytes gorilla, Troglo-
dytes minor, and of different
Varieties of the Human Race ;
and on the general Characters
of the Skeleton of the Gorilla.
(@iSaplaitess) ere eennenee Viele
No. VIII. On the External
Characters of the Gorilla (Zro-
glodytes gorilla Say.) (7 plates.)
10
d,
Wo ous, 4b ©
Owen, Sir R. (conz.).
On the Aye-aye ( Chtromys Cuvier;
Chiromys madagascariensis
Desm.; Sciurus madagascari-
ensts Gmel., Sonnerat; Lemur
psilodactylus Schreber, Shaw).
(15 plates.) y. 33.
On some Indian Cetacea collected
eC ee
by Walter Elliot, Esq. (12
PAE) Soceoeoneeohos Vis Ii
Note to Memoir on the Indian
Cetacea collected by Sir Walter
Elliot viele
On the Osteology of the Marsu-
pialia. Part IIT. Modifications
of the Skeleton in the Species
of Phascolomys. (8 plates.)
vill. 345.
Part IV. Bones of the
Trunk and Limbs of Phasco-
lomys. (6 plates.) .. vili. 483.
Part V. Fam. Poephaga,
Genus Macropus. (10 plates.)
ix. 417.
Description of a Portion of Man-
dible and Teeth of a large
extinct Kangaroo (Palorchestes
crassus Ow.) from ancient fluvia-
tile Drift, Queensland. (1 plate.)
5015 (6
OC a
Parker, T. JEFFERY, and Scort,
JOHN H.
On a Specimen of Zphius recently
obtained near Dunedin. (3
plates.) xii. 241.
Peters, W.
Contributions to the Knowledge
of Pectinator,a Genus of Rodent
Manimalia from North-Hastern
Africa, (8 plates.) .. vil. 397.
ee ee
AnpreEws, C. W.
On the Extinct Birds of Pata-
gonia.—I. The Skull andSke-
leton of Phororhachos inflatus
Ameghino, (4 piates,) xy. 55.
(ee)
bo
»
o
d.
©
=
Rouiuston, Guoren.
On the Placental Structures of
the Tenree ( Centetes ecaudatus)
and those of certain other
Mammalia; with Remarks on
the Value of the Placental
System of Classification. (1
plate.) v. 285.
eee eS Ce oe ee coe
| Scrater, Primi Lorry.
On certain Species of Deer now
or lately living in the Society’s
Menagerie. (12plates.) vii. 333.
On the Rhinoceroses now or lately
living in the Society’s Mena-
gerie. (5 plates.).... ix. 645.
Scorr, Jonn H., and Parxsr, T.
J HFFERY.
On a Specimen of Ziphius recently
obtamed near Dunedin. (3
plates) pas 4a. oan xil. 241.
THOMAS, OLDFIELD.
On the Mammals obtained by
Mr. John Whitehead during
his recent Expedition to the
Philippines; with Field-notes
by the Collector. (7 plates.)
SI, Oe
Treves, Sir FREDERICK, Bt., and
BurpparbD, Franx HE.
On the Anatomy of the Sondaic
Rhinoceros. (5 plates.) xii. 183.
Watson, M.
On the Anatomy of the Female
Organs of the Proboscidea.
(ADU) Bee enliee eo 28%, JIL
BIRDS.
0
CunninGHAM, Rospert O.
On some Points in the Anatomy
of the Steamer Duck (Micru-
pterus cinereus). (5 plates.)
Ss.
On
bo
d
(on)
vil. 495. 4 0
Drern, Epwarp.
ENedysis, as Morphological Evi-
dence of the Original Tetra-
dactyle Feathering of the Bird’s
Fore-limb, based “especially on
the Perennial Moult in Gymno-
rhina tibicen. (3 plates.)
xvi. 347.
Finscnu, Orro.
On a Collection of Birds from
North-eastern Abyssinia and
the Bogos Country. With Notes
by the Collector, WitLiam
JussE, C.M.Z.S., Zoologist to
the Abyssinian Expedition. (5
IALESH) erates rtie ere vil. 197.
Gapow, Hans, and Newton,
Sir Epwarp, K.C.M.G.
Cn additional Bones of the Dodo
and other Extinct Birds of
Mauritius obtained by Mr. Théo-
dore Sauzier. (5 plates.)
xi. 281.
Gurney, J. H.
On a Raptorial Bird transmitted
by Mr. Andersson from Damara-
lewacl, (LL qulenes yc uoee OUI“
Haast, JULIUS von.
On Megalapteryx hectori, a new
Gigantic Species of Apterygian
Bird. (1 plate.) .... xii. 161.
On Dinornis owen?, a new Species
of the Dinornithide, with some
Remarks on D. curtus. (2
(EWES) coool soonest oats IAN
Jess, WILLIAM.
On a Collection of Birds from
North-eastern Abyssinia and
the Bogos Country. By Orro
Finscu, Ph.D., C.M.Z.S. With
Notes by the Collector, Wi1-
LIAM JESSE, C.M.Z.S., Zoologist
to the Abyssinian Expedition.
(Gspllatess) asm: cise vii. 197,
Mivart, St. Gores.
On the Axial Skeleton of the
Ostrich (Struthio camelus).
Vili. 385,
Mivart, Sr. G. (cont.).
On the Axial Skeleton of the
MSHAANNEANIOMUCLES ooo eocaac- lle
On the Axial Skeleton of the
Pelecanidee. (7 plates.) x. 516.
Munpes, Gero. P.
On the Myology of the Tongue of
Parrots, with a Classification
of the Order, based upon the
Structure of the Tongue. (4
plates.) Ae eee ected nel, ALI!
Morin, JAMES.
On the Dermal and “Tian al Struc-
tures of the Kagu, Sun-bittern,
and Boatbill. (2 plates.)
vil. 465.
Newron, ALFRED.
On a Picture supposed to repre-
sent the Didine Bird of the
Island of Bourbon (Réunion).
(plate: te saci: Vi, 373.
Newton, Sir Epwarp, K.C.M.G.,
and Gabow, Hans.
On additional Bones of the Dodo
and other Extinct Birds of Mau-
ritius obtained by Mr. Théodore
Sauzier. (5 plates.) xiii. 281.
Newton, E. 1.
On the Remains of a Gigantic
Species of Bird (Gastornis
klaassent, n. sp.) from the Lower
Hocene Beds near Croydon.
(2iplates®) Rares ecrner xii, 143,
Owen, Sir Ricwarp, K.C.B.
Description of the Skeleton of the
Great Auk, or Garfowl (Alca
umpennts TL) (2 plates.) v. 517.
On Dinornis (Part IX.): con-
taining a Description of the
Skull, Atlas, and Scapulo-
coracoid Bone of the Dinornis
robustus Owen. (4 plates.)
vy. 337,
On Dinornis (Part X.): con-
taining a Description of Part
of the Skeleton of a flightless
Bird indicative of a new Genus
and Species (Cnemzornis calci-
trans Owen). (5 plates.) v. 395,
(o>)
Owen, Sir R. (cont.).
On Dinornis (Part XI.): con-
taining a Description of the
Integument of the Sole, and
Tendons of a Toe, of the Foot
of Dinornis robustus Owen.
(Glsplaiten) tsa ces cia vi. 495,
On Dinornis (Part XII.): con-
taining a Description of the
Femur, Tibia, and Metatarsus
of Dinorns maximus Owen.
Ciplatess yy cece: vi. 497.
On Dinornis (Part XIII.) : con-
taining a Description of the
Sternum in Dinornis elephan-
topus and D. rheides; with
Notes on that Bone in WD.
crassus and D. casuarimus.
(@ MANES) dab seo oben vil. 115.
On Dinornis (Part XIV.): con-
taining Contributions to the
Craniology of the Genus, with
a Description of the Fossil
Cranium of Dasornis londinensis
Owen, from the London Clay of
Sheppey. (7 plates.) vii. 128.
On Dinornis (Part XV.): con-
taining a Description of the
Skull, Femur, Tibia, Fibula,
and Metatarsus of Aptornis
defossor Owen, from Oamaru,
Middle Island, New Zealand ;
with additional Observations
on Aptornis otidiformis, on
Notornis mantel, and on
Dinornis curtus. (5 plates.)
Vii. 353.
On Dinornis (Part XVI.): con-
taining Notices of the Internal
Organs of some Species ; with
a Description of the Brain and
some Nerves and Muscles of
the Head of the Apteryx aus-
tralis. (3 plates.) .. vil. 381.
On Dinornis (Part XVII.) : con-
taining a Description of the
Sternum and Pelvis, with an
attempted Restoration, of Apt-
ornis defossor Owen, (8 plates.)
vill. 119.
On Dinornis (Part XVIII.) : con-
taining a Description of the
Pelvis and Bones of the Leg of
Dinornis gravis, (4 plates.)
vil. 361.
iS)
iN)
(J)
Owen, Sir R. (cont.).
On Dinornis (Part XIX.): con-
taining a Description of a Femur
indicative of a new Genus of
large Wingless Bird (Drom-
ornes australis Owen) from a
Post-tertiary Deposit in Queens-
land, Australia. - (2 plates.)
vii. 381.
On Dinornis (Part XX.): con-
tainme a Restoration of the
Skeleton of Cnemiornis culer-
trans Owen, with Remarks on
its Affinities in the Lemelli-
rostral Group. (5 plates.)
ix, 255.
On Dinornis (Part XXI.): con-
. taining a Restoration of the
Skeleton of Dinornis maximus
Owen. With an Appendix on
additional Evidence of the
Genus Dromornis in Australia.
(Seplates.)) wes aseme exon Ae
On Dinornis (Part XXIII.): con-
taining a Description of the
Skeleton of Dinornis parvus
Owen. (8 plates.) .. xi. 233.
On Dinornis (Part XXIV.) : con-
taiing a Description of the
Head and Feet, with their dried
Integuments, of an Individual
of the Species Dinornis didinus
Owen. (8 plates.) .. xi. 257.
On Dinornis (Part XXV.): con-
taining a Description of the
Sternum of Dinornis elephan-
topus. (1 plate:))...... lige le
On the Osteology of the Dodo
(Didus ineptus Linn.). (10
PlALES)okeian «cannes vi. 49.
On the Dodo. Part II. Notes on
the articulated Skeleton of the
Dodo (Didus meptus Linn.) in
the British Museum. (3 plates.)
vil. 513.
Parker, T. JEFFERY.
On the Cranial Osteology, Classi-
fication, and Phylogeny of the
Dinornithide. (7 plates.)
Xill. 573.
Parkpr, WILLIAM KircHen.
On the Osteology of Gallinaceous
Birds and Tinamous. (9 plates.)
v. 149.
id)
bo
0)
0)
Parker, W. K. (cont.).
On some Fossil Birds from the
Zebbug Cave, Malta. (2 plates.)
Wp ILI);
On the Osteology of the Kagu
(Rhinochetus jubatus). (2
(DENSE) so00adc00000 vi. 501.
On Agithoenathous Birds. Part I.
(© jolestes,)) Goasochods ix, 289,
On the Skull of the ®githo-
enathous Birds. Part Il. (9
TEMS a odconneacss08 x ADIL,
On the Morphology of a Reptilian
Bird, Opisthocomus cristatus.
(4 WIAKES)) o005600086 xii. 43,
Purrin, J. BESWICK.
On the Myology of Opisthocomus
cristatus. (4 plates.) ix, 353.
Pycrart, W. P.
A Monograph of the Genus Casu-
arius. By The Hon. WALTER
RotuscHiup, Ph.D. F.ZS.
With a Dissertation on the
Morphology and Phylogeny of
the Paleeognathe (Ratite and
Crypturi) and Neognathe (Ca-
rinate). By W. P. Pycrart.
(24 plates.) xv LOD:
Bou.encnr, G. A.
On a Collection of Fishes from
the Rio Paraguay. (6 plates.)
xiv. 25.
On a Collection of Fishes from
the Rio Jurua, Brazil. (4
TOUMIGE) sodinoa ave ao; xiv. 421.
Report on the Collection of Fishes
made by Mr. J. E. 8. Moore in
Lake Tanganyika during his
Expedition, 1895-96. With
an Appendix by J. E. 8S.
Moorg, A.R.C.8. (8 plates.)
xy. 1.
FISHES.
& ao
2
3 ©
7 6
7 ©
4 0
3.6
7” @
3. (0
2 6
6
Supplementary Notes
RotuscHitp, Hon. WaALter. Sane:
A Monograph of the Genus Casu-
arius. By The Hon. WALTER
RotruscHitp, Ph.D., F.ZS8.
With a Dissertation on the
Morphology and Phylogeny of
the Paleognathe (Ratite and
Crypturi) and Neognathee (Ca-
rinate). By W. P. Pycrart.
(@4eplatess) Reamer rae xy, LOOmaias
SALVIN, OSBERT.
On the Avifauna of the Galapagos
Archipelago. (6 plates.) ix.447. 8 0
SciatEer, Puitip Luriry.
On the Curassows now or lately
living in the Society’s Gardens.
(A lates.) obo conco06 ix. 273. 10 6
on the
Curassows now or lately living
in the Society’s Gardens. (7 .
TOES) 6 pao 2066500005 x. 043; 36) 90
WaALpEN, ARTHUR VISCOUNT.
A List of the Birds known to
inhabit the Island of Celebes.
(Siplatlesn i eexcree ree vii. 23. 8 O
Appendix to a List of Birds
known to inhabit the Island of
Celebes. (8 plates.) vill. 109. 2 6
A List of the Birds known to
inhabit the Philippine Archi-
pelago. (12 plates.).. ix. 125.10 6
Bovuencer, G. A. (cont.).
Second Contribution to the Ich-
thyology of Lake Tanganyika.
—On the Fishes obtained by
the Congo Free State Ex-
pedition under Lieut. Lemaire
in 1898. (8 plates.) .. xv. 87. 2 0
Third Contribution to the Jch-
thyology of Lake Tanganyika.
—Report on the Collection of
Fishes made by Mr. J. E. S.
Moore in Lakes Tanganyika and
Kivu during his Second Expedi-
tion, 1899-1900. (9 plates.)
xvi. 1387. 5 6
Bripen, T. W.
On the Morphology of the Skull
in the Paraguayan Lepedoszren
and in other Dipnoids. (2
TNIEIESE eicis cod eou or xiv. 525,
Bunpertt, J. 8.
On some Points in the Anatomy
of Polypterus. (8 plates.)
xy. 328,
On the Breeding-habits of some
West-African Fishes, with an
Account of the External Fea-
tures in Development of Proto-
pterus annectens, and a Descrip-
tion of the Larva of Polypterus
laprader, (2 plates.) xvi. 115.
On the Structure of the Larval
Polypterus. (8 plates.) xvi. 315.
GoELpI, Emin A.
On the Lepidosiren of the Ama-
zons; being Notes on five
Specimers obtained between
1895-97, and Remarks upon an
Example living in the Para
Museum. (2 plates.) xiv. 413.
GunTHER, ALBERT,
An Account of the Fishes of the
States of Central America,
based on Collections made by
Captain J. M. Dow, F. Godman,
Hsq., and O. Salvin, Esq. (25
plates.) Vi. 377.
Description of a Specimen of
Schedophilus medusophagus, a
Fish new to the British Fauna.
(1 plate.) x1, 223.
oMeogiel oll onleliieicemelralite
eee ee eee og
REPTILES
Bovutmnenr, G. A.
On the Reptiles and Batrachians
of the Solomon Islands. (7
TONES) ome ache Coe Xli. 35.
Catalogue of the Reptiles and
Batrachians of Barbary (Mo-
rocco, Algeria, Tunisia), based
chiefly upon the Notes. and
Collections made in 1880-1884
by M. Fernand Lataste. (6
jNEHIEED)) Gs ako co Ceo DOS Xill. 93,
gS ah
2 ©
3. 6
2a)
4 0
i ©
12 O
i: ©
AND
4 6
6 0
Lankestir, HB. Ray.
On the Hearts of Ceratodus, Proto-
pterus, and Chimera, with an
Account of undescribed Pocket
Valves in the Conus arteriosus
of Ceratodus and of Protopterus.
(2 platest) Baha x. 493.
On the Lepidosiren of Paraguay,
and on the External Characters
of Lepidosiren and Protopterus.
(1 plate.) xive Je
Mivart, St. GEORGE.
Notes. on the Fins of Elasmo-
branchs, with Considerations
on the Nature and Homologues
of Vertebrate Limbs. (6 plates.)
x. 459,
Parker, T. JEFFERY.
On the Intestinal Spiral Valve in
the Genus Raia. (2 plates.)
xi. 49.
Studies in New-Zealand Ichthy-
ology.—I. On the Skeleton of
Regalecus argenteus. (5 plates.)
xi. 5.
Parker, W. K.
On the Structure and Develop-
ment of the Skull in Sharks
and Skates. (9 plates.) x. 189.
Vincent, SwALE.
Contributions to the Comparative
Anatomy and Histology of
the Suprarenal Capsules.—The
Suprarenal Bodies in Fishes,
and their Relation to the so-
called Head-Kidney. (6 plates.)
xiv. 41.
BATRACHIANS.
Bounenesr, G. A. (cont.).
On Remains of an Extinct
Gigantic Tortoise from Mada-
gascar (Lestudo grandidiert
Vaillant). (8 plates.)
xill, 305.
On a Nothosaurian Reptile
from the Trias of Lombardy,
apparently referable to Larvzo-
saius, (i plate) 5. se <tvadle
“I
bho
1
d.
0)
the Egg, on the Hatching, and
Gapow, Hans. By ee
On the Remains of some Gigantic on the Hatched Young. (From
Land-Tortoises, and of an the Huxley Research Labora-
Extinct Lizard, recently dis- tony.) - (Giplates:) Sy.) viele
yered in Mauritius. (3 plates. 7
covered in Mauritius Coe Parker, W. K.
Gray, Joun Epwarp. On the Structure of the Skull in
Cae 4 the Chameleons. (6 plates.)
Synopsis of the Species of Recent ab ae
aces aie) Osea On the Structure and Deve-
Sane Vee "B cae oe lopment of the Skull in the
oe i a e ; Ae eee Urodeles. (6 plates.) xi. 171.
Sonat: ¢ Enola a ege of Sur- On the Structure and Deve-
peopece nue wmng is ee 3 6 lopment of the Skull in the
vi. 125. 3 Crocodilia. (10 plates.)
GinrHEr, ALBERT, zi, 268.
Observations on some rare Reptiles
and a Batrachian now or lately Swinnerton, H. H.,and Howss,
living in the Society’s Mena- G. B.
gerie. (6 plates.).... x1. 215, 3 6 On the Development of the Ske-
leton of the Tuatara, Sphenodon
Howus, G. B., and Swrnnerron, punctatus; with Remarks on
H.H the Ege, on the Hatching, and
On the Development of the Ske- on the Hatched Young. (From
leton of the Tuatara, Sphenodon the Huxley Research Labora-
punctatus; with Remarks on tory.) (6 plates.) .... xvi I.
MOLLUSCA,
AtprEr, JosHua, and Hancock, Hancock, AnBany, and ALDER,
ALBANY. JOSHUA.
Notice of a Collection of Nudi- Notice of a Collection of Nudi-
branchiate Mollusca made in branchiate Mollusca made in
India by Walter Elliot, Esq., India by Walter Elliot, Esq.,
with Descriptions of several with Descriptions of several
new Genera and Species. (6 new Genera and Species. (6
PlOleSD\iaeatsnuiee nec Wo als, 2h (DEWESE)o cooodo nb daaKe v. 113
GEDDES, PATRICK. Owen, Sir Ricuarp, K.C.B.
On the Mechanism of the Odon- Descriptions of some new and
tophore in certain Mollusca. (38 rare Cephalopoda, (Part II.)
UENISS,) oon eat ee soo. x.485, 2 6 (CIS ERS. ))o os 0080058 x15 NG)
BRYOZOA.
Gregory, J. W.
On the British Paleogene Bryozoa.
(4 plates.)
(ee)
op)
26
6 0
aunty 8), ay |)
CRUSTACEA.
Brenuam, W. B. S., LANKESTER, s. and Scorpio; with some Notes
BE. Ray, and Brcx, Miss E.J. on the Anatomy and Generic
On the Muscular and Endo- es ok Scomions: uC :
skeletal Systems of Limulus awe.) ob ete sehen ln 2b
and Scorpio. (12 plates.) Norman, the Rev. A. M., and
xi. 311. 10 SruBBrne, the Rev. T. R. R.
Brapy, GEORGE STEWARDSON. On We erase echoes of tbe
On new or imperfectly known Neeser ae RI eM tS «
Species of Marine Ostracoda. ae Sepedr ame. UA
(Giolatess\ weenie v. 859. 3 PE ORC lela sone ans
A Monograph of the Ostracoda Rozerrson, Davin, and StTEB-
of the Antwerp Crag. (8 BING, the Rev. T. R. R.
(DIENIESL)) 6560000080 3002 Xen OLD Ou cank Taaveel Aram finvedl
A Supplementary Report on the 5 zi a Eye a ee =.
Crustacea of the Group Myodo- Gi plates: ee AS a
copa obtained during the ‘ Chal- SrEBpina, the Rev. THomas R. R.
lenger’ Expedition, with Notes On some new Exotic Amphipoda
onvjother! new or imperfectly- from Singapore and New Treat
known Species. (3 oe) ane ‘ pee an eae acs a 199.
: ues n the Genus Urothve and a new
On new or imperfectly-known 7 ae Au ee eee
Species of Ostracoda, chiefly Genus Urothoides. (4 Cpe
from New Zealand. Cue) 3 Descriptions of nine new Species
: SON of Amphipodous Crustaceans
On the Marine Copepoda of New from the Tropical Atlantic
Zealand. (5 plates.) .. xv. 31. 3 (5 plates.) P sare Sys)
On new or imperfectly-known P ees ma Ree ;
Ostracoda, chiefly from a Col- ,and Normayn,the Rey. A.M.
lection in the Zoological Mu- On the Crustacea Isopoda of the
seum, Copenhagen. (5 plates.) ‘Lightning,’ ‘Porcupine, and
xvi. 179. 3 ‘Valorous’ Expeditions. (12
Lanxester, E. Ray, Bunnam,W. TOIENKEEE)) a eo oob oo sh Kel loadadee
B.S., and Becx, Miss EH. J. , and Rogertson, Davin.
On the Muscular and Endo- On four new British Amphipoda.
skeletal Systems of Limulus (BEE) eb ooo cso cs xii. 31,
ARACHNIDA.
Lanxaster, KH. Ray, Brnnam, W. B.S., and Buck, Miss E. J.
On the Muscular and Endoskeletal Systems of Limulus and Scorpio; with
some Notes on the Anatomy and Generic Characters of Scorpions.
(MBs oo oocssbdsnssoboo0d sao doUboBTEO00 00000 BG TRC ae, NO
10
Or
Burier, ArrnuR GARDINER. s. d. | Luuraner, Franz.
Revision of the Heterocerous A Monograph of the Odonto-
Lepidoptera of the Family labini, a subdivision of the
Sphingide. (5 plates.) ix.511. 7 6 Coleopterous Family Lucanide.
IEE places) petite xi, 885. 10 6
Eiwes, H. J., and Hpwarps, wee )
J AMES. Moors, F.
A Revision of the Oriental Hes- On the Genera and Species of
periide. (10 plates.) xiv. 101. 10 0 the Lepidopterous Subfamily
Ophiderine inhabiting the In-
Fawcerrr, Lt.-Col. J. Matcoum. dian Region. (3 plates). xi. 63.
Notes on the Transformations of =
some South-African Lepido- SmitH, FREDERICK.
ptera. (4 plates.) .. xv. 291. 4 0 Notes on the Habits of some
Hymenopterous Insects from
Horner, CHAarwus. the North-west Provinces of
Notes on the Habits of some India, By Cuartes Horne,
Hymenopterous Insects from Esq., B.C.8., F.Z.8. With an
the North-west Provinces of Appendix containing Descrip-
India. By CHartes Horne. tions of some new Species of
“With an Appendix containing Apide and Vespide collected
Descriptions of some new Spe- by Mr. Horne; by. FREDERICK
cies of Apide and Vespide Smit, of the British Museum.
collected by Mr. Horne ; by Illustrated by Plates from
FrepEerick SmirH, of the Drawings by the Author of
British Museum. Illustrated the Notes. (4 plates.) vi. 161.
by Plates from Drawings by
the Author of the Notes. Westwoop, J. O.
(Aoplatess mies Wu, IG, 7 6 Observations on the Uraniide,
a Family of Lepidopterous
Kirsy, W. F. Insects, sll a on Ee of
A Revision of the Subfamily the Family and a Monograph
Lnbelluline, with Descriptions of Coronidia, one of the Genera
of new Genera and Species. of which it is composed. (4
(@ |S) soccooseas xi. 249° 5 6 MEMES) Goobagabecddes x. OOU Ome
ECHINODERMS.
Brew, Ff. JEFFREY.
INSECTS.
Description of a remarkable new Sea-urchin of the Genus Cidari’s from
Mauritius. (1 plate.)
ersten
Uh Sueno ee ster ot cece etree rene X11, 308,
11
WORMS.
Brpparp, Frank E. s. ad. , M‘IntosH, W. C. Sumas
On the Anatomy and Systematic On British Annelida. (4 plates.)
Position of a Gigantic Earth- ix. 371, 0
worm (Microcheta rappi) from On the Annelida of the ‘ Porcu-
the Cape Colony. (2 plates.) pine’ Expeditions of 1869 and
Xi, 63. 1870, (@ plates: 7... ix. 3905 2m6
CQZELENTERATES.
Atmman, G. J. Duncan, P. M. (cont.).
Report on the Hydroida collected A Description of the Madreporaria
during the Expeditions of dredged up during the Expedi-
HLMLS. ‘ Porcupine.’ (4 plates.) tion of H.M.S. ‘ Porcupine’ in
vil. 469. 1869 and 1870. Part Il. (8
Brit, F. JEYFREY. EE)“ ecnooeneoos x. 235.3 0
Contributions to our Knowledge
of the Antipatharian Corals.
(2 EHS) sodonoancs xiii. 87. Hickson, Sypyuy J.
A Revision of the Genera of the
Duncay, P. Martin. Alcyonaria Stolonifera, with a
A Description of the Madreporaria Description of one new Genus
dredged up during the Expedi- and several new Species. (6
tion of H.M.S. ‘ Porcupine ’ in THEMES) Gonoscood tn xi, 325, 2 6
1869 and 1870. (11 plates.)
vii. 803. 6 O
SPONGES.
Dewnpy, ARTHUR.
Observations on the West-Indian Chalinine Sponges, with Descriptions of
new Species. (6 plates.) ........eee reece erence esse essen xii, 349, 2 6
PROTOZOA.
Bravy, Henry B., Parker, W. Kircuen, and Jonzs, T. Rupert.
On some Foraminifera from the Abrohlos Bank. (8 plates.)...... dg PAL, BO)
vee re CoNTENTS ae e ae An .
Tecorater 12, 1905.
The ee Report: on the Additions to the Society’ s Menagerie Musing. the month of
NGF ONIDEM NOW Dateien csane a Stier s So -cu wis seeing psa ee oak aterceie's seit Peiees ees Oe
_ The Secretary. Exhibition of a coloured print of Polito’s Hoya pmetazeeie at Exeter
AGH hott gers orc fh oi cat ae IS ape nics etane He popenees Merrett oir oehetalapale aperetete ~« 490
Mr. A, H. Cocks, F.Z:8. Exhibition of a series of photographs of Whales taken in East
EGR oPerL yh ie 8 vcs oan. 7 sd uns Sole ep ee eG hoes aL ea ees ee a ws 490
Mr. Geo. P. Mudge, F.2.8. Exhibition of, and remarks upon, a Docket vat abnormal
BL SCTE BNE SiC eee ayatcl alent ons areislartaia as. Tos plavapu taeda nee ene i eiey GO enbeny stan tetaeh uN e a es xe 490
Mr, oe P, ee PZ SS. Exhibition of, and remarks upon, an Ear aes with bifid
ena eta aa soi stapc's mises che ssa 6 shésn Be ia MEP RAS, rere ene e SC
Mr. H. B. Fantham, B.Se., F.Z.8. Exhibition of, and remarks upon, microscopic
preparations of a new Hemosporidian ofthe genus Piroplasimd. fo. s ev ven clea ln 491
Mr. Oldfield Thomas, F.R.S., F.Z.8. Exhibition of, and remarks upon, tails of Dormice
showing regeneration of thawertebvess Aiuite re) Wack meme aes wi oberonietti 491
Dr. W. G. Ridewood, F.Z.S. Exhibition of em eene preparations o of the regenerated
vertebr: of the tails of Dormice ..... eke 494
1. On the Habits and Reactions of Crabs bearing Actinians in their Claws. By J. B.
Dorrven, Ph.D., A.R.C.Sc. (lond.), Professor of Zoology, Rhodes University College,
(Granarnstown: Gane Wolom yin cericiee ateiwaiy to lesa sisi, aswel ale genet en estos ata Stele eats of, shea 494
Lo
. Notes on a Collection of Snakes from Japan and the Loo Choo Islands. Bs Captain
HALL, © MZAS.; Indi Medien bee rrices js iai.s ccvathone vc <eidate Meals sieve nbegiee cs isle dil
3. Description d’un Ophidien nouveau du Mexique (Morenoa orizabensis, & ef, sp. nn.).
ere UG ES, MEDS CMY ZS ees sii ists, a, scdsdre ac a Leal SoG ie tig) ne te etme es Ge 517
4, On a Collection of Mammals from Persia and Armenia presented to the British
- Museum by Col. A. C. Bailward. By Otprimup Tuomas, F.R.S., F.Z.S. (Plate XVI). 519
5. On the Colour-Variation of the Beetle Gonioctena variadilis. By L. Doncaszer, M.A.,
IRE YaST ors age splot cartel olae Misi Sides CAI es Ra ECR TEAS tices eee ye, SA 528
6. On Species of Crustacea of the Genera Ptychognathus Stimps. and Palemon Fabr.
frem Christmas Island, By Dr. J. G. pz May, of Ierseke, Holland. (Plates XVII.
Ne VMTN eos tstsrnpetelelt/efs's eves si ea dingete as fi sbsi bevel, aiaichacsro'm aur ail grr eRelaiftta enetiecin ty DOL
7. Note on Heredity in Pigeons. By Ricmarp Starius-Browne, F.Z.S8.............-- 2s 590
5. Ona new Species of Worm of the Genus Pontodrilus from the Shores of the Red Sea.
By Frank E. Bepparp, M.A., F.R.S., Prosectur to the Society ............6-..0- 558
9. On a new Enchytraid Worm (Hendea lefroyi, sp. n.) from India destructive to the Eggs
of a Locust oe sp.). By Frank E, Bupparp, M.A., F.K.S., Prosector to
the Society ......-.+.-...0 Eee is tire GHA cis hier net a eA e uIOD cea ae ABs Soe She ST 562
10. On new and rare British Mites of the Family Oribatide. By Crcin Warsurtoy,
M.A., E.Z.8., and Niegun D. F. Pearce, M.A. (Plates XLX. & XX.) .............. 564
si On some South Australian Spiders of the Family Ly ge By H. R. Tosa, M.A.,
PLUS AMET tie Hefesraiit sale Siiels, sleia eins aiereee PEPE SER SSS Cr ne SRE TaN DR Reo 569
Index ...... cl aathay A mR ery GN AMR ORT incase Te eta ae SECA oe eg Rent cee Dn SN me de Doe
Sle pan sctas 6 se cA en's veiels ode x ee sae oe meus 5 oi tcaine any = alae annie SR pe he i
Palliat or Couneland! Ofeers:. 305). crsnnaierate aia geese SIE es repr ter si Ors ANe ey tS Ueannat dele ee li-
SR ros OOM LETITe isin catch 6 ceatcles Stetave ciedatos a ob ame mace anes: «rhe xv ating ip hee ett ee cece ae nue ee ui
Atpisibeticalk Hish.of: Comtributors) > sc)yareicie wae at iesalie aise minis alae jase eee salient) Me xi
DOES Hoy i DAR sy rece cere piee caer ier PR RenNE ay roam ALB Ca Co ea atic Sana eat Gleaner Aree ee XX1
histo Wextefieures’: stieeie. so. viele ae Fae erie by RRS pase CN ae H Oise Spatial EXiiL
Dist or om teterio Lovmng tics e s/s. <u says es eRe GEN. Ws tess ye ach ace GeRe RENE
LIST OF PLATES.
1905,--V OT. 11.
PART IL
Plate Page
VIEL. White-maned Serow (Nemorhedus arqyrochetes) ......++--.. 829
IX. Mustela nelampus bed fords yoo. ieee te eis we eco nts oe vcun es 33]
X. 1. Galawxias affinis. 2. He huttont. 3. G.punctifer. 4. G.lyne. \
‘ eal
IGE, als Galawias weedomt. 2. G. wantit. 3. G.olidus. 4. G. occi- |
GONLALS. iin hE Oia TE BONO MAN Re UTE CE Oyen Nei
363:
XII. 1. Galawxias attenuatus. ° 2. G.cotii ...-+.. a
XIII. 1. Galavias auratus. 2. G. attenuatus. a 6. nal
4. G. trutiaceus...... BS Seas sete reer ant shes est ea y)
oe \ New species of Bladder-clawed Halticide .........--...0+-- 398
SRVAL o, Calomey/SCUS UCL MAMA otra slateisiets eps cte Coie) eee ya iole lcroke noite 51D
XVII. Figs. 1-5. Ptychognathus pusillus, Fig. 6. P. bar birt ave ets \
XVIII. Figs. 7-15. Palemon (Eupalemon) lar, var. Figs. 16-19. 5 OT
Pe: (Lupalemon) VOOR a tela nee an ete cee cent eee e bene gens y
Dee i | Britis OMD GAG ae einnae Meat ecient Gah ae eee 564
NOTICE.
‘The ‘ Proceedings’ for the year are issued in fows parts, forming two volumes,
as follows:—
: VOL. I,
Part 1. containing papers read in January and February, in June._
ile i aS », March and April, in August.
VOL. Il.
Part I. containing papers read in May and June, in October,
Ii. 7 ‘5 »» November and December, in April.
te
* Proceedings,’ 1905, Vol. II. Part I. was published on October 17th, 1908.
The Abstracts of the papers read at the Scientific Meetings in |
November oe ap 9 Tbe Rees in this Part.
i
i
v
i
ri
i
hs
:
a
waa Wt vote 5 Pale oe ee es eae i 9h poste Bp nap e S »
= ia . on wer ” Pees ~ s ° . om °
ir oaienners
oe " - = : - r o “ : -
Wl
|
ll
SMITHSONIAN INSTITUTION LIBRARIES
3 9088 00847 2250
|